taxonomy (33)
protein (248)
source (43)
structure (15)
composition (1)
disease (10)
reference (69)
site (369)
peptide (356)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Bubalus arnee bubalis (Water buffalo)
- Cricetulus griseus (Chinese hamster)
- Felis catus (Cat)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Nicotiana alata (Persian tobacco)
- Coturnix coturnix (Quail)
- Gallus gallus (Chicken)
- Physomitrella patens
- Caenorhabditis elegans
- Trichinella spiralis
- Helix pomatia (Roman snail)
- Megathura crenulata (Californian giant keyhole limpet)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Limulus polyphemus (Atlantic horseshoe crab)
- Human immunodeficiency virus (Hiv)
- Armoracia rusticana (Horseradish)
- Lupinus luteus (Yellow lupine)
- Phaseolus vulgaris (Kidney bean)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Semliki forest virus
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Schistosoma mansoni
Taxonomy
- Acid ceramidase / Homo sapiens Q13510
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Aminopeptidase n / Homo sapiens P15144
- Apolipoprotein d / Homo sapiens P05090
- Attractin / Homo sapiens O75882
- Azurocidin / Homo sapiens P20160
- Beta-mannosidase / Homo sapiens O00462
- Beta-secretase / Homo sapiens P56817
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens P13688
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens P31997
- Cathepsin D / Homo sapiens P07339
- Cathepsin L1 / Homo sapiens P07711
- Cathepsin Z / Homo sapiens Q9UBR2
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens O75503
- Di-N-acetylchitobiase / Homo sapiens Q01459
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dipeptidyl peptidase 2 / Homo sapiens Q9UHL4
- Eosinophil peroxidase / Homo sapiens P11678
- Ephrin type-a receptor 2 / Homo sapiens P29317
- Epididymal secretory protein E1 / Homo sapiens P61916
- Epididymis-specific alpha-mannosidase / Homo sapiens Q9Y2E5
- Fibronectin / Homo sapiens P02751
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Gamma-interferon-inducible protein 16 / Homo sapiens Q16666
- GDH/6PGL endoplasmic bifunctional protein / Homo sapiens O95479
- Group XV phospholipase A2 / Homo sapiens Q8NCC3
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens P01903
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Integrin alpha-3 / Homo sapiens P26006
- Junctional adhesion molecule c / Homo sapiens Q9BX67
- Lactotransferrin / Homo sapiens P02788
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Legumain / Homo sapiens Q99538
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosomal alpha-mannosidase / Homo sapiens O00754
- Lysosomal protective protein / Homo sapiens P10619
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Melanoma-associated antigen 2 / Homo sapiens P43356
- Mucin-2 / Homo sapiens Q02817
- Multimerin-1 / Homo sapiens Q13201
- Myelin protein zero-like protein 1 / Homo sapiens O95297
- Myeloperoxidase / Homo sapiens P05164
- N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase / Homo sapiens P20933
- N-acetylgalactosamine-6-sulfatase / Homo sapiens P34059
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Periostin / Homo sapiens Q15063
- Phospholipase B-like 1 / Homo sapiens Q6P4A8
- Phospholipase D3 / Homo sapiens Q8IV08
- Plasminogen / Homo sapiens P00747
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Probable serine carboxypeptidase CPVL / Homo sapiens Q9H3G5
- Progranulin / Homo sapiens P28799
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Protein CREG1 / Homo sapiens O75629
- Ribonuclease T2 / Homo sapiens O00584
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Stabilin-1 / Homo sapiens Q9NY15
- Synaptophysin-like protein 1 / Homo sapiens Q16563
- Tenascin / Homo sapiens P24821
- Tetraspanin-3 / Homo sapiens O60637
- Thrombospondin-1 / Homo sapiens P07996
- Thyroglobulin / Homo sapiens P01266
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Tripeptidyl-peptidase 1 / Homo sapiens O14773
- Tryptase alpha/beta-1 / Homo sapiens Q15661
- Tryptase beta-2 / Homo sapiens P20231
- UDP-glucuronosyltransferase 1-1 / Homo sapiens P22309
- UDP-glucuronosyltransferase 1-10 / Homo sapiens Q9HAW8
- UDP-glucuronosyltransferase 1-3 / Homo sapiens P35503
- UDP-glucuronosyltransferase 1-4 / Homo sapiens P22310
- UDP-glucuronosyltransferase 1-5 / Homo sapiens P35504
- UDP-glucuronosyltransferase 1-6 / Homo sapiens P19224
- UDP-glucuronosyltransferase 1-7 / Homo sapiens Q9HAW7
- UDP-glucuronosyltransferase 1-8 / Homo sapiens Q9HAW9
- UDP-glucuronosyltransferase 1-9 / Homo sapiens O60656
- Vascular endothelial growth factor receptor 1 / Homo sapiens P17948
- Vitronectin / Homo sapiens P04004
- Zona pellucida sperm-binding protein 3 / Homo sapiens P21754
- Glycophorin / Bos taurus
- Gp-3 / Bos taurus
- Kappa casein / Bos taurus P02668
- Lactotransferrin / Bos taurus P24627
- Uncharacterized protein from Ovary / Cricetulus griseus
- Uncharacterized protein from Ovary / Cricetulus griseus
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus Q64676
- Acid ceramidase / Mus musculus Q9WV54
- Adhesion G protein-coupled receptor B2 / Mus musculus Q8CGM1
- Adipocyte plasma membrane-associated protein / Mus musculus Q9D7N9
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus P56528
- Alpha-N-acetylglucosaminidase / Mus musculus O88325
- Arylsulfatase G / Mus musculus Q3TYD4
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus A2AL83 Q8BSY0
- Attractin / Mus musculus Q9WU60
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Brevican core protein / Mus musculus Q61361
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Cadherin-13 / Mus musculus Q9WTR5
- Cadherin-2 / Mus musculus P15116
- Cadherin-4 / Mus musculus P39038
- Carboxypeptidase E / Mus musculus Q00493
- Cathepsin L1 / Mus musculus P06797
- Cation-independent mannose-6-phosphate receptor / Mus musculus Q07113
- CD166 antigen / Mus musculus Q61490
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Contactin-1 / Mus musculus P12960
- Contactin-2 / Mus musculus Q61330
- Contactin-associated protein 1 / Mus musculus O54991
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- Contactin-associated protein-like 4 / Mus musculus Q99P47
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Dipeptidyl peptidase 2 / Mus musculus Q9ET22
- Disintegrin and metalloproteinase domain-containing protein 9 / Mus musculus Q61072
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus Q9EQG7
