taxonomy (33)
protein (248)
source (48)
structure (16)
composition (1)
disease (15)
reference (73)
site (363)
peptide (316)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Bubalus arnee bubalis (Water buffalo)
- Cricetulus griseus (Chinese hamster)
- Felis catus (Cat)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Nicotiana alata (Persian tobacco)
- Coturnix coturnix (Quail)
- Gallus gallus (Chicken)
- Physomitrella patens
- Caenorhabditis elegans
- Trichinella spiralis
- Helix pomatia (Roman snail)
- Megathura crenulata (Californian giant keyhole limpet)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Limulus polyphemus (Atlantic horseshoe crab)
- Human immunodeficiency virus (Hiv)
- Armoracia rusticana (Horseradish)
- Lupinus luteus (Yellow lupine)
- Phaseolus vulgaris (Kidney bean)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Semliki forest virus
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Schistosoma mansoni
Taxonomy
- Acid ceramidase / Homo sapiens Q13510
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Aminopeptidase n / Homo sapiens P15144
- Apolipoprotein D / Homo sapiens P05090
- Attractin / Homo sapiens O75882
- Azurocidin / Homo sapiens P20160
- Beta-mannosidase / Homo sapiens O00462
- Beta-secretase / Homo sapiens P56817
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens P13688
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens P31997
- Cathepsin D / Homo sapiens P07339
- Cathepsin L1 / Homo sapiens P07711
- Cathepsin Z / Homo sapiens Q9UBR2
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens O75503
- Di-N-acetylchitobiase / Homo sapiens Q01459
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dipeptidyl peptidase 2 / Homo sapiens Q9UHL4
- Eosinophil peroxidase / Homo sapiens P11678
- Ephrin type-a receptor 2 / Homo sapiens P29317
- Epididymal secretory protein E1 / Homo sapiens P61916
- Epididymis-specific alpha-mannosidase / Homo sapiens Q9Y2E5
- Fibronectin / Homo sapiens P02751
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Gamma-interferon-inducible protein 16 / Homo sapiens Q16666
- GDH/6PGL endoplasmic bifunctional protein / Homo sapiens O95479
- Group XV phospholipase A2 / Homo sapiens Q8NCC3
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens P01903
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Integrin alpha-3 / Homo sapiens P26006
- Junctional adhesion molecule c / Homo sapiens Q9BX67
- Lactotransferrin / Homo sapiens P02788
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Legumain / Homo sapiens Q99538
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosomal alpha-mannosidase / Homo sapiens O00754
- Lysosomal protective protein / Homo sapiens P10619
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Melanoma-associated antigen 2 / Homo sapiens P43356
- Mucin-2 / Homo sapiens Q02817
- Multimerin-1 / Homo sapiens Q13201
- Myelin protein zero-like protein 1 / Homo sapiens O95297
- Myeloperoxidase / Homo sapiens P05164
- N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase / Homo sapiens P20933
- N-acetylgalactosamine-6-sulfatase / Homo sapiens P34059
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Periostin / Homo sapiens Q15063
- Phospholipase B-like 1 / Homo sapiens Q6P4A8
- Phospholipase D3 / Homo sapiens Q8IV08
- Plasminogen / Homo sapiens P00747
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Probable serine carboxypeptidase CPVL / Homo sapiens Q9H3G5
- Progranulin / Homo sapiens P28799
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Protein CREG1 / Homo sapiens O75629
- Ribonuclease T2 / Homo sapiens O00584
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Stabilin-1 / Homo sapiens Q9NY15
- Synaptophysin-like protein 1 / Homo sapiens Q16563
- Tenascin / Homo sapiens P24821
- Tetraspanin-3 / Homo sapiens O60637
- Thrombospondin-1 / Homo sapiens P07996
- Thyroglobulin / Homo sapiens P01266
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Tripeptidyl-peptidase 1 / Homo sapiens O14773
- Tryptase alpha/beta-1 / Homo sapiens Q15661
- Tryptase beta-2 / Homo sapiens P20231
- UDP-glucuronosyltransferase 1-1 / Homo sapiens P22309
- UDP-glucuronosyltransferase 1-10 / Homo sapiens Q9HAW8
- UDP-glucuronosyltransferase 1-3 / Homo sapiens P35503
- UDP-glucuronosyltransferase 1-4 / Homo sapiens P22310
- UDP-glucuronosyltransferase 1-5 / Homo sapiens P35504
- UDP-glucuronosyltransferase 1-6 / Homo sapiens P19224
- UDP-glucuronosyltransferase 1-7 / Homo sapiens Q9HAW7
- UDP-glucuronosyltransferase 1-8 / Homo sapiens Q9HAW9
- UDP-glucuronosyltransferase 1-9 / Homo sapiens O60656
- Vascular endothelial growth factor receptor 1 / Homo sapiens P17948
- Vitronectin / Homo sapiens P04004
- Zona pellucida sperm-binding protein 3 / Homo sapiens P21754
- Glycophorin / Bos taurus
- Gp-3 / Bos taurus
- Kappa casein / Bos taurus P02668
- Lactotransferrin / Bos taurus P24627
- Uncharacterized protein from Ovary / Cricetulus griseus
- Uncharacterized protein from Ovary / Cricetulus griseus
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus Q64676
- Acid ceramidase / Mus musculus Q9WV54
- Adhesion G protein-coupled receptor B2 / Mus musculus Q8CGM1
- Adipocyte plasma membrane-associated protein / Mus musculus Q9D7N9
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus P56528
- Alpha-N-acetylglucosaminidase / Mus musculus O88325
- Arylsulfatase G / Mus musculus Q3TYD4
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus Q8BSY0-3
- Attractin / Mus musculus Q9WU60
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Brevican core protein / Mus musculus Q61361
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Cadherin-13 / Mus musculus Q9WTR5
- Cadherin-2 / Mus musculus P15116
- Cadherin-4 / Mus musculus P39038
- Carboxypeptidase E / Mus musculus Q00493
- Cathepsin L1 / Mus musculus P06797
- Cation-independent mannose-6-phosphate receptor / Mus musculus Q07113
- CD166 antigen / Mus musculus Q61490
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Contactin-1 / Mus musculus P12960
- Contactin-2 / Mus musculus Q61330
- Contactin-associated protein 1 / Mus musculus O54991
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- Contactin-associated protein-like 4 / Mus musculus Q99P47
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Dipeptidyl peptidase 2 / Mus musculus Q9ET22
- Disintegrin and metalloproteinase domain-containing protein 9 / Mus musculus Q61072
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus Q9EQG7
- Embigin / Mus musculus P21995
