Hex:5 HexNAc:3

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Rana pipiens (Northern leopard frog)
• Nicotiana alata (Persian tobacco)
• Gallus gallus (Chicken)
• Megathura crenulata (Californian giant keyhole limpet)
• Drosophila melanogaster (Fruit fly)
• Trypanosoma brucei brucei
• Friend murine leukemia virus (F-mulv)
• Carica papaya (Papaya)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein B-100 / Homo sapiens    P04114
• Apolipoprotein D / Homo sapiens    P05090
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Cathepsin D / Homo sapiens    P07339
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Complement c3 / Homo sapiens    P01024
• Decorin / Homo sapiens    P07585
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Fibrillin-1 / Homo sapiens    P35555
• Fibrillin-2 / Homo sapiens    P35556
• Fibrillin-3 / Homo sapiens    Q75N90
• Fibronectin / Homo sapiens    P02751
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Golgi membrane protein 1 / Homo sapiens    Q8NBJ4
• Histone-lysine N-methyltransferase 2A / Homo sapiens    Q03164
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Integrin alpha-M / Homo sapiens    P11215
• Integrin alpha-V / Homo sapiens    P06756
• Interferon gamma / Homo sapiens    P01579
• Lactotransferrin / Homo sapiens    P02788
• Lysosomal alpha-glucosidase / Homo sapiens    P10253
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Monocyte differentiation antigen cd14 / Homo sapiens    P08571
• Myeloperoxidase / Homo sapiens    P05164
• N-acetylglucosamine-6-sulfatase / Homo sapiens    P15586
• Oncostatin-M-specific receptor subunit beta / Homo sapiens    Q99650
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Pentraxin-related protein ptx3 / Homo sapiens    P26022
• Periostin / Homo sapiens    Q15063
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prosaposin / Homo sapiens    P07602
• Rhodopsin / Homo sapiens    P08100
• Sciellin / Homo sapiens    O95171
• Serpin h1 / Homo sapiens    P50454
• SUN domain-containing ossification factor / Homo sapiens    Q9UBS9
• Sushi domain-containing protein 2 / Homo sapiens    Q9UGT4
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Transmembrane 9 superfamily member 3 / Homo sapiens    Q9HD45
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Tumor necrosis factor receptor superfamily member 11B / Homo sapiens    O00300
• Vascular endothelial growth factor receptor 1 / Homo sapiens    P17948
• Vitronectin / Homo sapiens    P04004
• Lactotransferrin / Bos taurus    P24627
• Rhodopsin / Bos taurus    P02699
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Adhesion G protein-coupled receptor B2 / Mus musculus    Q8CGM1
• BDNF/NT-3 growth factors receptor / Mus musculus    P15209
• Cadherin-13 / Mus musculus    Q9WTR5
• Cadherin-6 / Mus musculus    P97326
• Carboxypeptidase E / Mus musculus    Q00493
• Cation-dependent mannose-6-phosphate receptor / Mus musculus    P24668
• CD166 antigen / Mus musculus    Q61490
• Contactin-1 / Mus musculus    P12960
• Contactin-associated protein like 5-3 / Mus musculus    Q0V8T7
• Contactin-associated protein-like 2 / Mus musculus    Q9CPW0
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus    O55026
• Embigin / Mus musculus    P21995
• F-box only protein 38 / Mus musculus    Q8BMI0
• Fibroblast growth factor receptor 1 / Mus musculus    P16092
• Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus    P63137
• Hepatocyte cell adhesion molecule / Mus musculus    Q640R3
• Immunoglobulin superfamily member 8 / Mus musculus    Q8R366
• Integrin alpha-V / Mus musculus    P43406
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus    Q9R1V6-16
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus    P11881-3