- Embigin / Mus musculus P21995
- Excitatory amino acid transporter 2 / Mus musculus P43006
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus P26049
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus Q9D6F4
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Glutamate carboxypeptidase 2 / Mus musculus O35409
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus Q9JL56
- GPI transamidase component PIG-S / Mus musculus Q6PD26
- Group XV phospholipase A2 / Mus musculus Q8VEB4
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Immunoglobulin mu chain C region / Mus musculus P01872
- Immunoglobulin superfamily member 21 / Mus musculus Q7TNR6
- Immunoglobulin superfamily member 3 / Mus musculus Q6ZQA6
- Insulin receptor / Mus musculus P15208
- Insulin-like growth factor 1 receptor / Mus musculus Q60751
- Integrin alpha-6 / Mus musculus Q61739
- Integrin alpha-V / Mus musculus P43406
- Intercellular adhesion molecule 5 / Mus musculus Q60625
- Interferon beta / Mus musculus P01575
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus Q80TS3-2
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Isoform 3 of Neuroplastin / Mus musculus P97300-3
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-10
- Laminin subunit alpha-1 / Mus musculus P19137
- Laminin subunit alpha-2 / Mus musculus Q60675
- Laminin subunit gamma-1 / Mus musculus P02468
- Leucine-rich repeat-containing protein 4 / Mus musculus Q99PH1
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Low-density lipoprotein receptor-related protein 1B / Mus musculus Q9JI18
- Lysosomal alpha-glucosidase / Mus musculus P70699
- Lysosomal protective protein / Mus musculus P16675
- Lysosome-associated membrane glycoprotein 1 / Mus musculus P11438
- Lysosome-associated membrane glycoprotein 2 / Mus musculus P17047
- Mammalian ependymin-related protein 1 / Mus musculus Q99M71
- Metabotropic glutamate receptor 3 / Mus musculus Q9QYS2
- Metal transporter CNNM4 / Mus musculus Q69ZF7
- Myelin-associated glycoprotein / Mus musculus P20917
- Neural cell adhesion molecule 2 / Mus musculus O35136
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neural cell adhesion molecule L1-like protein / Mus musculus P70232
- Neurocan core protein / Mus musculus P55066
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuronal growth regulator 1 / Mus musculus Q80Z24
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Opioid-binding protein/cell adhesion molecule / Mus musculus G5E8G3
- Phospholipase D3 / Mus musculus O35405
- Plexin-A4 / Mus musculus Q80UG2
- Plexin-B1 / Mus musculus Q8CJH3
- Plexin-B2 / Mus musculus B2RXS4
- Plexin-C1 / Mus musculus Q9QZC2
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus Q68FM6
- Protein sidekick-2 / Mus musculus Q6V4S5
- Protocadherin-17 / Mus musculus E9PXF0
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus Q64455
- Rho-associated protein kinase 2 / Mus musculus P70336
- Roundabout homolog 2 / Mus musculus Q7TPD3
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium channel subunit beta-4 / Mus musculus Q7M729
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Sortilin-related receptor / Mus musculus O88307
- Teneurin-2 / Mus musculus Q9WTS5
- Tetraspanin-3 / Mus musculus Q9QY33
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus Q69ZU6
- Thy-1 membrane glycoprotein / Mus musculus P01831
- TM2 domain-containing protein 3 / Mus musculus Q8BJ83
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Tripeptidyl-peptidase 1 / Mus musculus O89023
- VPS10 domain-containing receptor SorCS1 / Mus musculus Q9JLC4
- VPS10 domain-containing receptor SorCS3 / Mus musculus Q8VI51
- Zinc finger protein 521 / Mus musculus Q6KAS7
- Zona pellucida sperm-binding protein 3 / Mus musculus P10761
- Zona pellucida sperm-binding protein matrix / Mus musculus P20239 Q62005 P10761
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Asgp-1 / Rattus norvegicus
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- T-cell surface glycoprotein cd4 / Rattus norvegicus P05540
- Uncharacterized protein from Epidiymis / Rattus norvegicus
- Uncharacterized protein from Testis / Rattus norvegicus
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Ribonuclease s-6 / Nicotiana alata Q40379
- Ovomucoid / Coturnix coturnix
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein from Egg Cell / Gallus gallus
- Uncharacterized protein from Whole Plant / Physomitrella patens
- Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein from Whole Organism / Trichinella spiralis
- Hemocyanin, alpha-d chain / Helix pomatia
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- C-reactive protein / Limulus polyphemus
- Surface protein gp120 / Human immunodeficiency virus
- Peroxidase c1a / Armoracia rusticana P00433
- Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris P02873
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Spike glycoprotein e1 / Semliki forest virus P03315
- Spike glycoprotein e2 / Semliki forest virus P03315
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Circulating cathodic antigen / Schistosoma mansoni O02197
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Colostrum (UBERON_0001914)
- Embryo (UBERON_0000922)
- Epidiymis (UBERON_0001301)
- Hemolymph (UBERON_0001011)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Liver (UBERON_0002107) Cytoplasm (GO_0005737)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) PIR-P3 (CVCL_DD11)
- Ovary (UBERON_0000992) PIR-P8 (CVCL_IQ79)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Spleen (UBERON_0002106)
- Testis (UBERON_0000473)
- Thyroid (UBERON_0002046)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- C6/36 (CVCL_Z230)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- SPC-Mb-92-C6 (CVCL_VT62)
- Sf21 (CVCL_0518)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Seed (BTO_0001226)
- Style (BTO_0001313)
Source
- Free / Lactose / GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Structure 9158
- Free / Lactose / Structure 9219
- N-Linked / No-core / Man(a1-3)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Gal(b1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 9868
- N-Linked / Undefined core / Structure 9901
- O-Linked / Core 1 / Gal(a1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 2 / Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Undefined core / Gal(?1-3)[Gal(?1-4)GlcNAc(?1-6)]GalNAc+"+ Gal(?1-?)"