- Excitatory amino acid transporter 2 / Mus musculus P43006
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus P26049
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus Q9D6F4
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Glutamate carboxypeptidase 2 / Mus musculus O35409
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus Q9JL56
- GPI transamidase component PIG-S / Mus musculus Q6PD26
- Group XV phospholipase A2 / Mus musculus Q8VEB4
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Immunoglobulin mu chain C region / Mus musculus P01872
- Immunoglobulin superfamily member 21 / Mus musculus Q7TNR6
- Immunoglobulin superfamily member 3 / Mus musculus Q6ZQA6
- Insulin receptor / Mus musculus P15208
- Insulin-like growth factor 1 receptor / Mus musculus Q60751
- Integrin alpha-6 / Mus musculus Q61739
- Integrin alpha-V / Mus musculus P43406
- Intercellular adhesion molecule 5 / Mus musculus Q60625
- Interferon beta / Mus musculus P01575
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus Q80TS3-2
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Isoform 3 of Neuroplastin / Mus musculus P97300-3
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-10
- Laminin subunit alpha-1 / Mus musculus P19137
- Laminin subunit alpha-2 / Mus musculus Q60675
- Laminin subunit gamma-1 / Mus musculus P02468
- Leucine-rich repeat-containing protein 4 / Mus musculus Q99PH1
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Low-density lipoprotein receptor-related protein 1B / Mus musculus Q9JI18
- Lysosomal alpha-glucosidase / Mus musculus P70699
- Lysosomal protective protein / Mus musculus P16675
- Lysosome-associated membrane glycoprotein 1 / Mus musculus P11438
- Lysosome-associated membrane glycoprotein 2 / Mus musculus P17047
- Mammalian ependymin-related protein 1 / Mus musculus Q99M71
- Metabotropic glutamate receptor 3 / Mus musculus Q9QYS2
- Metal transporter CNNM4 / Mus musculus Q69ZF7
- Myelin-associated glycoprotein / Mus musculus P20917
- Neural cell adhesion molecule 2 / Mus musculus O35136
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neural cell adhesion molecule L1-like protein / Mus musculus P70232
- Neurocan core protein / Mus musculus P55066
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuronal growth regulator 1 / Mus musculus Q80Z24
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Opioid-binding protein/cell adhesion molecule / Mus musculus G5E8G3
- Phospholipase D3 / Mus musculus O35405
- Plexin-A4 / Mus musculus Q80UG2
- Plexin-B1 / Mus musculus Q8CJH3
- Plexin-B2 / Mus musculus B2RXS4
- Plexin-C1 / Mus musculus Q9QZC2
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus Q68FM6
- Protein sidekick-2 / Mus musculus Q6V4S5
- Protocadherin-17 / Mus musculus E9PXF0
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus Q64455
- Rho-associated protein kinase 2 / Mus musculus P70336
- Roundabout homolog 2 / Mus musculus Q7TPD3
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium channel subunit beta-4 / Mus musculus Q7M729
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Sortilin-related receptor / Mus musculus O88307
- Teneurin-2 / Mus musculus Q9WTS5
- Tetraspanin-3 / Mus musculus Q9QY33
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus Q69ZU6
- Thy-1 membrane glycoprotein / Mus musculus P01831
- TM2 domain-containing protein 3 / Mus musculus Q8BJ83
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Tripeptidyl-peptidase 1 / Mus musculus O89023
- VPS10 domain-containing receptor SorCS1 / Mus musculus Q9JLC4
- VPS10 domain-containing receptor SorCS3 / Mus musculus Q8VI51
- Zinc finger protein 521 / Mus musculus Q6KAS7
- Zona pellucida sperm-binding protein 3 / Mus musculus P10761
- Zona pellucida sperm-binding protein matrix / Mus musculus P20239 P10761 Q62005
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Asgp-1 / Rattus norvegicus
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- T-cell surface glycoprotein cd4 / Rattus norvegicus P05540
- Uncharacterized protein from Epidiymis / Rattus norvegicus
- Uncharacterized protein from Testis / Rattus norvegicus
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Ribonuclease s-6 / Nicotiana alata Q40379
- Ovomucoid / Coturnix coturnix
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Uncharacterized protein / Physomitrella patens
- Uncharacterized protein / Caenorhabditis elegans
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Hemocyanin, alpha-d chain / Helix pomatia
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- C-reactive protein / Limulus polyphemus
- Surface protein gp120 / Human immunodeficiency virus
- Peroxidase c1a / Armoracia rusticana P00433
- Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris P02873
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Spike glycoprotein e1 / Semliki forest virus P03315
- Spike glycoprotein e2 / Semliki forest virus P03315
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Circulating cathodic antigen / Schistosoma mansoni O02197
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Colostrum (UBERON_0001914)
- Embryo (UBERON_0000922)
- Epidiymis (UBERON_0001301)
- Hemolymph (UBERON_0001011)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Liver (UBERON_0002107) Cytoplasm (GO_0005737)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) PIR-P3 (CVCL_DD11)
- Ovary (UBERON_0000992) PIR-P8 (CVCL_IQ79)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Spleen (UBERON_0002106)
- Striatum (UBERON_0002345)
- Substantia Nigra (UBERON_0002038)
- Testis (UBERON_0000473)
- Thyroid (UBERON_0002046)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- C6/36 (CVCL_Z230)
- FreeStyle 293-F (CVCL_D603)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- LS174T (CVCL_1384)
- SPC-Mb-92-C6 (CVCL_VT62)
- Sf21 (CVCL_0518)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Seed (BTO_0001226)
- Style (BTO_0001313)
Source
- Free / Lactose / GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Structure 9158
- Free / Lactose / Structure 9219
- N-Linked / No-core / Man(a1-3)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Gal(b1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 10497
- N-Linked / Pauci-Mannose / Structure 10605
- O-Linked / Core 1 / Gal(a1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 2 / Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / O-Man / Structure 11416
- O-Linked / Undefined core / Gal(?1-3)[Gal(?1-4)GlcNAc(?1-6)]GalNAc+"+ Gal(?1-?)"