• Isoform 3 of Neuroplastin / Mus musculus    P97300-3
• Laminin subunit gamma-1 / Mus musculus    P02468
• Leucyl-cystinyl aminopeptidase / Mus musculus    Q8C129
• Leukocyte surface antigen CD47 / Mus musculus    Q61735
• Low-density lipoprotein receptor-related protein 1B / Mus musculus    Q9JI18
• Lysosome-associated membrane glycoprotein 1 / Mus musculus    P11438
• Lysosome-associated membrane glycoprotein 2 / Mus musculus    P17047
• Myelin-associated glycoprotein / Mus musculus    P20917
• Nectin-1 / Mus musculus    Q9JKF6
• Neural cell adhesion molecule 2 / Mus musculus    O35136
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neurocan core protein / Mus musculus    P55066
• Neurofascin / Mus musculus    A0A087WPX3
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Neurotrimin / Mus musculus    Q99PJ0
• Noelin / Mus musculus    O88998
• Oligodendrocyte-myelin glycoprotein / Mus musculus    Q63912
• Phosphoribosylformylglycinamidine synthase / Mus musculus    Q5SUR0
• Plexin-B1 / Mus musculus    Q8CJH3
• Plexin-B2 / Mus musculus    B2RXS4
• Plexin-C1 / Mus musculus    Q9QZC2
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Receptor-type tyrosine-protein phosphatase delta / Mus musculus    Q64487
• Ribose-phosphate pyrophosphokinase 1 / Mus musculus    Q9D7G0
• Roundabout homolog 2 / Mus musculus    Q7TPD3
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sodium/potassium-transporting ATPase subunit alpha / Mus musculus    Q6PIC6
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• SPARC / Mus musculus    P07214
• SPARC-like protein 1 / Mus musculus    P70663
• Tetraspanin-3 / Mus musculus    Q9QY33
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Zinc finger protein 521 / Mus musculus    Q6KAS7
• Zinc transporter ZIP10 / Mus musculus    Q6P5F6
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• T-cell surface glycoprotein cd4 / Rattus norvegicus    P05540
• Rhodopsin / Rana pipiens    P31355
• Ribonuclease s-3 / Nicotiana alata    O24103
• Ribonuclease s-6 / Nicotiana alata    Q40379
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Hemocyanin / Megathura crenulata    Q10584    Q10583
• Uncharacterized protein / Trypanosoma brucei brucei    
• Uncharacterized protein / Trypanosoma brucei brucei    
• Envelope glycoprotein / Friend murine leukemia virus    P03395
• Uncharacterized protein / Carica papaya    
• Uncharacterized protein / Carica papaya    
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Embryo (UBERON_0000922)  
• Hemolymph (UBERON_0001011)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   IM4/V/IV (CVCL_VT67)  
• Ovary (UBERON_0000992)   IM4/V/IV-G1 (CVCL_VT68)  
• Ovary (UBERON_0000992)   IM4/V/IV-G2 (CVCL_VT69)  
• Ovary (UBERON_0000992)   IM4/V/IV-G3 (CVCL_VT70)  
• Ovary (UBERON_0000992)   IM4/V/IV-G4 (CVCL_VT71)  
• Ovary (UBERON_0000992)   IM4/V/IV-G5 (CVCL_VT72)  
• Ovary (UBERON_0000992)  
• Placenta (UBERON_0001987)  
• Retina (UBERON_0000966)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)  
• Eveline (CVCL_A1LI)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293T (CVCL_0063)  
• LS174T (CVCL_1384)  
• Delipidated Cell  
• Egg Cell  
• Fruit (BTO_0000486)  
• Leaf (BTO_0000713)  
• Style (BTO_0001313)  
• Low-Density Lipoprotein Particle (GO_0034362)  

Reported structure

• Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / Structure 9199
• Free / Lactose / Structure 9207
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[Gal(b1-6)]Man(a1-3)[Gal(b1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Structure 1224
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Structure 1713