- O-Linked / Undefined core / Gal(?1-3)Gal(?1-4)GlcNAc(b1-3)Gal(?1-3)GalNAc
- O-Linked / Undefined core / Hex(?1-?)HexNAc(?1-?)Hex(?1-?)[Hex(?1-?)]HexNAc
Reported structure
- Hex:3 HexNAc:2 (avg mass : 910.8325 )
Composition
- Adenocarcinoma (DOID:299)
- Cancer, breast (DOID:1612)
- Carcinoma, Hepatocellular (DOID:684)
- COVID-19 (DOID:0080600)
- Gaucher Disease (DOID:1926)
- Hyperimmune condition
- IgE myeloma (DOID:9538)
- Mannosidosis, alpha (DOID:3413)
- Myeloma, Multiple (DOID:9538)
- Prostate cancer (DOID:10283)
Disease
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Quantitation and isomeric structure analysis of free oligosaccharides present in the cytosol fraction of mouse liver: detection of a free disialobiantennary oligosaccharide and glucosylated oligomannosides. (1999 - Ohashi S, Iwai K, Mega T, Hase S) / Status : Reviewed
- A novel pentasaccharide from immunostimulant oligosaccharide fraction of buffalo milk. (1999 - Saksena R, Deepak D, Khare A, Sahai R, Tripathi L, Srivastava V) / Status : Reviewed
- New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Primary structure of 21 novel monoantennary and diantennary N-linked carbohydrate chains from alphaD-hemocyanin of Helix pomatia. (1997 - Lommerse J, Thomas-Oates J, Gielens C, Praux G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- The immunologically reactive O-linked polysaccharide chains derived from circulating cathodic antigen isolated from the human blood fluke Schistosoma mansoni have Lewis x as repeating unit. (1994 - van Dam G, Bergwerff A, Thomas-Oates J, Rotmans J, Kamerling J, Vliegenthart J, Deelder A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Molecular characterization of Limulus polyphemus C-reactive protein. II. Asparagine-linked oligosaccharides. (1993 - Amatayakul-Chantler S, Dwek R, Tennent G, Pepys M, Rademacher T) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Asparagine-linked oligosaccharides of Semliki Forest virus grown in mosquito cells. (1992 - Naim HY, Koblet H) / Status : Reviewed
- Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Isolation of Chinese hamster ovary cell lines producing Man3GlcNAc2 asparagine-linked glycans. (1991 - Zeng Y, Lehrman M) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- Swainsonine induces the production of hybrid glycoproteins and accumulation of oligosaccharides in male reproductive tissues of the rat. (1990 - Tulsiani DR, Skudlarek MD, Orgebin-Crist MC) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Carbohydrate structures of quail ovomucoid. Characterization of degraded oligosaccharides produced during alkaline hydrolysis of the asparaginyl-N-acetylglucosamine linkage. (1990 - Alonso J, Boulengueur P, Wieruszeski J, Leroy Y, Montreuil J, Fournet B) / Status : Reviewed
- Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
- Isolation and structural studies of the neutral oligosaccharide units from bovine glycophorin. (1981 - Fukuda K, Tomita M, Hamada A) / Status : Reviewed
- Structure of the asialyl oligosaccharide chains of kappa-casein isolated from ovine colostrum. (1980 - Soulier S, Sarfati R, Szab L) / Status : Reviewed
Reference
- Acid ceramidase / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Asn-124
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Apolipoprotein d / Homo sapiens
- Attractin / Homo sapiens
- Azurocidin / Homo sapiens
- Beta-mannosidase / Homo sapiens
-
Beta-secretase / Homo sapiens
- Undefined site
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens
- Cathepsin D / Homo sapiens
- Cathepsin L1 / Homo sapiens
- Cathepsin Z / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Di-N-acetylchitobiase / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 2 / Homo sapiens
- Eosinophil peroxidase / Homo sapiens
- Ephrin type-a receptor 2 / Homo sapiens
- Epididymal secretory protein E1 / Homo sapiens
- Epididymis-specific alpha-mannosidase / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Gamma-interferon-inducible protein 16 / Homo sapiens
- GDH/6PGL endoplasmic bifunctional protein / Homo sapiens
- Group XV phospholipase A2 / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Integrin alpha-3 / Homo sapiens
- Junctional adhesion molecule c / Homo sapiens
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Legumain / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosomal protective protein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Melanoma-associated antigen 2 / Homo sapiens
- Mucin-2 / Homo sapiens
- Multimerin-1 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase / Homo sapiens
- N-acetylgalactosamine-6-sulfatase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Phospholipase B-like 1 / Homo sapiens
- Phospholipase D3 / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Polymeric immunoglobulin receptor / Homo sapiens
- Probable serine carboxypeptidase CPVL / Homo sapiens
- Progranulin / Homo sapiens
-
Prorenin / Homo sapiens
- Undefined site
- Prosaposin / Homo sapiens
- Protein CREG1 / Homo sapiens
- Ribonuclease T2 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