- O-Linked / Undefined core / Gal(?1-3)Gal(?1-4)GlcNAc(b1-3)Gal(?1-3)GalNAc
- O-Linked / Undefined core / Hex(?1-?)HexNAc(?1-?)Hex(?1-?)[Hex(?1-?)]HexNAc
Reported structure
- Hex:3 HexNAc:2 (avg mass : 910.8325 )
Composition
- Adenocarcinoma (DOID:299)
- Cancer, breast (DOID:1612)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Gaucher Disease (DOID:1926)
- Hyperimmune condition
- IgE myeloma (DOID:9538)
- Mannosidosis, alpha (DOID:3413)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Parkinson's disease (DOID:14330)
- Prostate cancer (DOID:10283)
Disease
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Quantitation and isomeric structure analysis of free oligosaccharides present in the cytosol fraction of mouse liver: detection of a free disialobiantennary oligosaccharide and glucosylated oligomannosides. (1999 - Ohashi S, Iwai K, Mega T, Hase S) / Status : Reviewed
- A novel pentasaccharide from immunostimulant oligosaccharide fraction of buffalo milk. (1999 - Saksena R, Deepak D, Khare A, Sahai R, Tripathi L, Srivastava V) / Status : Reviewed
- New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Primary structure of 21 novel monoantennary and diantennary N-linked carbohydrate chains from alphaD-hemocyanin of Helix pomatia. (1997 - Lommerse J, Thomas-Oates J, Gielens C, Praux G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- The immunologically reactive O-linked polysaccharide chains derived from circulating cathodic antigen isolated from the human blood fluke Schistosoma mansoni have Lewis x as repeating unit. (1994 - van Dam G, Bergwerff A, Thomas-Oates J, Rotmans J, Kamerling J, Vliegenthart J, Deelder A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Molecular characterization of Limulus polyphemus C-reactive protein. II. Asparagine-linked oligosaccharides. (1993 - Amatayakul-Chantler S, Dwek R, Tennent G, Pepys M, Rademacher T) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Asparagine-linked oligosaccharides of Semliki Forest virus grown in mosquito cells. (1992 - Naim HY, Koblet H) / Status : Reviewed
- Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Isolation of Chinese hamster ovary cell lines producing Man3GlcNAc2 asparagine-linked glycans. (1991 - Zeng Y, Lehrman M) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- Swainsonine induces the production of hybrid glycoproteins and accumulation of oligosaccharides in male reproductive tissues of the rat. (1990 - Tulsiani DR, Skudlarek MD, Orgebin-Crist MC) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Carbohydrate structures of quail ovomucoid. Characterization of degraded oligosaccharides produced during alkaline hydrolysis of the asparaginyl-N-acetylglucosamine linkage. (1990 - Alonso J, Boulengueur P, Wieruszeski J, Leroy Y, Montreuil J, Fournet B) / Status : Reviewed
- Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
- Isolation and structural studies of the neutral oligosaccharide units from bovine glycophorin. (1981 - Fukuda K, Tomita M, Hamada A) / Status : Reviewed
- Structure of the asialyl oligosaccharide chains of kappa-casein isolated from ovine colostrum. (1980 - Soulier S, Sarfati R, Szab L) / Status : Reviewed
Reference
- Acid ceramidase / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Asn-124
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Attractin / Homo sapiens
- Azurocidin / Homo sapiens
- Beta-mannosidase / Homo sapiens
-
Beta-secretase / Homo sapiens
- Undefined site
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Asn-197
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens
- Cathepsin D / Homo sapiens
- Cathepsin L1 / Homo sapiens
- Cathepsin Z / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Di-N-acetylchitobiase / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 2 / Homo sapiens
- Eosinophil peroxidase / Homo sapiens
- Ephrin type-a receptor 2 / Homo sapiens
- Epididymal secretory protein E1 / Homo sapiens
- Epididymis-specific alpha-mannosidase / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Gamma-interferon-inducible protein 16 / Homo sapiens
- GDH/6PGL endoplasmic bifunctional protein / Homo sapiens
- Group XV phospholipase A2 / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Integrin alpha-3 / Homo sapiens
- Junctional adhesion molecule c / Homo sapiens
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Legumain / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosomal protective protein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Melanoma-associated antigen 2 / Homo sapiens
- Mucin-2 / Homo sapiens
- Multimerin-1 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase / Homo sapiens
- N-acetylgalactosamine-6-sulfatase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Phospholipase B-like 1 / Homo sapiens
- Phospholipase D3 / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Polymeric immunoglobulin receptor / Homo sapiens