• N-Linked / Hybrid / Man(?1-?)[Man(?1-?)]Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Man(a1-3)[Man(a1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Man(a1-?)[Man(a1-?)]Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Structure 9492
• N-Linked / Hybrid / Structure 9564
• N-Linked / Hybrid / Structure 10205
• N-Linked / Hybrid / Structure 10478

Composition

• Hex:5 HexNAc:3 (avg mass : 1438.3123 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma (DOID:305)
• Carcinoma, Hepatocellular (DOID:684)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Diabetes Mellitus, Non-insulin dependent (DOID:9352)
• Gastritis (DOID:4029)
• Hypercholesterolemia, Familial (DOID:13810)
• Hypersensitivity reaction disease (DOID:0060056)
• Myeloma, Multiple (DOID:9538)

Reference

• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Unreviewed
• A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
• A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
• Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
• The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
• Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
• Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
• The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
• Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
• Processing pathway deduced from the structures of N-glycans in Carica papaya. (2000 - Makino Y, Shimazaki A, Omichi K, Odani S, Hase S) / Status : Reviewed
• Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
• Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
• Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
• Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed

Reported glycosite

• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-922
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-410
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein B-100 / Homo sapiens
  •        Undefined site
  •        Asn-3411
• Apolipoprotein D / Homo sapiens
  •        Asn-98
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-89
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Cathepsin D / Homo sapiens
  •        Asn-263
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
• Complement c3 / Homo sapiens
  •        Asn-85
• Decorin / Homo sapiens
  •        Asn-211
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-119
  •        Asn-276
• Fibrillin-1 / Homo sapiens
  •        Asn-1067
• Fibrillin-2 / Homo sapiens
  •        Asn-1112
• Fibrillin-3 / Homo sapiens
  •        Asn-1025
• Fibronectin / Homo sapiens
  •        Asn-542
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Undefined site
• Golgi membrane protein 1 / Homo sapiens
  •        Asn-109
• Histone-lysine N-methyltransferase 2A / Homo sapiens
  •        Asn-1601
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Undefined site
  •        Asn-275
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-279
  •        Asn-440
• Integrin alpha-M / Homo sapiens
  •        Asn-900
• Integrin alpha-V / Homo sapiens
  •        Asn-74
• Interferon gamma / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Lysosomal alpha-glucosidase / Homo sapiens
  •        Asn-470
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-103
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-356
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2007
  •        Asn-2500
• Monocyte differentiation antigen cd14 / Homo sapiens
  •        Asn-151
• Myeloperoxidase / Homo sapiens
  •        Asn-323
• N-acetylglucosamine-6-sulfatase / Homo sapiens
  •        Asn-362
• Oncostatin-M-specific receptor subunit beta / Homo sapiens
  •        Asn-176
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-197
• Pentraxin-related protein ptx3 / Homo sapiens
  •        Asn-220
• Periostin / Homo sapiens
  •        Asn-599