- Stabilin-1 / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
- Tenascin / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Tripeptidyl-peptidase 1 / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tryptase beta-2 / Homo sapiens
- UDP-glucuronosyltransferase 1-1 / Homo sapiens
- UDP-glucuronosyltransferase 1-10 / Homo sapiens
- UDP-glucuronosyltransferase 1-3 / Homo sapiens
- UDP-glucuronosyltransferase 1-4 / Homo sapiens
- UDP-glucuronosyltransferase 1-5 / Homo sapiens
- UDP-glucuronosyltransferase 1-6 / Homo sapiens
- UDP-glucuronosyltransferase 1-7 / Homo sapiens
- UDP-glucuronosyltransferase 1-8 / Homo sapiens
- UDP-glucuronosyltransferase 1-9 / Homo sapiens
- Vascular endothelial growth factor receptor 1 / Homo sapiens
- Vitronectin / Homo sapiens
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
-
Glycophorin / Bos taurus
- Undefined site
-
Gp-3 / Bos taurus
- Undefined site
-
Kappa casein / Bos taurus
- Undefined site
- Lactotransferrin / Bos taurus
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- Acid ceramidase / Mus musculus
- Adhesion G protein-coupled receptor B2 / Mus musculus
- Adipocyte plasma membrane-associated protein / Mus musculus
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- Alpha-N-acetylglucosaminidase / Mus musculus
- Arylsulfatase G / Mus musculus
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus
- Attractin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-2 / Mus musculus
- Cadherin-4 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Cathepsin L1 / Mus musculus
- Cation-independent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-2 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Dipeptidyl peptidase 2 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 9 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Embigin / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glutamate carboxypeptidase 2 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus
- GPI transamidase component PIG-S / Mus musculus
- Group XV phospholipase A2 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus
- Immunoglobulin superfamily member 21 / Mus musculus
- Immunoglobulin superfamily member 3 / Mus musculus
- Insulin receptor / Mus musculus
- Insulin-like growth factor 1 receptor / Mus musculus
- Integrin alpha-6 / Mus musculus
- Integrin alpha-V / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
-
Interferon beta / Mus musculus
- Undefined site
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 3 of Neuroplastin / Mus musculus
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Laminin subunit alpha-1 / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucine-rich repeat-containing protein 4 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosomal protective protein / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Mammalian ependymin-related protein 1 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Metal transporter CNNM4 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal growth regulator 1 / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-A4 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus
- Protein sidekick-2 / Mus musculus
- Protocadherin-17 / Mus musculus
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus
- Rho-associated protein kinase 2 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-4 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sortilin-related receptor / Mus musculus
- Teneurin-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- TM2 domain-containing protein 3 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- VPS10 domain-containing receptor SorCS1 / Mus musculus
- VPS10 domain-containing receptor SorCS3 / Mus musculus
- Zinc finger protein 521 / Mus musculus
-
Zona pellucida sperm-binding protein 3 / Mus musculus
- Undefined site
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Asgp-1 / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Epidiymis / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Testis / Rattus norvegicus
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Ovomucoid / Coturnix coturnix
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein from Egg Cell / Gallus gallus
- Undefined site
-
Uncharacterized protein from Whole Plant / Physomitrella patens
- Undefined site
-
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein from Whole Organism / Trichinella spiralis
- Undefined site
-
Hemocyanin, alpha-d chain / Helix pomatia
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
C-reactive protein / Limulus polyphemus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
-
Spike glycoprotein e1 / Semliki forest virus
- Undefined site
-
Spike glycoprotein e2 / Semliki forest virus
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
Circulating cathodic antigen / Schistosoma mansoni
- Undefined site
Reported glycosite
- NATEAAWR (8aa)
- HENNTKDNSIQHEFSLTR (18aa)
- WQMNFTVR (8aa)
- GGSLWLNCSTNCPRPER (17aa)
- YETTNK (6aa)
- GQSYSVNVTFTSNIQSK (17aa)
- VLDPDFHENYFEQYMDHFNFESFGNK (26aa)
- SNVTWF (6aa)
- FSNVTWF (7aa)
- FSNVTW (6aa)