- Probable serine carboxypeptidase CPVL / Homo sapiens
- Progranulin / Homo sapiens
-
Prorenin / Homo sapiens
- Undefined site
- Prosaposin / Homo sapiens
- Protein CREG1 / Homo sapiens
- Ribonuclease T2 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
- Stabilin-1 / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
- Tenascin / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Tripeptidyl-peptidase 1 / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tryptase beta-2 / Homo sapiens
- UDP-glucuronosyltransferase 1-1 / Homo sapiens
- UDP-glucuronosyltransferase 1-10 / Homo sapiens
- UDP-glucuronosyltransferase 1-3 / Homo sapiens
- UDP-glucuronosyltransferase 1-4 / Homo sapiens
- UDP-glucuronosyltransferase 1-5 / Homo sapiens
- UDP-glucuronosyltransferase 1-6 / Homo sapiens
- UDP-glucuronosyltransferase 1-7 / Homo sapiens
- UDP-glucuronosyltransferase 1-8 / Homo sapiens
- UDP-glucuronosyltransferase 1-9 / Homo sapiens
- Vascular endothelial growth factor receptor 1 / Homo sapiens
- Vitronectin / Homo sapiens
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
-
Glycophorin / Bos taurus
- Undefined site
-
Gp-3 / Bos taurus
- Undefined site
-
Kappa casein / Bos taurus
- Undefined site
- Lactotransferrin / Bos taurus
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- Acid ceramidase / Mus musculus
- Adhesion G protein-coupled receptor B2 / Mus musculus
- Adipocyte plasma membrane-associated protein / Mus musculus
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- Alpha-N-acetylglucosaminidase / Mus musculus
- Arylsulfatase G / Mus musculus
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus
- Attractin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-2 / Mus musculus
- Cadherin-4 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Cathepsin L1 / Mus musculus
- Cation-independent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-2 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Dipeptidyl peptidase 2 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 9 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Embigin / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glutamate carboxypeptidase 2 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus
- GPI transamidase component PIG-S / Mus musculus
- Group XV phospholipase A2 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus
- Immunoglobulin superfamily member 21 / Mus musculus
- Immunoglobulin superfamily member 3 / Mus musculus
- Insulin receptor / Mus musculus
- Insulin-like growth factor 1 receptor / Mus musculus
- Integrin alpha-6 / Mus musculus
- Integrin alpha-V / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
-
Interferon beta / Mus musculus
- Undefined site
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 3 of Neuroplastin / Mus musculus
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Laminin subunit alpha-1 / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucine-rich repeat-containing protein 4 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosomal protective protein / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Mammalian ependymin-related protein 1 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Metal transporter CNNM4 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal growth regulator 1 / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-A4 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus
- Protein sidekick-2 / Mus musculus
- Protocadherin-17 / Mus musculus
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus
- Rho-associated protein kinase 2 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-4 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sortilin-related receptor / Mus musculus
- Teneurin-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- TM2 domain-containing protein 3 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- VPS10 domain-containing receptor SorCS1 / Mus musculus
- VPS10 domain-containing receptor SorCS3 / Mus musculus
- Zinc finger protein 521 / Mus musculus
-
Zona pellucida sperm-binding protein 3 / Mus musculus
- Undefined site
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Asgp-1 / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Epidiymis / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Testis / Rattus norvegicus
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Ovomucoid / Coturnix coturnix
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Hemocyanin, alpha-d chain / Helix pomatia
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
C-reactive protein / Limulus polyphemus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
-
Spike glycoprotein e1 / Semliki forest virus
- Undefined site
-
Spike glycoprotein e2 / Semliki forest virus
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
Circulating cathodic antigen / Schistosoma mansoni
- Undefined site