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-499
• Prosaposin / Homo sapiens
  •        Asn-215
  •        Asn-332
  •        Asn-426
• Rhodopsin / Homo sapiens
  •        Undefined site
• Sciellin / Homo sapiens
  •        Asn-562
• Serpin h1 / Homo sapiens
  •        Asn-120
• SUN domain-containing ossification factor / Homo sapiens
  •        Asn-530
• Sushi domain-containing protein 2 / Homo sapiens
  •        Asn-162
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Transferrin receptor protein 1 / Homo sapiens
  •        Undefined site
• Transmembrane 9 superfamily member 3 / Homo sapiens
  •        Asn-174
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-200
• Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
  •        Asn-152
• Vascular endothelial growth factor receptor 1 / Homo sapiens
  •        Asn-474
• Vitronectin / Homo sapiens
  •        Asn-169
• Lactotransferrin / Bos taurus
  •        Asn-495
• Rhodopsin / Bos taurus
  •        Undefined site
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-153
• Adhesion G protein-coupled receptor B2 / Mus musculus
  •        Asn-636
• BDNF/NT-3 growth factors receptor / Mus musculus
  •        Asn-241
• Cadherin-13 / Mus musculus
  •        Asn-638
• Cadherin-6 / Mus musculus
  •        Asn-399
• Carboxypeptidase E / Mus musculus
  •        Asn-139
• Cation-dependent mannose-6-phosphate receptor / Mus musculus
  •        Asn-58
• CD166 antigen / Mus musculus
  •        Asn-167
• Contactin-1 / Mus musculus
  •        Asn-494
• Contactin-associated protein like 5-3 / Mus musculus
  •        Asn-282
• Contactin-associated protein-like 2 / Mus musculus
  •        Asn-436
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-258
  •        Asn-505
• Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus
  •        Asn-64
• Embigin / Mus musculus
  •        Asn-70
• F-box only protein 38 / Mus musculus
  •        Asn-654
• Fibroblast growth factor receptor 1 / Mus musculus
  •        Asn-77
• Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
  •        Asn-104
• Hepatocyte cell adhesion molecule / Mus musculus
  •        Asn-189
• Immunoglobulin superfamily member 8 / Mus musculus
  •        Asn-325
• Integrin alpha-V / Mus musculus
  •        Asn-74
  •        Asn-546
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
  •        Asn-517
  •        Asn-632
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-580
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
  •        Asn-2502
• Isoform 3 of Neuroplastin / Mus musculus
  •        Asn-112
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
  •        Asn-1393
• Leucyl-cystinyl aminopeptidase / Mus musculus
  •        Asn-215
• Leukocyte surface antigen CD47 / Mus musculus
  •        Asn-61
  •        Asn-109
• Low-density lipoprotein receptor-related protein 1B / Mus musculus
  •        Asn-725
• Lysosome-associated membrane glycoprotein 1 / Mus musculus
  •        Asn-115
• Lysosome-associated membrane glycoprotein 2 / Mus musculus
  •        Asn-115
• Myelin-associated glycoprotein / Mus musculus
  •        Asn-99
• Nectin-1 / Mus musculus
  •        Asn-202
• Neural cell adhesion molecule 2 / Mus musculus
  •        Asn-474
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
  •        Asn-478
• Neurocan core protein / Mus musculus
  •        Asn-121
• Neurofascin / Mus musculus
  •        Asn-446
  •        Asn-866
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-217
  •        Asn-501
• Neurotrimin / Mus musculus
  •        Asn-305
• Noelin / Mus musculus
  •        Asn-473
• Oligodendrocyte-myelin glycoprotein / Mus musculus
  •        Asn-234
• Phosphoribosylformylglycinamidine synthase / Mus musculus
  •        Asn-272
• Plexin-B1 / Mus musculus