- QGNASDVILR (10aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- WKLNK (5aa)
- APLVNVTLYYEALCGGCR (18aa)
- CIQANYSLMEN (11aa)
- CIQANYSIMENGK (13aa)
- CIQANY (6aa)
- GAWLNR (6aa)
- AIGFENATQAIGR (13aa)
- SNVSVEENVILEKPSHVELK (20aa)
- VAWLNR (6aa)
- WSYNNSETSR (10aa)
- GQTEIQVNCPPAVTENK (17aa)
- FHAIHVSGTNGTKR (14aa)
- ANTTQPGIVEGGQVLK (16aa)
- FHAIHVSGTNGTKRF (15aa)
- HAIHVSGTNGTK (12aa)
- NYTLWR (6aa)
- WVSIDNWTYSK (11aa)
- NGTHFDIDKDPLVTMKPGSGTLVINIMSEGK (31aa)
- DNATQEEILHYLEK (14aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- DNATEEEILVYLEK (14aa)
- IRNVSDTTK (9aa)
- IRNVSDTTKR (10aa)
- VLTLANFTTK (10aa)
- NLTIVDSGLK (10aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- NCTLLLSTLSPELGGK (16aa)
- LVYNR (5aa)
- IAVQFGPGFSWIANFTK (17aa)
- TCDWIPKPNMSASCK (15aa)
- YNLSEVLQGK (10aa)
- AYWPDVIHSFPNR (13aa)
- DAMVGNYTCEVTELSR (16aa)
- ISNVTPADAGIYYCVK (16aa)
- ANATIEVK (8aa)
- EASHYSIHDIVLSYNTSDSTVFPGAVAK (28aa)
- YSVQHMYFTYNLSDTEHFPNAISK (24aa)
- IFYNLSIQ (8aa)
- IFYNLSIQS (9aa)
- FLEPYNDSIQAQK (13aa)
- LVNVSR (6aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- SISNSTAR (8aa)
- HINFTR (6aa)
- ANATLLLGPLR (11aa)
- HRANATLLLGPLR (13aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
- LVTQTIPCNK (10aa)
- LGIYADMGNFTCMGYPGTTLDK (22aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- DAGVVCTNET (10aa)
- TYNGTNPDAASR (12aa)
- VALPAYPASLTDVSLVLSELRPNDSGVYR (29aa)
- DASINIENMQFIHNGTYICDVK (22aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- NGTSFDIHY (9aa)
- NGTSFDIHYG (10aa)
- NGTSFDIHYGSGSL (14aa)
- GNETIVNLIHSTR (13aa)
- LENLSSTESGYTATLTR (17aa)
- IENISSSEMGYTATITR (17aa)
- FTPPVVNVTWIR (12aa)
- FYATNDTEVAQSNFEAIQDFFR (22aa)
- ACQFNR (6aa)
- RACQFNR (7aa)
- NGTILYTMR (9aa)
- NINSSCR (7aa)
- VYMKNVTVVLR (11aa)
- AGPNGTLFVVDAYK (14aa)
- VNETEMDIAK (10aa)
- NFTGGQLHSR (10aa)
- VDVAMPLNFTGGQLHSR (17aa)
- SSANNCTF (8aa)
- SEFRVYSSANNCTFEYVSQPFLMDLE (26aa)
- VYSSANNCTFE (11aa)
- SEFRVYSSANNCTFE (15aa)
- VYSSANNCTF (10aa)
- NQSVPLSCCR (10aa)
- DINETIHYMYK (11aa)
- HNLTIFFDVK (10aa)
- VNFTCK (6aa)
- NGSLFAFR (8aa)
- FVNVTVTPEDQCRPNNVCTGVITR (24aa)
- LVDNGTLLYTMR (12aa)
- TSLSAPPNSSSTENPK (16aa)
- NYTVVMSTR (9aa)
- YYNYTISINGK (11aa)
- DHIHCLGNR (9aa)
- QIGLYPVLVIDSSGYVNPNYTGR (23aa)
- HMSIAINR (8aa)
- INITNIWVIDYFGGPK (16aa)
- LLNQTLR (7aa)
- LLNQTLRENLKK (12aa)
- VINFYAGANQSMNVTCVGK (19aa)
- EDVYRNHSIFIADINQER (18aa)
- IQISNGNR (8aa)
- LQLSNDNR (8aa)
- NHSIFLADINQER (13aa)
- RNESHLIDFR (10aa)
- VSVNTANVTIGPQIMEVTVYR (21aa)
- NFTMNEK (7aa)
- NVTALLMEAR (10aa)
- TGEANITQIYIQEAIDFIKR (20aa)
- VLVAPPSEEANTTK (14aa)
- GNYSCFVSSPSITK (14aa)
- FVSQTNGNLYIANVESSDRGNYSCFVSSPSITK (33aa)
- GINESYKK (8aa)
- QDQQLQNCTEPG (12aa)
- TNSTFVQALVEHVK (14aa)
- DIILHSTGHNISR (13aa)
- IVTPEEYYNVT (11aa)
- FNHTQTIQQK (10aa)
- YSVANDTGFVDIPKQEK (17aa)
- YSVANDTGFVDIPK (14aa)
- AEFAVANDTGFVDIPQQEK (19aa)
- FINDSIVDPVDSEWFGFYR (19aa)
- VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa)
- VNGTWLQAGVVSWDEGCAQPNRPGIYTR (28aa)
- ELGVVMYNCSCLAR (14aa)
- QNITYLLK (8aa)
- EIGVVMYNCSCIAR (14aa)
- KFHVNYTQPLVAVK (14aa)
- FHVNYTQPLVAVK (13aa)
- RNGTGHGNSTHHGPEYMRC (19aa)
- HMNETSHTQGSLR (13aa)
- GIANLSNFIR (10aa)
- NIETNYTR (8aa)
- VASVININPNTTHSTGSCR (19aa)
- SVLENTTSYEEAK (13aa)
- LAYATINDSR (10aa)
- GSISYINVTR (10aa)
- GSLSYLNVTRK (11aa)
- TNSTQVSDVR (10aa)
- YIGNATAIFFIPDEGK (16aa)
- VTQQSPTSMNQVNLTCR (17aa)
- SAVSTSWLLPYNHTWSHEK (19aa)
- SAVSTSWIIPYNYTWSPEK (19aa)
- LNSSTIK (7aa)
- DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- TPMTNSSIQFIDNAFRK (17aa)
- IMESHPNGTFSAK (13aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- TFLLKYNENGTITDAVDCALDPLSETK (27aa)
- NGTITDAVDCALDPLSE (17aa)
- ANHSGAVVLLKR (12aa)
- IIAPAYFIIGGNQSGEGCVITR (22aa)
- GGNQSGEGCVITR (13aa)
- QVNFTVDEHRR (11aa)
- VFVYTPTTNYTLR (13aa)
- SINLTLDR (8aa)
- EGKFDEVYDALAGAHPNLTVYK (22aa)
- EGKFDEVYDALAGAHPNLTVYKK (23aa)
- FDEVYDALAGAHPNLTVYKK (20aa)
- VIYQNHNK (8aa)
- RDDLHPTLPAGQYFLNITYNYPVHSFDGR (29aa)
- DDLHPTLPAGQYFLNITYNYPVHSFDGR (28aa)
- QINSSISGNIWDK (13aa)
- NDTPKNLTK (9aa)
- IIDGDITSDPSYFQNVTGCSNYYNFIR (27aa)
- ALIYQFSPIYTGNISSFQQCYIFD (24aa)
- ALIYQFSPIYTGNISSFQQ (19aa)
- EDGMLPANR (9aa)
- HEGQEPFIQWIMIISNESAIPHVHTVSYGDDEDSISSAYIQR (42aa)
- AIAGIVYNASGSEHCYDIYR (20aa)
- AANGSLR (7aa)
- KMSNITFR (8aa)
- LDPPCTNTTAPSNYLNNPYVR (21aa)
- FPNITNLCPF (10aa)
- FPNITNL (7aa)
- KGIYQTSNFRVQPTESIVRFPNITNLCPFGE (31aa)
- FPNITNLCPFGEVFNATR (18aa)
- FPNITNLCPFGE (12aa)
- IIDNNKTEK (9aa)
- LIDNNK (6aa)
- MDPPCTNTTAASTYINNPYVR (21aa)
- VPYNVGPGFAGNFSTQK (17aa)
- GEVFNATR (8aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- AQNVSILTLCDATTGVCTK (19aa)
- CPFGEVFNATR (11aa)
- TGTRPSNLANNTI (13aa)
- QAIHVGNQTFNDGTIVEK (18aa)
- GELNSTLFSSRPK (13aa)
- VQPFNVTQGK (10aa)
- NLSLNIHGK (9aa)
- GPGIKPNQTSK (11aa)
- DLNISEDR (8aa)
- LNHSLDK (7aa)
- ANITWSVK (8aa)
- IYNASELPVR (10aa)
- RFNHTCLTFTTR (12aa)
- NFSSCSAEDFEK (12aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- DLQGNPIANATISVDGIDHDVTSAK (25aa)
- QVVENMTR (8aa)
- AIIPFDNIHDDPCIITNR (18aa)
- HQNQTLR (7aa)
- GASNITWR (8aa)
- VPAELNGSMYR (11aa)
- NSTKQEIIAAIEK (13aa)
- VFHIHNESWVLLTPK (15aa)