Reported glycosite
- NATEAAWR (8aa)
- HENNTKDNSIQHEFSLTR (18aa)
- WQMNFTVR (8aa)
- GGSLWLNCSTNCPRPER (17aa)
- YETTNK (6aa)
- GQSYSVNVTFTSNIQSK (17aa)
- VLDPDFHENYFEQYMDHFNFESFGNK (26aa)
- SNVTWF (6aa)
- FSNVTWF (7aa)
- FSNVTW (6aa)
- QGNASDVILR (10aa)
- WKLNK (5aa)
- APLVNVTLYYEALCGGCR (18aa)
- CIQANYSLMEN (11aa)
- CIQANYSIMENGK (13aa)
- CIQANY (6aa)
- GAWLNR (6aa)
- AIGFENATQAIGR (13aa)
- SNVSVEENVILEKPSHVELK (20aa)
- VAWLNR (6aa)
- WSYNNSETSR (10aa)
- GQTEIQVNCPPAVTENK (17aa)
- FHAIHVSGTNGTKR (14aa)
- ANTTQPGIVEGGQVLK (16aa)
- FHAIHVSGTNGTKRF (15aa)
- HAIHVSGTNGTK (12aa)
- NYTLWR (6aa)
- WVSIDNWTYSK (11aa)
- NGTHFDIDKDPLVTMKPGSGTLVINIMSEGK (31aa)
- DNATQEEILHYLEK (14aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- DNATEEEILVYLEK (14aa)
- IRNVSDTTK (9aa)
- IRNVSDTTKR (10aa)
- VLTLANFTTK (10aa)
- NLTIVDSGLK (10aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- NCTLLLSTLSPELGGK (16aa)
- LVYNR (5aa)
- IAVQFGPGFSWIANFTK (17aa)
- TCDWIPKPNMSASCK (15aa)
- YNLSEVLQGK (10aa)
- AYWPDVIHSFPNR (13aa)
- DAMVGNYTCEVTELSR (16aa)
- ISNVTPADAGIYYCVK (16aa)
- ANATIEVK (8aa)
- EASHYSIHDIVLSYNTSDSTVFPGAVAK (28aa)
- YSVQHMYFTYNLSDTEHFPNAISK (24aa)
- IFYNLSIQ (8aa)
- IFYNLSIQS (9aa)
- FLEPYNDSIQAQK (13aa)
- LVNVSR (6aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- SISNSTAR (8aa)
- HINFTR (6aa)
- ANATLLLGPLR (11aa)
- HRANATLLLGPLR (13aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
- LVTQTIPCNK (10aa)
- LGIYADMGNFTCMGYPGTTLDK (22aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- DAGVVCTNET (10aa)
- TYNGTNPDAASR (12aa)
- VALPAYPASLTDVSLVLSELRPNDSGVYR (29aa)
- DASINIENMQFIHNGTYICDVK (22aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- NGTSFDIHY (9aa)
- NGTSFDIHYG (10aa)
- NGTSFDIHYGSGSL (14aa)
- GNETIVNLIHSTR (13aa)
- LENLSSTESGYTATLTR (17aa)
- IENISSSEMGYTATITR (17aa)
- FTPPVVNVTWIR (12aa)
- FYATNDTEVAQSNFEAIQDFFR (22aa)
- ACQFNR (6aa)
- RACQFNR (7aa)
- NGTILYTMR (9aa)
- NINSSCR (7aa)
- VYMKNVTVVLR (11aa)
- AGPNGTLFVVDAYK (14aa)
- VNETEMDIAK (10aa)
- NFTGGQLHSR (10aa)
- VDVAMPLNFTGGQLHSR (17aa)
- SSANNCTF (8aa)
- VYSSANNCTF (10aa)
- NQSVPLSCCR (10aa)
- DINETIHYMYK (11aa)
- HNLTIFFDVK (10aa)
- VNFTCK (6aa)
- NGSLFAFR (8aa)
- FVNVTVTPEDQCRPNNVCTGVITR (24aa)
- LVDNGTLLYTMR (12aa)
- TSLSAPPNSSSTENPK (16aa)
- NYTVVMSTR (9aa)
- YYNYTISINGK (11aa)
- DHIHCLGNR (9aa)
- QIGLYPVLVIDSSGYVNPNYTGR (23aa)
- HMSIAINR (8aa)
- INITNIWVIDYFGGPK (16aa)
- LLNQTLR (7aa)
- LLNQTLRENLKK (12aa)
- VINFYAGANQSMNVTCVGK (19aa)
- EDVYRNHSIFIADINQER (18aa)
- IQISNGNR (8aa)
- P13688 Asn-197     Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens
- P06731 Asn-197     Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- P31997 Asn-197     Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens
- LQLSNDNR (8aa)
- NHSIFLADINQER (13aa)
- RNESHLIDFR (10aa)
- VSVNTANVTIGPQIMEVTVYR (21aa)
- NFTMNEK (7aa)
- NVTALLMEAR (10aa)
- TGEANITQIYIQEAIDFIKR (20aa)
- VLVAPPSEEANTTK (14aa)
- GNYSCFVSSPSITK (14aa)
- FVSQTNGNLYIANVESSDRGNYSCFVSSPSITK (33aa)
- GINESYKK (8aa)
- QDQQLQNCTEPG (12aa)
- TNSTFVQALVEHVK (14aa)
- DIILHSTGHNISR (13aa)
- IVTPEEYYNVT (11aa)
- FNHTQTIQQK (10aa)
- YSVANDTGFVDIPKQEK (17aa)
- YSVANDTGFVDIPK (14aa)
- AEFAVANDTGFVDIPQQEK (19aa)
- FINDSIVDPVDSEWFGFYR (19aa)
- VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa)
- VNGTWLQAGVVSWDEGCAQPNRPGIYTR (28aa)
- ELGVVMYNCSCLAR (14aa)
- QNITYLLK (8aa)
- EIGVVMYNCSCIAR (14aa)
- KFHVNYTQPLVAVK (14aa)
- FHVNYTQPLVAVK (13aa)
- RNGTGHGNSTHHGPEYMRC (19aa)
- HMNETSHTQGSLR (13aa)
- GIANLSNFIR (10aa)
- NIETNYTR (8aa)
- VASVININPNTTHSTGSCR (19aa)
- SVLENTTSYEEAK (13aa)
- LAYATINDSR (10aa)
- GSISYINVTR (10aa)
- GSLSYLNVTRK (11aa)
- TNSTQVSDVR (10aa)
- YIGNATAIFFIPDEGK (16aa)
- VTQQSPTSMNQVNLTCR (17aa)
- SAVSTSWLLPYNHTWSHEK (19aa)
- SAVSTSWIIPYNYTWSPEK (19aa)
- LNSSTIK (7aa)
- DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- TPMTNSSIQFIDNAFRK (17aa)
- IMESHPNGTFSAK (13aa)
- ANHSGAVVLLKR (12aa)
- IIAPAYFIIGGNQSGEGCVITR (22aa)
- GGNQSGEGCVITR (13aa)
- QVNFTVDEHRR (11aa)
- VFVYTPTTNYTLR (13aa)
- SINLTLDR (8aa)
- EGKFDEVYDALAGAHPNLTVYK (22aa)
- EGKFDEVYDALAGAHPNLTVYKK (23aa)
- FDEVYDALAGAHPNLTVYKK (20aa)
- VIYQNHNK (8aa)
- RDDLHPTLPAGQYFLNITYNYPVHSFDGR (29aa)
- DDLHPTLPAGQYFLNITYNYPVHSFDGR (28aa)
- QINSSISGNIWDK (13aa)
- NDTPKNLTK (9aa)
- IIDGDITSDPSYFQNVTGCSNYYNFIR (27aa)
- ALIYQFSPIYTGNISSFQQCYIFD (24aa)
- ALIYQFSPIYTGNISSFQQ (19aa)
- EDGMLPANR (9aa)
- HEGQEPFIQWIMIISNESAIPHVHTVSYGDDEDSISSAYIQR (42aa)
- AIAGIVYNASGSEHCYDIYR (20aa)
- AANGSLR (7aa)
- KMSNITFR (8aa)
- LDPPCTNTTAPSNYLNNPYVR (21aa)
- FPNITNLCPF (10aa)
- FPNITNL (7aa)
- IIDNNKTEK (9aa)
- LIDNNK (6aa)
- MDPPCTNTTAASTYINNPYVR (21aa)
- VPYNVGPGFAGNFSTQK (17aa)
- GEVFNATR (8aa)
- AQNVSILTLCDATTGVCTK (19aa)
- CPFGEVFNATR (11aa)
- TGTRPSNLANNTI (13aa)
- P35504 Asn-348     UDP-glucuronosyltransferase 1-5 / Homo sapiens
- Q9HAW9 Asn-344     UDP-glucuronosyltransferase 1-8 / Homo sapiens
- P19224 Asn-346     UDP-glucuronosyltransferase 1-6 / Homo sapiens
- P22309 Asn-347     UDP-glucuronosyltransferase 1-1 / Homo sapiens
- Q9HAW8 Asn-344     UDP-glucuronosyltransferase 1-10 / Homo sapiens
- P22310 Asn-348     UDP-glucuronosyltransferase 1-4 / Homo sapiens
- P35503 Asn-348     UDP-glucuronosyltransferase 1-3 / Homo sapiens
- Q9HAW7 Asn-344     UDP-glucuronosyltransferase 1-7 / Homo sapiens
- O60656 Asn-344     UDP-glucuronosyltransferase 1-9 / Homo sapiens
- QAIHVGNQTFNDGTIVEK (18aa)
- GELNSTLFSSRPK (13aa)
- VQPFNVTQGK (10aa)
- NLSLNIHGK (9aa)
- GPGIKPNQTSK (11aa)
- DLNISEDR (8aa)
- LNHSLDK (7aa)
- ANITWSVK (8aa)
- IYNASELPVR (10aa)
- RFNHTCLTFTTR (12aa)
- NFSSCSAEDFEK (12aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- DLQGNPIANATISVDGIDHDVTSAK (25aa)
- QVVENMTR (8aa)
- AIIPFDNIHDDPCIITNR (18aa)
- HQNQTLR (7aa)
- GASNITWR (8aa)
- VPAELNGSMYR (11aa)
- NSTKQEIIAAIEK (13aa)
- VFHIHNESWVLLTPK (15aa)
- VGVHINNTQTK (11aa)
- ANQTALCGGGVQTR (14aa)
- INFTAPFNPNK (11aa)
- VICTGPNDTSPGSPR (15aa)
- NHSLAFVGTK (10aa)
- LSEIHKDQPGHPVNR (15aa)
- SSSHLPPSSYFNASGR (16aa)
- FISSSPHIPPSSYFNASGR (19aa)
- VILYNR (6aa)
- FNSTEYQVVTR (11aa)
- DGGSPPLNSTK (11aa)
- GTEWLVNSSR (10aa)
- NSTKEEILAALEK (13aa)
- GTEILGNSTR (10aa)
- VPGNVTAVIGETIK (14aa)
- GVFITNETGQPIIGK (15aa)
- YNCTATNR (8aa)
- FFPYANGTLSIR (12aa)
- IIISPEENVTLTCTAENQLER (21aa)
- ANSTGTLVITNPTR (14aa)
- GKANSTGTLVITNPTR (16aa)
- ALADVLQDIADDNSSR (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- ANSTGILSVR (10aa)
- SVYNCSGEACSGHNR (15aa)
- SVYNCSGEACR (11aa)
- CEGPGVPTVTVHNTTDKRR (19aa)
- CEGPGVPTVTVHNTTDK (17aa)
- CEGPGVPTVTVHNTTDKR (18aa)
- VTDEAGHPVPSQIQNSTETPSAYDIIIITTIPGISYR (37aa)
- EICSGNSSQCAPNVHK (16aa)
- DVECGEGHFCHDNQTCCR (18aa)
- RHEEGHMINCTCFGQGR (17aa)
- VVAVSPANISR (11aa)
- AAIPSAIDTNSSK (13aa)
- YIDKGNR (7aa)
- TVIRPFYLTNS (11aa)
- VLSAGGNDSR (10aa)
- FNFTNCASLK (10aa)
- NLSVVILGASDKDLHPNTDPFKFEIHK (27aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVL (19aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- YQDVNCTEVPVAIHADQL (18aa)
- QDVNCTEVPVAIHADQL (17aa)
- LYQDVNCT (8aa)
- NVTDTFKR (8aa)
- NWTITR (6aa)
- VPGNQTSTTLK (11aa)
- FGTVPNGSTER (11aa)
- TPIVQEVHQNFSAWCSQVVR (20aa)
- SNISILR (7aa)
- AIQLNCSVK (9aa)
- VFLNGTHR (8aa)
- LQVTLYNCSFGR (12aa)
- GLLTFVDHLPVTQVVVGDTNR (21aa)
- VVSNNCTDGVR (11aa)
- NLTLK (5aa)
- FHINK (5aa)
- IVSNNCTDGLR (11aa)
- DFGGFNF (7aa)
- NFSQILPDPSK (11aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- VDVMNSTLVK (10aa)
- GYNVTYWWK (9aa)
- YVPFNGTK (8aa)
- NATLAEQAK (9aa)
- NNTIVNK (7aa)
- LNPGNYTAR (9aa)
- GLSPGNYSVR (10aa)
- LLTTNK (6aa)
- VTVIGVATAPQQVISNGVPVSNFTYSPDTK (30aa)
- NLSAPVTLNLR (11aa)
- AEPPLNASAGDQEEK (15aa)
- QSCITEQTQYFFKNDTK (17aa)
- NLNFSTR (7aa)
- INYSIPTGQWVGVQIPR (17aa)
- TGNGSSVQTTGR (12aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- HVTYVPAQEKNF (12aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWF (12aa)
- NGTHWFV (7aa)
- GVFVSNGTHWFVTQR (15aa)
- VNSSLHSQISR (11aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- TANETSAEAYNLLLR (15aa)
- NVTSILELR (9aa)
- NISCVVSDGSAEDFSK (16aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- RIPAINR (7aa)
- GPCSHLCLINHNR (13aa)
- GPCSHLCLINYNR (13aa)
- DNTTCYEFKK (10aa)
- EANSLLSNHSEK (12aa)
- LYWISSGNHTINR (13aa)
- SVTTSLHNK (9aa)
- VETGENCTSPAPK (13aa)
- DGSCIGNSSR (10aa)
- CNASSQFLCSSGR (13aa)
- FGTCSQLCNNTK (12aa)
- GVTHLNISGLK (11aa)
- LNGTDPIVAADSK (13aa)
- YNNTVEIVK (9aa)
Mass spectrometry observed peptide
-
- Free / Lactose
(avg mass : 910.8325)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 910.8325)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 910.8325)
- Milk (UBERON_0001913)
-
- N-Linked / No-core
(avg mass : 910.8325)
- Gaucher Disease (DOID:1926)
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Molecular characterization of Limulus polyphemus C-reactive protein. II. Asparagine-linked oligosaccharides. (1993 - Amatayakul-Chantler S, Dwek R, Tennent G, Pepys M, Rademacher T) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
- Phospholipase a2 / Apis mellifera
-
C-reactive protein / Limulus polyphemus
- Undefined site
-
- N-Linked / No-core
(avg mass : 910.8325)
- Quantitation and isomeric structure analysis of free oligosaccharides present in the cytosol fraction of mouse liver: detection of a free disialobiantennary oligosaccharide and glucosylated oligomannosides. (1999 - Ohashi S, Iwai K, Mega T, Hase S) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
-
Ovalbumin / Gallus gallus
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
- Hemolymph (UBERON_0001011)
-
Hemocyanin / Megathura crenulata
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Embryo (UBERON_0000922)
- Epidiymis (UBERON_0001301)
- Hemolymph (UBERON_0001011)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) PIR-P3 (CVCL_DD11)
- Ovary (UBERON_0000992) PIR-P8 (CVCL_IQ79)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Spleen (UBERON_0002106)
- Testis (UBERON_0000473)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- C6/36 (CVCL_Z230)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- LS174T (CVCL_1384)
- SPC-Mb-92-C6 (CVCL_VT62)
- Sf21 (CVCL_0518)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Seed (BTO_0001226)
- Style (BTO_0001313)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gaucher Disease (DOID:1926)
- Hyperimmune condition
- IgE myeloma (DOID:9538)
- Mannosidosis, alpha (DOID:3413)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Primary structure of 21 novel monoantennary and diantennary N-linked carbohydrate chains from alphaD-hemocyanin of Helix pomatia. (1997 - Lommerse J, Thomas-Oates J, Gielens C, Praux G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Asparagine-linked oligosaccharides of Semliki Forest virus grown in mosquito cells. (1992 - Naim HY, Koblet H) / Status : Reviewed
- Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Isolation of Chinese hamster ovary cell lines producing Man3GlcNAc2 asparagine-linked glycans. (1991 - Zeng Y, Lehrman M) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- Swainsonine induces the production of hybrid glycoproteins and accumulation of oligosaccharides in male reproductive tissues of the rat. (1990 - Tulsiani DR, Skudlarek MD, Orgebin-Crist MC) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Carbohydrate structures of quail ovomucoid. Characterization of degraded oligosaccharides produced during alkaline hydrolysis of the asparaginyl-N-acetylglucosamine linkage. (1990 - Alonso J, Boulengueur P, Wieruszeski J, Leroy Y, Montreuil J, Fournet B) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Beta-secretase / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
- Lactotransferrin / Bos taurus
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Interferon beta / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Epidiymis / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Testis / Rattus norvegicus
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Ovomucoid / Coturnix coturnix
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Hemocyanin, alpha-d chain / Helix pomatia
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
-
Spike glycoprotein e1 / Semliki forest virus
- Undefined site
-
Spike glycoprotein e2 / Semliki forest virus
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- RNGTGHGNSTHHGPEYMRC (19aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
- Ascitic fluid (UBERON_0007795)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
- Bone Marrow (UBERON_0002371)
-
- O-Linked / Core 1
(avg mass : 910.8325)
- Zona Pellucida (UBERON_0000086)
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 910.8325)
- Adenocarcinoma (DOID:299)
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
-
Gp-3 / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Mus musculus
- Undefined site
-
Asgp-1 / Rattus norvegicus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 910.8325)
- Colostrum (UBERON_0001914)
-
Kappa casein / Bos taurus
- Undefined site
-
- O-Linked / O-Man
(avg mass : 910.8325)
-
- O-Linked / Undefined core
(avg mass : 910.8325)
- Zona Pellucida (UBERON_0000086)
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 910.8325)
-
Glycophorin / Bos taurus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 910.8325)
-
Circulating cathodic antigen / Schistosoma mansoni
- Undefined site
-
- Hex:3 HexNAc:2 / N-Linked
(avg mass : 910.8325)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / No-core / Man(a1-3)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Gal(b1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 10497
- N-Linked / Pauci-Mannose / Structure 10605
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Acid ceramidase / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-n-acetylgalactosaminidase / Homo sapiens
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Attractin / Homo sapiens
- Azurocidin / Homo sapiens
- Beta-mannosidase / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens
- Cathepsin D / Homo sapiens
- Cathepsin L1 / Homo sapiens
- Cathepsin Z / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Di-N-acetylchitobiase / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 2 / Homo sapiens
- Eosinophil peroxidase / Homo sapiens
- Ephrin type-a receptor 2 / Homo sapiens
- Epididymal secretory protein E1 / Homo sapiens
- Epididymis-specific alpha-mannosidase / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Gamma-interferon-inducible protein 16 / Homo sapiens
- GDH/6PGL endoplasmic bifunctional protein / Homo sapiens
- Group XV phospholipase A2 / Homo sapiens
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Integrin alpha-3 / Homo sapiens
- Junctional adhesion molecule c / Homo sapiens
- Legumain / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosomal protective protein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Melanoma-associated antigen 2 / Homo sapiens
- Mucin-2 / Homo sapiens
- Multimerin-1 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase / Homo sapiens
- N-acetylgalactosamine-6-sulfatase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Phospholipase B-like 1 / Homo sapiens
- Phospholipase D3 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Probable serine carboxypeptidase CPVL / Homo sapiens
- Progranulin / Homo sapiens
- Prosaposin / Homo sapiens
- Protein CREG1 / Homo sapiens
- Ribonuclease T2 / Homo sapiens
- Serpin h1 / Homo sapiens
- Stabilin-1 / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
- Tenascin / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Tripeptidyl-peptidase 1 / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tryptase beta-2 / Homo sapiens
- UDP-glucuronosyltransferase 1-1 / Homo sapiens
- UDP-glucuronosyltransferase 1-10 / Homo sapiens
- UDP-glucuronosyltransferase 1-3 / Homo sapiens
- UDP-glucuronosyltransferase 1-4 / Homo sapiens
- UDP-glucuronosyltransferase 1-5 / Homo sapiens
- UDP-glucuronosyltransferase 1-6 / Homo sapiens
- UDP-glucuronosyltransferase 1-7 / Homo sapiens
- UDP-glucuronosyltransferase 1-8 / Homo sapiens
- UDP-glucuronosyltransferase 1-9 / Homo sapiens
- Vascular endothelial growth factor receptor 1 / Homo sapiens
- Vitronectin / Homo sapiens
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- Acid ceramidase / Mus musculus
- Adhesion G protein-coupled receptor B2 / Mus musculus
- Adipocyte plasma membrane-associated protein / Mus musculus
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- Alpha-N-acetylglucosaminidase / Mus musculus
- Arylsulfatase G / Mus musculus
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus
- Attractin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-2 / Mus musculus
- Cadherin-4 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Cathepsin L1 / Mus musculus
- Cation-independent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-2 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Dipeptidyl peptidase 2 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 9 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Embigin / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glutamate carboxypeptidase 2 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus
- GPI transamidase component PIG-S / Mus musculus
- Group XV phospholipase A2 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus
- Immunoglobulin superfamily member 21 / Mus musculus
- Immunoglobulin superfamily member 3 / Mus musculus
- Insulin receptor / Mus musculus
- Insulin-like growth factor 1 receptor / Mus musculus
- Integrin alpha-6 / Mus musculus
- Integrin alpha-V / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 3 of Neuroplastin / Mus musculus
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Laminin subunit alpha-1 / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucine-rich repeat-containing protein 4 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosomal protective protein / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Mammalian ependymin-related protein 1 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Metal transporter CNNM4 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal growth regulator 1 / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-A4 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus
- Protein sidekick-2 / Mus musculus
- Protocadherin-17 / Mus musculus
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus
- Rho-associated protein kinase 2 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-4 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sortilin-related receptor / Mus musculus
- Teneurin-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
-
Thrombospondin type-1 domain-containing protein 7A / Mus musculus
Source
Suggested structure
Disease
Reference
Reported glycosite
- Hex:3 HexNAc:2 / N-Linked
(avg mass : 910.8325)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 910.8325)
Reported glycosite
- O-Linked / Undefined core
(avg mass : 910.8325)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 910.8325)
Reported glycosite
- O-Linked / O-Man
(avg mass : 910.8325)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 910.8325)
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 910.8325)
Source
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 910.8325)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
Source
Disease
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 910.8325)
Disease
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 910.8325)
Source
Reported glycosite
- Free / Lactose
(avg mass : 910.8325)
Source
Reported glycosite
- Free / Lactose
(avg mass : 910.8325)
Source
Reported glycosite
- Free / Lactose
(avg mass : 910.8325)