  •        Asn-31
• Plexin-B2 / Mus musculus
  •        Asn-735
• Plexin-C1 / Mus musculus
  •        Asn-1084
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-1512
  •        Asn-3840
  •        Asn-3954
• Receptor-type tyrosine-protein phosphatase delta / Mus musculus
  •        Asn-724
• Ribose-phosphate pyrophosphokinase 1 / Mus musculus
  •        Asn-164
• Roundabout homolog 2 / Mus musculus
  •        Asn-793
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-92
  •        Asn-168
  •        Asn-246
• Sodium/potassium-transporting ATPase subunit alpha / Mus musculus
  •        Asn-473
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-118
  •        Asn-153
  •        Asn-238
• SPARC / Mus musculus
  •        Asn-115
• SPARC-like protein 1 / Mus musculus
  •        Asn-462
• Tetraspanin-3 / Mus musculus
  •        Asn-167
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
  •        Asn-118
• Zinc finger protein 521 / Mus musculus
  •        Asn-1169
• Zinc transporter ZIP10 / Mus musculus
  •        Asn-341
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• T-cell surface glycoprotein cd4 / Rattus norvegicus
  •        Undefined site
• Rhodopsin / Rana pipiens
  •        Asn-2
  •        Asn-15
• Ribonuclease s-3 / Nicotiana alata
  •        Undefined site
• Ribonuclease s-6 / Nicotiana alata
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Hemocyanin / Megathura crenulata
  •        Undefined site
• Uncharacterized protein / Trypanosoma brucei brucei
  •        Undefined site
• Uncharacterized protein / Trypanosoma brucei brucei
  •        Undefined site
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-12
• Uncharacterized protein / Carica papaya
  •        Undefined site
• Uncharacterized protein / Carica papaya
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-615
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-122
  •        Asn-149
  •        Asn-234
  •        Asn-331
  •        Asn-602
  •        Asn-615
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-234
  •        Asn-343

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SPLPAAFTANGTHLQHLAR (19aa)
  •    Q8CJH3    Asn-31     Plexin-B1 / Mus musculus
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• LRPLFNK (7aa)
  •    P24668    Asn-58     Cation-dependent mannose-6-phosphate receptor / Mus musculus
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• WKLNK (5aa)
  •    Q61735    Asn-61     Leukocyte surface antigen CD47 / Mus musculus
• WPADKENDTGIVGQHSSCDVR (21aa)
  •    O55026    Asn-64     Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus
• SNVSVEENVILEKPSHVELK (20aa)
  •    P21995    Asn-70     Embigin / Mus musculus
• ANTTQPGIVEGGQVLK (16aa)
  •    P43406    Asn-74     Integrin alpha-V / Mus musculus
• FHAIHVSGTNGTK (13aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HAIHVSGTNGTK (12aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ANTTQPGIVEGGQVIK (16aa)
  •    P06756    Asn-74     Integrin alpha-V / Homo sapiens
• DGVQLVESNRTR (12aa)
  •    P16092    Asn-77     Fibroblast growth factor receptor 1 / Mus musculus
• TVLTPATNHMGNVTFTIPANR (21aa)
  •    P01024    Asn-85     Complement c3 / Homo sapiens
• KTVLTPATNHMGNVTFTIPANRE (23aa)
  •    P01024    Asn-85     Complement c3 / Homo sapiens
• AIVNFTR (7aa)
  •    P98160    Asn-89     Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92     Signal-regulatory protein alpha / Mus musculus
• IRNVSDTTK (9aa)
  •    P97797    Asn-92     Signal-regulatory protein alpha / Mus musculus
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• NCTLLLSTLSPELGGK (16aa)
  •    P20917    Asn-99     Myelin-associated glycoprotein / Mus musculus
• GHTITINFTR (10aa)