- VGVHINNTQTK (11aa)
- ANQTALCGGGVQTR (14aa)
- INFTAPFNPNK (11aa)
- VICTGPNDTSPGSPR (15aa)
- NHSLAFVGTK (10aa)
- LSEIHKDQPGHPVNR (15aa)
- SSSHLPPSSYFNASGR (16aa)
- FISSSPHIPPSSYFNASGR (19aa)
- VILYNR (6aa)
- FNSTEYQVVTR (11aa)
- DGGSPPLNSTK (11aa)
- GTEWLVNSSR (10aa)
- NSTKEEILAALEK (13aa)
- GTEILGNSTR (10aa)
- VPGNVTAVIGETIK (14aa)
- GVFITNETGQPIIGK (15aa)
- YNCTATNR (8aa)
- FFPYANGTLSIR (12aa)
- IIISPEENVTLTCTAENQLER (21aa)
- ANSTGTLVITNPTR (14aa)
- GKANSTGTLVITNPTR (16aa)
- ALADVLQDIADDNSSR (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- ANSTGILSVR (10aa)
- SVYNCSGEACSGHNR (15aa)
- SVYNCSGEACR (11aa)
- CEGPGVPTVTVHNTTDKRR (19aa)
- CEGPGVPTVTVHNTTDK (17aa)
- CEGPGVPTVTVHNTTDKR (18aa)
- VTDEAGHPVPSQIQNSTETPSAYDIIIITTIPGISYR (37aa)
- EICSGNSSQCAPNVHK (16aa)
- DVECGEGHFCHDNQTCCR (18aa)
- RHEEGHMINCTCFGQGR (17aa)
- VVAVSPANISR (11aa)
- AAIPSAIDTNSSK (13aa)
- YIDKGNR (7aa)
- TVIRPFYLTNS (11aa)
- VLSAGGNDSR (10aa)
- FNFTNCASLK (10aa)
- NLSVVILGASDKDLHPNTDPFKFEIHK (27aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVL (19aa)
- ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- YQDVNCTEVPVAIHADQL (18aa)
- QDVNCTEVPVAIHADQL (17aa)
- LYQDVNCT (8aa)
- NVTDTFKR (8aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRR (37aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR (39aa)
- AGCLIGAEHVNNSYE (15aa)
- HVNNSYECDIPIGAGICASYQTQTNSPR (28aa)
- HVNNSYE (7aa)
- NWTITR (6aa)
- VPGNQTSTTLK (11aa)
- FGTVPNGSTER (11aa)
- TPIVQEVHQNFSAWCSQVVR (20aa)
- SNISILR (7aa)
- AIQLNCSVK (9aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- VFLNGTHR (8aa)
- LQVTLYNCSFGR (12aa)
- GLLTFVDHLPVTQVVVGDTNR (21aa)
- VVSNNCTDGVR (11aa)
- NLTLK (5aa)
- FHINK (5aa)
- IVSNNCTDGLR (11aa)
- DFGGFNF (7aa)
- NFSQILPDPSK (11aa)
- DFGGFNFSQILPDPSK (16aa)
- TPPIKDFGGFNFSQILPDPSKPSK (24aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- QIYKTPPIKDFGGFNFSQILPDPSKPSK (28aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIE (39aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- VDVMNSTLVK (10aa)
- GYNVTYWWK (9aa)
- YVPFNGTK (8aa)
- NATLAEQAK (9aa)
- NNTIVNK (7aa)
- LNPGNYTAR (9aa)
- GLSPGNYSVR (10aa)
- LLTTNK (6aa)
- VTVIGVATAPQQVISNGVPVSNFTYSPDTK (30aa)
- NLSAPVTLNLR (11aa)
- AEPPLNASAGDQEEK (15aa)
- QSCITEQTQYFFKNDTK (17aa)
- NLNFSTR (7aa)
- INYSIPTGQWVGVQIPR (17aa)
- TGNGSSVQTTGR (12aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- HVTYVPAQEKNF (12aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPR (46aa)
- KNFTTAPAICHDGK (14aa)
- VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (47aa)
- CVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPRE (61aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWF (12aa)
- NGTHWFV (7aa)
- EGVFVSNGTHWFVTQR (16aa)
- GVFVSNGTHWFVTQR (15aa)
- AHFPREGVFVSNGTHWFVTQR (21aa)
- NFTTAPAICHDGKAHFPR (18aa)
- NFTTAPAICHDGK (13aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
- VNSSLHSQISR (11aa)
- ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
- NHTSPDVDLGDISGINASVVNIQKE (25aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- NLNESLIDLQELGK (14aa)
- VAKNLNE (7aa)
- IDRLNEVAKNLNESLIDLQE (20aa)
- IDRLNEVAKNLNE (13aa)
- NLNESLIDLQE (11aa)
- VAKNLNESLIDLQE (14aa)
- TANETSAEAYNLLLR (15aa)
- NVTSILELR (9aa)
- NISCVVSDGSAEDFSK (16aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- RIPAINR (7aa)
- GPCSHLCLINHNR (13aa)
- GPCSHLCLINYNR (13aa)
- DNTTCYEFKK (10aa)
- EANSLLSNHSEK (12aa)
- LYWISSGNHTINR (13aa)
- SVTTSLHNK (9aa)
- VETGENCTSPAPK (13aa)
- DGSCIGNSSR (10aa)
- CNASSQFLCSSGR (13aa)
- FGTCSQLCNNTK (12aa)
- GVTHLNISGLK (11aa)
- LNGTDPIVAADSK (13aa)
- YNNTVEIVK (9aa)
Mass spectrometry observed peptide
-
- Free / Lactose
(avg mass : 910.8325)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 910.8325)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 910.8325)
- Milk (UBERON_0001913)
-
- N-Linked / No-core
(avg mass : 910.8325)
- Gaucher Disease (DOID:1926)
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Molecular characterization of Limulus polyphemus C-reactive protein. II. Asparagine-linked oligosaccharides. (1993 - Amatayakul-Chantler S, Dwek R, Tennent G, Pepys M, Rademacher T) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
- Phospholipase a2 / Apis mellifera
-
C-reactive protein / Limulus polyphemus
- Undefined site
-
- N-Linked / No-core
(avg mass : 910.8325)
Detected as released in some experiments - Quantitation and isomeric structure analysis of free oligosaccharides present in the cytosol fraction of mouse liver: detection of a free disialobiantennary oligosaccharide and glucosylated oligomannosides. (1999 - Ohashi S, Iwai K, Mega T, Hase S) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
-
Ovalbumin / Gallus gallus
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
- Hemolymph (UBERON_0001011)
-
Hemocyanin / Megathura crenulata
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
Detected as released in some experiments - Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Embryo (UBERON_0000922)
- Epidiymis (UBERON_0001301)
- Hemolymph (UBERON_0001011)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) PIR-P3 (CVCL_DD11)