  •    P11279    Asn-103     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• LSYNVIPLNLTLDNR (15aa)
  •    P63137    Asn-104     Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
• DAMVGNYTCEVTELSR (16aa)
  •    Q61735    Asn-109     Leukocyte surface antigen CD47 / Mus musculus
• AVIVNNITTGER (12aa)
  •    Q8NBJ4    Asn-109     Golgi membrane protein 1 / Homo sapiens
• ANATIEVK (8aa)
  •    P97300-3    Asn-112     Isoform 3 of Neuroplastin / Mus musculus
• VCSNDNKTFDSSCHFFATK (19aa)
  •    P07214    Asn-115     SPARC / Mus musculus
• EASHYSIHDIVLSYNTSDSTVFPGAVAK (28aa)
  •    P17047    Asn-115     Lysosome-associated membrane glycoprotein 2 / Mus musculus
• YSVQHMYFTYNLSDTEHFPNAISK (24aa)
  •    P11438    Asn-115     Lysosome-associated membrane glycoprotein 1 / Mus musculus
• DEGDYFCELQVSGANPMSSNK (21aa)
  •    P01831    Asn-118     Thy-1 membrane glycoprotein / Mus musculus
• FLEPYNDSIQAQK (13aa)
  •    P14231    Asn-118     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• VTTYCNETMTGWVHDVIGR (19aa)
  •    P53634    Asn-119     Dipeptidyl peptidase 1 / Homo sapiens
• SISNSTAR (8aa)
  •    P50454    Asn-120     Serpin h1 / Homo sapiens
• HRANATLLLGPLR (13aa)
  •    P55066    Asn-121     Neurocan core protein / Mus musculus
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IVNNATNVVIKVCEF (15aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •    P01877    Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• GNETIVNLIHSTR (13aa)
  •    Q00493    Asn-139     Carboxypeptidase E / Mus musculus
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140     Collagen alpha-2(VI) chain / Homo sapiens
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RLRNVSWATGRS (12aa)
  •    P08571    Asn-151     Monocyte differentiation antigen cd14 / Homo sapiens
• RNVSWATGRS (10aa)
  •    P08571    Asn-151     Monocyte differentiation antigen cd14 / Homo sapiens
• KRCPDGFFSNETSSKA (16aa)
  •    O00300    Asn-152     Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
• RACQFNR (7aa)
  •    P14231    Asn-153     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• ACQFNR (6aa)
  •    P14231    Asn-153     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• SEIVNETR (8aa)
  •    Q9UGT4    Asn-162     Sushi domain-containing protein 2 / Homo sapiens
• NCTIVSPDAGGAK (13aa)
  •    Q9D7G0    Asn-164     Ribose-phosphate pyrophosphokinase 1 / Mus musculus
• DSYPDGNITWYR (12aa)
  •    Q61490    Asn-167     CD166 antigen / Mus musculus
• NQSVPLSCCR (10aa)
  •    Q9QY33    Asn-167     Tetraspanin-3 / Mus musculus
• GIPDQKVNFTCK (12aa)
  •    P97797    Asn-168     Signal-regulatory protein alpha / Mus musculus
• VNFTCK (6aa)
  •    P97797    Asn-168     Signal-regulatory protein alpha / Mus musculus
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• IVDVNITSEGK (11aa)
  •    Q9HD45    Asn-174     Transmembrane 9 superfamily member 3 / Homo sapiens
• NIQNNVSCYLEGK (13aa)
  •    Q99650    Asn-176     Oncostatin-M-specific receptor subunit beta / Homo sapiens
• DGKPLLNDSR (10aa)
  •    Q640R3    Asn-189     Hepatocyte cell adhesion molecule / Mus musculus
• NHSIFLADINQER (13aa)
  •    P50897    Asn-197     Palmitoyl-protein thioesterase 1 / Homo sapiens
• VSVNTANVTIGPQIMEVTVYR (21aa)
  •    Q14956    Asn-200     Transmembrane glycoprotein NMB / Homo sapiens
• LKGEAEYQEIRNPNGTVTVISR (22aa)
  •    Q9JKF6    Asn-202     Nectin-1 / Mus musculus
• NPNGTVTVISR (11aa)
  •    Q9JKF6    Asn-202     Nectin-1 / Mus musculus
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• DIILHSTGHNISR (13aa)
  •    Q8C129    Asn-215     Leucyl-cystinyl aminopeptidase / Mus musculus
• TNSTFVQALVEHVK (14aa)
  •    P07602    Asn-215     Prosaposin / Homo sapiens
• FNHTQTIQQK (10aa)
  •    Q810U4    Asn-217     Neuronal cell adhesion molecule / Mus musculus