- Ovary (UBERON_0000992) PIR-P8 (CVCL_IQ79)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Spleen (UBERON_0002106)
- Testis (UBERON_0000473)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- C6/36 (CVCL_Z230)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- SPC-Mb-92-C6 (CVCL_VT62)
- Sf21 (CVCL_0518)
- Egg Cell
- Egg Cell Egg White
- Seed (BTO_0001226)
- Style (BTO_0001313)
- Carcinoma, Hepatocellular (DOID:684)
- Gaucher Disease (DOID:1926)
- Hyperimmune condition
- IgE myeloma (DOID:9538)
- Mannosidosis, alpha (DOID:3413)
- Myeloma, Multiple (DOID:9538)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Primary structure of 21 novel monoantennary and diantennary N-linked carbohydrate chains from alphaD-hemocyanin of Helix pomatia. (1997 - Lommerse J, Thomas-Oates J, Gielens C, Praux G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Asparagine-linked oligosaccharides of Semliki Forest virus grown in mosquito cells. (1992 - Naim HY, Koblet H) / Status : Reviewed
- Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Isolation of Chinese hamster ovary cell lines producing Man3GlcNAc2 asparagine-linked glycans. (1991 - Zeng Y, Lehrman M) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- Swainsonine induces the production of hybrid glycoproteins and accumulation of oligosaccharides in male reproductive tissues of the rat. (1990 - Tulsiani DR, Skudlarek MD, Orgebin-Crist MC) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Carbohydrate structures of quail ovomucoid. Characterization of degraded oligosaccharides produced during alkaline hydrolysis of the asparaginyl-N-acetylglucosamine linkage. (1990 - Alonso J, Boulengueur P, Wieruszeski J, Leroy Y, Montreuil J, Fournet B) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Beta-secretase / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
- Lactotransferrin / Bos taurus
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Interferon beta / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Epidiymis / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Testis / Rattus norvegicus
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Ovomucoid / Coturnix coturnix
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein from Egg Cell / Gallus gallus
- Undefined site
-
Uncharacterized protein from Whole Plant / Physomitrella patens
- Undefined site
-
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein from Whole Organism / Trichinella spiralis
- Undefined site
-
Hemocyanin, alpha-d chain / Helix pomatia
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
-
Spike glycoprotein e1 / Semliki forest virus
- Undefined site
-
Spike glycoprotein e2 / Semliki forest virus
- Undefined site
- RNGTGHGNSTHHGPEYMRC (19aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
Released - Embryo (UBERON_0000922)
-
- N-Linked / Undefined core
(avg mass : 910.8325)
Released - Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
-
- O-Linked / Core 1
(avg mass : 910.8325)
- Zona Pellucida (UBERON_0000086)
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 910.8325)
- Adenocarcinoma (DOID:299)
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
-
Gp-3 / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Mus musculus
- Undefined site
-
Asgp-1 / Rattus norvegicus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 910.8325)
- Colostrum (UBERON_0001914)
-
Kappa casein / Bos taurus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 910.8325)
- Zona Pellucida (UBERON_0000086)
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 910.8325)
-
Glycophorin / Bos taurus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 910.8325)
-
Circulating cathodic antigen / Schistosoma mansoni
- Undefined site
-
- Hex:3 HexNAc:2 / N-Linked
(avg mass : 910.8325)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / No-core / Man(a1-3)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Gal(b1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 9868
- N-Linked / Undefined core / Structure 9901
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Acid ceramidase / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-n-acetylgalactosaminidase / Homo sapiens
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Apolipoprotein d / Homo sapiens
- Attractin / Homo sapiens
- Azurocidin / Homo sapiens
- Beta-mannosidase / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens
- Cathepsin D / Homo sapiens
- Cathepsin L1 / Homo sapiens
- Cathepsin Z / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Di-N-acetylchitobiase / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 2 / Homo sapiens
- Eosinophil peroxidase / Homo sapiens
- Ephrin type-a receptor 2 / Homo sapiens
- Epididymal secretory protein E1 / Homo sapiens
- Epididymis-specific alpha-mannosidase / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Gamma-interferon-inducible protein 16 / Homo sapiens
- GDH/6PGL endoplasmic bifunctional protein / Homo sapiens
- Group XV phospholipase A2 / Homo sapiens
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Integrin alpha-3 / Homo sapiens
- Junctional adhesion molecule c / Homo sapiens
- Legumain / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosomal protective protein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Melanoma-associated antigen 2 / Homo sapiens
- Mucin-2 / Homo sapiens
- Multimerin-1 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase / Homo sapiens
- N-acetylgalactosamine-6-sulfatase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Phospholipase B-like 1 / Homo sapiens
- Phospholipase D3 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Probable serine carboxypeptidase CPVL / Homo sapiens
- Progranulin / Homo sapiens
- Prosaposin / Homo sapiens
- Protein CREG1 / Homo sapiens
- Ribonuclease T2 / Homo sapiens
- Serpin h1 / Homo sapiens
- Stabilin-1 / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
- Tenascin / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Tripeptidyl-peptidase 1 / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tryptase beta-2 / Homo sapiens
- UDP-glucuronosyltransferase 1-1 / Homo sapiens
- UDP-glucuronosyltransferase 1-10 / Homo sapiens
- UDP-glucuronosyltransferase 1-3 / Homo sapiens
- UDP-glucuronosyltransferase 1-4 / Homo sapiens
- UDP-glucuronosyltransferase 1-5 / Homo sapiens
- UDP-glucuronosyltransferase 1-6 / Homo sapiens
- UDP-glucuronosyltransferase 1-7 / Homo sapiens
- UDP-glucuronosyltransferase 1-8 / Homo sapiens
- UDP-glucuronosyltransferase 1-9 / Homo sapiens
- Vascular endothelial growth factor receptor 1 / Homo sapiens
- Vitronectin / Homo sapiens
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- Acid ceramidase / Mus musculus
- Adhesion G protein-coupled receptor B2 / Mus musculus
- Adipocyte plasma membrane-associated protein / Mus musculus
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- Alpha-N-acetylglucosaminidase / Mus musculus
- Arylsulfatase G / Mus musculus
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus
- Attractin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-2 / Mus musculus
- Cadherin-4 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Cathepsin L1 / Mus musculus
- Cation-independent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-2 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Dipeptidyl peptidase 2 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 9 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Embigin / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glutamate carboxypeptidase 2 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus
- GPI transamidase component PIG-S / Mus musculus
- Group XV phospholipase A2 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus
- Immunoglobulin superfamily member 21 / Mus musculus
- Immunoglobulin superfamily member 3 / Mus musculus
- Insulin receptor / Mus musculus
- Insulin-like growth factor 1 receptor / Mus musculus
- Integrin alpha-6 / Mus musculus
- Integrin alpha-V / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 3 of Neuroplastin / Mus musculus
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Laminin subunit alpha-1 / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucine-rich repeat-containing protein 4 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosomal protective protein / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Mammalian ependymin-related protein 1 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Metal transporter CNNM4 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal growth regulator 1 / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-A4 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus
- Protein sidekick-2 / Mus musculus
- Protocadherin-17 / Mus musculus
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus
- Rho-associated protein kinase 2 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-4 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sortilin-related receptor / Mus musculus
- Teneurin-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- TM2 domain-containing protein 3 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- VPS10 domain-containing receptor SorCS1 / Mus musculus
- VPS10 domain-containing receptor SorCS3 / Mus musculus
- Zinc finger protein 521 / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Source
Suggested structure
Reference
Reported glycosite
- Hex:3 HexNAc:2 / N-Linked
(avg mass : 910.8325)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 910.8325)
Reported glycosite
- O-Linked / Undefined core
(avg mass : 910.8325)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 910.8325)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 910.8325)
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 910.8325)
Source
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 910.8325)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 910.8325)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 910.8325)
Disease
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 910.8325)
Source
Reported glycosite
- Free / Lactose
(avg mass : 910.8325)
Source
Reported glycosite
- Free / Lactose
(avg mass : 910.8325)
Source
Reported glycosite
- Free / Lactose
(avg mass : 910.8325)