• WSCDHKQNITYLLK (14aa)
  •    Q63912    Asn-234     Oligodendrocyte-myelin glycoprotein / Mus musculus
• GINIT (5aa)
  •    P0DTC2    Asn-234     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• DLPQGFSALEPLVDLPIGINITR (23aa)
  •    P0DTC2    Asn-234     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHVNYTQPLVAVK (13aa)
  •    P14231    Asn-238     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• HMNETSHTQGSLR (13aa)
  •    P15209    Asn-241     BDNF/NT-3 growth factors receptor / Mus musculus
• GIANLSNFIR (10aa)
  •    P97797    Asn-246     Signal-regulatory protein alpha / Mus musculus
• LAYATINDSRVPLMELPTYTGSVYPTVKPYHYPK (34aa)
  •    Q9Z218    Asn-258     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• LAYATINDSR (10aa)
  •    Q9Z218    Asn-258     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• GSISYINVTR (10aa)
  •    P07339    Asn-263     Cathepsin D / Homo sapiens
• FCDNSSAIQGK (11aa)
  •    Q5SUR0    Asn-272     Phosphoribosylformylglycinamidine synthase / Mus musculus
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• SHPNATFSAVGE (12aa)
  •    P01871    Asn-279     Immunoglobulin heavy constant mu / Homo sapiens
• QANFTVDKNTQHFQTK (16aa)
  •    Q0V8T7    Asn-282     Contactin-associated protein like 5-3 / Mus musculus
• VIYQNHNK (8aa)
  •    P11627    Asn-293     Neural cell adhesion molecule L1 / Mus musculus
• LGHTNASIMLFEVK (14aa)
  •    Q99PJ0    Asn-305     Neurotrimin / Mus musculus
• SCPACPGSNITIR (13aa)
  •    P05164    Asn-323     Myeloperoxidase / Homo sapiens
• IGPGEPLELLCNVSGALPPPGR (22aa)
  •    Q8R366    Asn-325     Immunoglobulin superfamily member 8 / Mus musculus
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330     Thrombospondin-2 / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LIDNNK (6aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• IIDNNKTEK (9aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• DQSEDDRQHECLNVTQLLK (19aa)
  •    Q6P5F6    Asn-341     Zinc transporter ZIP10 / Mus musculus
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• GPGIKPNQTSK (11aa)
  •    P15586    Asn-362     N-acetylglucosamine-6-sulfatase / Homo sapiens
• INTTIGSVAAQDPDAAR (17aa)
  •    P97326    Asn-399     Cadherin-6 / Mus musculus
• SINTTNVMGTSLTVR (15aa)
  •    P01023    Asn-410     Alpha-2-macroglobulin / Homo sapiens
• NLEKNSTK (8aa)
  •    P07602    Asn-426     Prosaposin / Homo sapiens
• VGVHINNTQTK (11aa)
  •    Q9CPW0    Asn-436     Contactin-associated protein-like 2 / Mus musculus
• STGKPTLYNVSLVMSDTAGTCY (22aa)
  •    P01871    Asn-440     Immunoglobulin heavy constant mu / Homo sapiens
• VILYNR (6aa)
  •    A0A087WPX3    Asn-446     Neurofascin / Mus musculus
• ILDQACGTDNQTYASSCHLFATK (23aa)
  •    P70663    Asn-462     SPARC-like protein 1 / Mus musculus
• GVFITNETGQPIIGK (15aa)
  •    P10253    Asn-470     Lysosomal alpha-glucosidase / Homo sapiens
• VAEIPFNSTNK VAEIPFNSTNK (23aa)
  •    Q6PIC6    Asn-473     Sodium/potassium-transporting ATPase subunit alpha / Mus musculus
• ALYAWNNGHQTLYNVTLFHVIR (22aa)
  •    O88998    Asn-473     Noelin / Mus musculus
• KMILEIAPTSDNDFGRYNCTATNR (24aa)
  •    O35136    Asn-474     Neural cell adhesion molecule 2 / Mus musculus
• FFPYANGTLSIR (12aa)
  •    P11627    Asn-478     Neural cell adhesion molecule L1 / Mus musculus
• GKANSTGTLVITNPTR (16aa)
  •    P12960    Asn-494     Contactin-1 / Mus musculus
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• GSALHEDIYVLHDNGTLEIPVAQK (24aa)
  •    Q810U4    Asn-501     Neuronal cell adhesion molecule / Mus musculus
• CEGPGVPTVTVHNTTDKRR (19aa)
  •    Q9Z218    Asn-505     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• CEGPGVPTVTVHNTTDK (17aa)
  •    Q9Z218    Asn-505     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• CEGPGVPTVTVHNTTDKR (18aa)
  •    Q9Z218    Asn-505     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• EICSGNSSQCAPNVHK (16aa)
  •    Q9R1V6-16    Asn-517     Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
• SISENATATAAPK (13aa)
  •    Q9UBS9    Asn-530     SUN domain-containing ossification factor / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• ALFLHNR (7aa)
  •    P43406    Asn-546     Integrin alpha-V / Mus musculus
• NGSSNTGAK (9aa)
  •    O95171    Asn-562     Sciellin / Homo sapiens
• YIDKGNR (7aa)
  •    O08532-4    Asn-580     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• VITPGTNTS (9aa)
  •    P0DTC2    Asn-602     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QDVNCTEVPVAIHADQLTPTWR (22aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TLNCSGAHVK (10aa)
  •    Q9R1V6-16    Asn-632     Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
• NVTDTFKR (8aa)
  •    Q8CGM1    Asn-636     Adhesion G protein-coupled receptor B2 / Mus musculus
• INNTHALVSLLQNLNK (16aa)
  •    Q9WTR5    Asn-638     Cadherin-13 / Mus musculus
• CNNSHQTGQAK (11aa)
  •    Q8BMI0    Asn-654     F-box only protein 38 / Mus musculus
• NFTIS (5aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KVEVEAVNATAVK (13aa)
  •    Q64487    Asn-724     Receptor-type tyrosine-protein phosphatase delta / Mus musculus
• VFLNGTHR (8aa)
  •    Q9JI18    Asn-725     Low-density lipoprotein receptor-related protein 1B / Mus musculus
• LSHDGNETLPLHLYVK (16aa)
  •    B2RXS4    Asn-735     Plexin-B2 / Mus musculus
• FHINK (5aa)
  •    Q7TPD3    Asn-793     Roundabout homolog 2 / Mus musculus
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NVTAQICIDK (10aa)
  •    P12109    Asn-804     Collagen alpha-1(VI) chain / Homo sapiens
• YVPFNGTK (8aa)
  •    A0A087WPX3    Asn-866     Neurofascin / Mus musculus
• ANVTSENNMPR (11aa)
  •    P11215    Asn-900     Integrin alpha-M / Homo sapiens
• GVVTDEQGIPIANATISVSGINHGVK (26aa)
  •    Q8IUX7    Asn-922     Adipocyte enhancer-binding protein 1 / Homo sapiens
• NCTDIDECR (9aa)
  •    Q75N90    Asn-1025     Fibrillin-3 / Homo sapiens
  •    P35555    Asn-1067     Fibrillin-1 / Homo sapiens
  •    P35556    Asn-1112     Fibrillin-2 / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• CDSGFALDSEERNCTDIDECR (21aa)
  •    P35555    Asn-1067     Fibrillin-1 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFSVKDR (7aa)
  •    Q9QZC2    Asn-1084     Plexin-C1 / Mus musculus
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VSNGTHW (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105     Laminin subunit gamma-1 / Mus musculus
• ELVPDANSTQLK (12aa)
  •    Q6KAS7    Asn-1169     Zinc finger protein 521 / Mus musculus
• RIPAINR (7aa)
  •    P02468    Asn-1393     Laminin subunit gamma-1 / Mus musculus
• WTGHNVTVVQR (11aa)
  •    Q91ZX7    Asn-1512     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• CENLSDEMYEILSNLPESVAYTCVNCTER (29aa)
  •    Q03164    Asn-1601     Histone-lysine N-methyltransferase 2A / Homo sapiens
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763     Collagen alpha-1(XII) chain / Homo sapiens
• ITLHENR (7aa)
  •    Q9NR99    Asn-2007     Matrix-remodeling-associated protein 5 / Homo sapiens
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500     Matrix-remodeling-associated protein 5 / Homo sapiens
• VETGENCTSPAPK (13aa)
  •    P11881-3    Asn-2502     Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens
• FGTCSQLCNNTK (12aa)
  •    Q91ZX7    Asn-3840     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• GVTHLNISGLK (11aa)
  •    Q91ZX7    Asn-3954     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus