taxonomy (14)
protein (132)
source (36)
structure (18)
composition (1)
disease (11)
reference (44)
site (179)
peptide (161)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Desmodus rotundus (Common vampire bat)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Rana pipiens (Northern leopard frog)
- Nicotiana alata (Persian tobacco)
- Gallus gallus (Chicken)
- Megathura crenulata (Californian giant keyhole limpet)
- Drosophila melanogaster (Fruit fly)
- Trypanosoma brucei brucei
- Friend murine leukemia virus (F-mulv)
- Carica papaya (Papaya)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Adipocyte enhancer-binding protein 1 / Homo sapiens Q8IUX7
- Alpha-2-macroglobulin / Homo sapiens P01023
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cathepsin D / Homo sapiens P07339
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Complement c3 / Homo sapiens P01024
- Decorin / Homo sapiens P07585
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Fibrillin-1 / Homo sapiens P35555
- Fibrillin-2 / Homo sapiens P35556
- Fibrillin-3 / Homo sapiens Q75N90
- Fibronectin / Homo sapiens P02751
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens P01215
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- Histone-lysine N-methyltransferase 2A / Homo sapiens Q03164
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01857 P01859 P01861 P01860
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Integrin alpha-M / Homo sapiens P11215
- Integrin alpha-V / Homo sapiens P06756
- Interferon gamma / Homo sapiens P01579
- Lactotransferrin / Homo sapiens P02788
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Matrix-remodeling-associated protein 5 / Homo sapiens Q9NR99
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Myeloperoxidase / Homo sapiens P05164
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- Oncostatin-M-specific receptor subunit beta / Homo sapiens Q99650
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Pentraxin-related protein ptx3 / Homo sapiens P26022
- Periostin / Homo sapiens Q15063
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prosaposin / Homo sapiens P07602
- Rhodopsin / Homo sapiens P08100
- Sciellin / Homo sapiens O95171
- Serpin h1 / Homo sapiens P50454
- SUN domain-containing ossification factor / Homo sapiens Q9UBS9
- Sushi domain-containing protein 2 / Homo sapiens Q9UGT4
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Transferrin receptor protein 1 / Homo sapiens P02786
- Transmembrane 9 superfamily member 3 / Homo sapiens Q9HD45
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens O00300
- Vascular endothelial growth factor receptor 1 / Homo sapiens P17948
- Vitronectin / Homo sapiens P04004
- Lactotransferrin / Bos taurus P24627
- Rhodopsin / Bos taurus P02699
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Adhesion G protein-coupled receptor B2 / Mus musculus Q8CGM1
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Cadherin-13 / Mus musculus Q9WTR5
- Cadherin-6 / Mus musculus P97326
- Carboxypeptidase E / Mus musculus Q00493
- Cation-dependent mannose-6-phosphate receptor / Mus musculus P24668
- CD166 antigen / Mus musculus Q61490
- Contactin-1 / Mus musculus P12960
- Contactin-associated protein like 5-3 / Mus musculus Q0V8T7
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus O55026
- Embigin / Mus musculus P21995
- F-box only protein 38 / Mus musculus Q8BMI0
- Fibroblast growth factor receptor 1 / Mus musculus P16092
- Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus P63137
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Immunoglobulin superfamily member 8 / Mus musculus Q8R366
- Integrin alpha-V / Mus musculus P43406
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Isoform 3 of Neuroplastin / Mus musculus P97300-3
- Laminin subunit gamma-1 / Mus musculus P02468
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Low-density lipoprotein receptor-related protein 1B / Mus musculus Q9JI18
- Lysosome-associated membrane glycoprotein 1 / Mus musculus P11438
- Lysosome-associated membrane glycoprotein 2 / Mus musculus P17047
- Myelin-associated glycoprotein / Mus musculus P20917
- Nectin-1 / Mus musculus Q9JKF6
- Neural cell adhesion molecule 2 / Mus musculus O35136
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neurocan core protein / Mus musculus P55066
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neurotrimin / Mus musculus Q99PJ0
- Noelin / Mus musculus O88998
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Phosphoribosylformylglycinamidine synthase / Mus musculus Q5SUR0
- Plexin-B1 / Mus musculus Q8CJH3
- Plexin-B2 / Mus musculus B2RXS4
- Plexin-C1 / Mus musculus Q9QZC2
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Receptor-type tyrosine-protein phosphatase delta / Mus musculus Q64487
- Ribose-phosphate pyrophosphokinase 1 / Mus musculus Q9D7G0
- Roundabout homolog 2 / Mus musculus Q7TPD3
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium/potassium-transporting ATPase subunit alpha / Mus musculus Q6PIC6
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- SPARC / Mus musculus P07214
- SPARC-like protein 1 / Mus musculus P70663
- Tetraspanin-3 / Mus musculus Q9QY33
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Zinc finger protein 521 / Mus musculus Q6KAS7
- Zinc transporter ZIP10 / Mus musculus Q6P5F6
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- T-cell surface glycoprotein cd4 / Rattus norvegicus P05540
- Rhodopsin / Rana pipiens P31355
- Ribonuclease s-3 / Nicotiana alata O24103
- Ribonuclease s-6 / Nicotiana alata Q40379
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Uncharacterized protein / Trypanosoma brucei brucei
- Uncharacterized protein / Trypanosoma brucei brucei
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Uncharacterized protein / Carica papaya
- Uncharacterized protein / Carica papaya
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Ovary (UBERON_0000992)
- Placenta (UBERON_0001987)
- Retina (UBERON_0000966)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- Eveline (CVCL_A1LI)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- LS174T (CVCL_1384)
- Delipidated Cell
- Egg Cell
- Egg Cell Egg White
- Fruit (BTO_0000486)
- Leaf (BTO_0000713)
- Style (BTO_0001313)
- Low-Density Lipoprotein Particle (GO_0034362)
Source
- Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9199
- Free / Lactose / Structure 9207
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[Gal(b1-6)]Man(a1-3)[Gal(b1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 1224
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 1713
- N-Linked / Hybrid / Man(?1-?)[Man(?1-?)]Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-3)[Man(a1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-?)[Man(a1-?)]Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9492
- N-Linked / Hybrid / Structure 9564
- N-Linked / Hybrid / Structure 10205
- N-Linked / Hybrid / Structure 10478
- N-Linked / Hybrid / Structure 11181
Reported structure
- Hex:5 HexNAc:3 (avg mass : 1438.3123 )
Composition
- Cancer, breast (DOID:1612)
- Carcinoma (DOID:305)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Gastritis (DOID:4029)
- Hypercholesterolemia, Familial (DOID:13810)
- Hypersensitivity reaction disease (DOID:0060056)
- Multiple myeloma (DOID:9538)
Disease
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- Processing pathway deduced from the structures of N-glycans in Carica papaya. (2000 - Makino Y, Shimazaki A, Omichi K, Odani S, Hase S) / Status : Reviewed
- Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
- Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed
Reference
- Adipocyte enhancer-binding protein 1 / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Apolipoprotein B-100 / Homo sapiens
- Undefined site
- Asn-3411
- Apolipoprotein D / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cathepsin D / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
- Fibronectin / Homo sapiens
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
- Golgi membrane protein 1 / Homo sapiens
- Histone-lysine N-methyltransferase 2A / Homo sapiens
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
- Asn-275
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Integrin alpha-V / Homo sapiens
-
Interferon gamma / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Oncostatin-M-specific receptor subunit beta / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Pentraxin-related protein ptx3 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prosaposin / Homo sapiens
-
Rhodopsin / Homo sapiens
- Undefined site
- Sciellin / Homo sapiens
- Serpin h1 / Homo sapiens
- SUN domain-containing ossification factor / Homo sapiens
- Sushi domain-containing protein 2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
-
Transferrin receptor protein 1 / Homo sapiens
- Undefined site
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
- Vascular endothelial growth factor receptor 1 / Homo sapiens
- Vitronectin / Homo sapiens
- Lactotransferrin / Bos taurus
-
Rhodopsin / Bos taurus
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
- Adhesion G protein-coupled receptor B2 / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-6 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-associated protein like 5-3 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus
- Embigin / Mus musculus
- F-box only protein 38 / Mus musculus
- Fibroblast growth factor receptor 1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus
- Integrin alpha-V / Mus musculus
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 3 of Neuroplastin / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- Nectin-1 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neurotrimin / Mus musculus
- Noelin / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Phosphoribosylformylglycinamidine synthase / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Receptor-type tyrosine-protein phosphatase delta / Mus musculus
- Ribose-phosphate pyrophosphokinase 1 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- SPARC / Mus musculus
- SPARC-like protein 1 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Zinc finger protein 521 / Mus musculus
- Zinc transporter ZIP10 / Mus musculus
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
- Rhodopsin / Rana pipiens
-
Ribonuclease s-3 / Nicotiana alata
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- Asn-293
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
Uncharacterized protein / Carica papaya
- Undefined site
-
Uncharacterized protein / Carica papaya
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- HENNTKDNSIQHEFSLTR (18aa)
- LRPLFNK (7aa)
- FSNVTWF (7aa)
- WKLNK (5aa)
- WPADKENDTGIVGQHSSCDVR (21aa)
- SNVSVEENVILEKPSHVELK (20aa)
- ANTTQPGIVEGGQVLK (16aa)
- FHAIHVSGTNGTK (13aa)
- HAIHVSGTNGTK (12aa)
- ANTTQPGIVEGGQVIK (16aa)
- DGVQLVESNRTR (12aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- KTVLTPATNHMGNVTFTIPANRE (23aa)
- AIVNFTR (7aa)
- IRNVSDTTKR (10aa)
- IRNVSDTTK (9aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- NCTLLLSTLSPELGGK (16aa)
- GHTITINFTR (10aa)
- LSYNVIPLNLTLDNR (15aa)
- DAMVGNYTCEVTELSR (16aa)
- AVIVNNITTGER (12aa)
- ANATIEVK (8aa)
- VCSNDNKTFDSSCHFFATK (19aa)
- EASHYSIHDIVLSYNTSDSTVFPGAVAK (28aa)
- YSVQHMYFTYNLSDTEHFPNAISK (24aa)
- DEGDYFCELQVSGANPMSSNK (21aa)
- FLEPYNDSIQAQK (13aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- SISNSTAR (8aa)
- HRANATLLLGPLR (13aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- IVNNATNVVIKVCEF (15aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- GNETIVNLIHSTR (13aa)
- GTFTDCALANMTEQIR (16aa)
- YHKNNKSWMESEF (13aa)
- RLRNVSWATGRS (12aa)
- RNVSWATGRS (10aa)
- KRCPDGFFSNETSSKA (16aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- SEIVNETR (8aa)
- NCTIVSPDAGGAK (13aa)
- DSYPDGNITWYR (12aa)
- NQSVPLSCCR (10aa)
- GIPDQKVNFTCK (12aa)
- VNFTCK (6aa)
- NGSLFAFR (8aa)
- IVDVNITSEGK (11aa)
- NIQNNVSCYLEGK (13aa)
- DGKPLLNDSR (10aa)
- NHSIFLADINQER (13aa)
- VSVNTANVTIGPQIMEVTVYR (21aa)
- LKGEAEYQEIRNPNGTVTVISR (22aa)
- NPNGTVTVISR (11aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- DIILHSTGHNISR (13aa)
- TNSTFVQALVEHVK (14aa)
- FNHTQTIQQK (10aa)
- WSCDHKQNITYLLK (14aa)
- GINIT (5aa)
- DLPQGFSALEPLVDLPIGINITR (23aa)
- FHVNYTQPLVAVK (13aa)
- HMNETSHTQGSLR (13aa)
- GIANLSNFIR (10aa)
- LAYATINDSRVPLMELPTYTGSVYPTVKPYHYPK (34aa)
- LAYATINDSR (10aa)
- IININPNK (8aa)
- GSISYINVTR (10aa)
- FCDNSSAIQGK (11aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- SHPNATFSAVGE (12aa)
- QANFTVDKNTQHFQTK (16aa)
- YNLT (4aa)
- VIYQNHNK (8aa)
- LGHTNASIMLFEVK (14aa)
- SCPACPGSNITIR (13aa)
- IGPGEPLELLCNVSGALPPPGR (22aa)
- FFAENETWVVDSCTTCTCK (19aa)
- RFPNIT (6aa)
- LIDNNK (6aa)
- IIDNNKTEK (9aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- DQSEDDRQHECLNVTQLLK (19aa)
- VFNATR (6aa)
- VQPFNVTQGK (10aa)
- KVSCPIMPCSNATVPDGECCPR (22aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- GPGIKPNQTSK (11aa)
- INTTIGSVAAQDPDAAR (17aa)
- SINTTNVMGTSLTVR (15aa)
- NLEKNSTK (8aa)
- VGVHINNTQTK (11aa)
- STGKPTLYNVSLVMSDTAGTCY (22aa)
- VILYNR (6aa)
- ILDQACGTDNQTYASSCHLFATK (23aa)
- GVFITNETGQPIIGK (15aa)
- VAEIPFNSTNK VAEIPFNSTNK (23aa)
- ALYAWNNGHQTLYNVTLFHVIR (22aa)
- KMILEIAPTSDNDFGRYNCTATNR (24aa)
- FFPYANGTLSIR (12aa)
- GKANSTGTLVITNPTR (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- GSALHEDIYVLHDNGTLEIPVAQK (24aa)
- CEGPGVPTVTVHNTTDKRR (19aa)
- CEGPGVPTVTVHNTTDK (17aa)
- CEGPGVPTVTVHNTTDKR (18aa)
- EICSGNSSQCAPNVHK (16aa)
- SISENATATAAPK (13aa)
- RHEEGHMINCTCFGQGR (17aa)
- ALFLHNR (7aa)
- NGSSNTGAK (9aa)
- YIDKGNR (7aa)
- EVNDTLLVNELK (12aa)
- VITPGTNTS (9aa)
- LYQDVNCT (8aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- TLNCSGAHVK (10aa)
- NVTDTFKR (8aa)
- INNTHALVSLLQNLNK (16aa)
- CNNSHQTGQAK (11aa)
- NFTIS (5aa)
- KVEVEAVNATAVK (13aa)
- VFLNGTHR (8aa)
- LSHDGNETLPLHLYVK (16aa)
- FHINK (5aa)
- FGGFNFS (7aa)
- NVTAQICIDK (10aa)
- YVPFNGTK (8aa)
- ANVTSENNMPR (11aa)
- GVVTDEQGIPIANATISVSGINHGVK (26aa)
- NCTDIDECR (9aa)
- VVNSTTGPGEHIR (13aa)
- CDSGFALDSEERNCTDIDECR (21aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGK (13aa)
- NFSVKDR (7aa)
- EGVFVSNGTHW (11aa)
- NGTHWFVT (8aa)
- VSNGTHW (7aa)
- VNSSLHSQISR (11aa)
- ELVPDANSTQLK (12aa)
- RIPAINR (7aa)
- WTGHNVTVVQR (11aa)
- CENLSDEMYEILSNLPESVAYTCVNCTER (29aa)
- NLQVYNATSNSLTVK (15aa)
- ITLHENR (7aa)
- ITVHGNGSLDIR (12aa)
- VETGENCTSPAPK (13aa)
- MIEAYNITEK (10aa)
- FVEGSHNSTVSLTTK (15aa)
- FGTCSQLCNNTK (12aa)
- GVTHLNISGLK (11aa)
Mass spectrometry observed peptide
-
- Free / Lactose
(avg mass : 1438.3123)
- Milk (UBERON_0001913)
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1438.3123)
- Milk (UBERON_0001913)
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1438.3123)
- Milk (UBERON_0001913)
-
- N-Linked / Complex
(avg mass : 1438.3123)
- Hemolymph (UBERON_0001011)
-
Hemocyanin / Megathura crenulata
- Undefined site
-
- N-Linked / Complex
(avg mass : 1438.3123)
- Hemolymph (UBERON_0001011)
-
Hemocyanin / Megathura crenulata
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Retina (UBERON_0000966)
- Rhodopsin / Rana pipiens
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Blood Plasma (UBERON_0001969)
- Vitronectin / Homo sapiens
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Placenta (UBERON_0001987)
- Urine (UBERON_0001088)
- Eveline (CVCL_A1LI)
- Delipidated Cell
- Carcinoma, Hepatocellular (DOID:684)
- Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
-
Transferrin receptor protein 1 / Homo sapiens
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Blood Serum (UBERON_0001977)
- Embryo (UBERON_0000922)
- Milk (UBERON_0001913)
- BTI-Tn-5B1-4 (CVCL_C190)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant mu / Homo sapiens
- Lactotransferrin / Homo sapiens
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- SHPNATFSAVGE (12aa)
- VFNATR (6aa)
- NFTTAPAICHDGK (13aa)
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Retina (UBERON_0000966)
- Rhodopsin / Rana pipiens
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Colon (UBERON_0001155)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Ovary (UBERON_0000992)
- Retina (UBERON_0000966)
- LS174T (CVCL_1384)
- Egg Cell
- Fruit (BTO_0000486)
- Leaf (BTO_0000713)
- Style (BTO_0001313)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Processing pathway deduced from the structures of N-glycans in Carica papaya. (2000 - Makino Y, Shimazaki A, Omichi K, Odani S, Hase S) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
Interferon gamma / Homo sapiens
- Undefined site
-
Rhodopsin / Homo sapiens
- Undefined site
-
Rhodopsin / Bos taurus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Ribonuclease s-3 / Nicotiana alata
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Carica papaya
- Undefined site
-
Uncharacterized protein / Carica papaya
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Hypercholesterolemia, Familial (DOID:13810)
-
Apolipoprotein B-100 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Milk (UBERON_0001913)
- Complement c3 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
- KTVLTPATNHMGNVTFTIPANRE (23aa)
- RNVSWATGRS (10aa)
- RLRNVSWATGRS (12aa)
- KRCPDGFFSNETSSKA (16aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Blood Serum (UBERON_0001977)
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Colon (UBERON_0001155)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1438.3123)
- Colon (UBERON_0001155)
-
- Hex:5 HexNAc:3 / N-Linked
(avg mass : 1438.3123)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[Gal(b1-6)]Man(a1-3)[Gal(b1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 1224
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 1713
- N-Linked / Hybrid / Man(?1-?)[Man(?1-?)]Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-3)[Man(a1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-?)[Man(a1-?)]Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9492
- N-Linked / Hybrid / Structure 9564
- N-Linked / Hybrid / Structure 10205
- N-Linked / Hybrid / Structure 10478
- N-Linked / Hybrid / Structure 11181
- Ovalbumin / Gallus gallus
- YNLT (4aa)
-
- Hex:5 HexNAc:3 / N-Linked
(avg mass : 1438.3123)
- Ascitic fluid (UBERON_0007795)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[Gal(b1-6)]Man(a1-3)[Gal(b1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 1224
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 1713
- N-Linked / Hybrid / Man(?1-?)[Man(?1-?)]Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-3)[Man(a1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-?)[Man(a1-?)]Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9492
- N-Linked / Hybrid / Structure 9564
- N-Linked / Hybrid / Structure 10205
- N-Linked / Hybrid / Structure 10478
- N-Linked / Hybrid / Structure 11181
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Adipocyte enhancer-binding protein 1 / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cathepsin D / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
- Fibronectin / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Histone-lysine N-methyltransferase 2A / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Integrin alpha-V / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Oncostatin-M-specific receptor subunit beta / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Pentraxin-related protein ptx3 / Homo sapiens
- Periostin / Homo sapiens
- Prosaposin / Homo sapiens
- Sciellin / Homo sapiens
- Serpin h1 / Homo sapiens
- SUN domain-containing ossification factor / Homo sapiens
- Sushi domain-containing protein 2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Vascular endothelial growth factor receptor 1 / Homo sapiens
- Vitronectin / Homo sapiens
- Lactotransferrin / Bos taurus
- Adhesion G protein-coupled receptor B2 / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-6 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-associated protein like 5-3 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus
- Embigin / Mus musculus
- F-box only protein 38 / Mus musculus
- Fibroblast growth factor receptor 1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus
- Integrin alpha-V / Mus musculus
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 3 of Neuroplastin / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- Nectin-1 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neurotrimin / Mus musculus
- Noelin / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Phosphoribosylformylglycinamidine synthase / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Receptor-type tyrosine-protein phosphatase delta / Mus musculus
- Ribose-phosphate pyrophosphokinase 1 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- SPARC / Mus musculus
- SPARC-like protein 1 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Zinc finger protein 521 / Mus musculus
- Zinc transporter ZIP10 / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- HENNTKDNSIQHEFSLTR (18aa)
- LRPLFNK (7aa)
- FSNVTWF (7aa)
- WKLNK (5aa)
- WPADKENDTGIVGQHSSCDVR (21aa)
- SNVSVEENVILEKPSHVELK (20aa)
- ANTTQPGIVEGGQVLK (16aa)
- FHAIHVSGTNGTK (13aa)
- HAIHVSGTNGTK (12aa)
- ANTTQPGIVEGGQVIK (16aa)
- DGVQLVESNRTR (12aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- AIVNFTR (7aa)
- IRNVSDTTKR (10aa)
- IRNVSDTTK (9aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- NCTLLLSTLSPELGGK (16aa)
- GHTITINFTR (10aa)
- LSYNVIPLNLTLDNR (15aa)
- DAMVGNYTCEVTELSR (16aa)
- AVIVNNITTGER (12aa)
- ANATIEVK (8aa)
- VCSNDNKTFDSSCHFFATK (19aa)
- EASHYSIHDIVLSYNTSDSTVFPGAVAK (28aa)
- YSVQHMYFTYNLSDTEHFPNAISK (24aa)
- DEGDYFCELQVSGANPMSSNK (21aa)
- FLEPYNDSIQAQK (13aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- SISNSTAR (8aa)
- HRANATLLLGPLR (13aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- IVNNATNVVIKVCEF (15aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- GNETIVNLIHSTR (13aa)
- GTFTDCALANMTEQIR (16aa)
- YHKNNKSWMESEF (13aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- SEIVNETR (8aa)
- NCTIVSPDAGGAK (13aa)
- DSYPDGNITWYR (12aa)
- NQSVPLSCCR (10aa)
- GIPDQKVNFTCK (12aa)
- VNFTCK (6aa)
- NGSLFAFR (8aa)
- IVDVNITSEGK (11aa)
- NIQNNVSCYLEGK (13aa)
- DGKPLLNDSR (10aa)
- NHSIFLADINQER (13aa)
- VSVNTANVTIGPQIMEVTVYR (21aa)
- LKGEAEYQEIRNPNGTVTVISR (22aa)
- NPNGTVTVISR (11aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- DIILHSTGHNISR (13aa)
- TNSTFVQALVEHVK (14aa)
- FNHTQTIQQK (10aa)
- WSCDHKQNITYLLK (14aa)
- GINIT (5aa)
- DLPQGFSALEPLVDLPIGINITR (23aa)
- FHVNYTQPLVAVK (13aa)
- HMNETSHTQGSLR (13aa)
- GIANLSNFIR (10aa)
- LAYATINDSRVPLMELPTYTGSVYPTVKPYHYPK (34aa)
- LAYATINDSR (10aa)
- IININPNK (8aa)
- GSISYINVTR (10aa)
- FCDNSSAIQGK (11aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- QANFTVDKNTQHFQTK (16aa)
- VIYQNHNK (8aa)
- LGHTNASIMLFEVK (14aa)
- SCPACPGSNITIR (13aa)
- IGPGEPLELLCNVSGALPPPGR (22aa)
- FFAENETWVVDSCTTCTCK (19aa)
- RFPNIT (6aa)
- LIDNNK (6aa)
- IIDNNKTEK (9aa)
- DQSEDDRQHECLNVTQLLK (19aa)
- VQPFNVTQGK (10aa)
- KVSCPIMPCSNATVPDGECCPR (22aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- GPGIKPNQTSK (11aa)
- INTTIGSVAAQDPDAAR (17aa)
- SINTTNVMGTSLTVR (15aa)
- NLEKNSTK (8aa)
- VGVHINNTQTK (11aa)
- STGKPTLYNVSLVMSDTAGTCY (22aa)
- VILYNR (6aa)
- ILDQACGTDNQTYASSCHLFATK (23aa)
- GVFITNETGQPIIGK (15aa)
- VAEIPFNSTNK VAEIPFNSTNK (23aa)
- ALYAWNNGHQTLYNVTLFHVIR (22aa)
- KMILEIAPTSDNDFGRYNCTATNR (24aa)
- FFPYANGTLSIR (12aa)
- GKANSTGTLVITNPTR (16aa)
- GSALHEDIYVLHDNGTLEIPVAQK (24aa)
- CEGPGVPTVTVHNTTDKRR (19aa)
- CEGPGVPTVTVHNTTDK (17aa)
- CEGPGVPTVTVHNTTDKR (18aa)
- EICSGNSSQCAPNVHK (16aa)
- SISENATATAAPK (13aa)
- RHEEGHMINCTCFGQGR (17aa)
- ALFLHNR (7aa)
- NGSSNTGAK (9aa)
- YIDKGNR (7aa)
- EVNDTLLVNELK (12aa)
- VITPGTNTS (9aa)
- LYQDVNCT (8aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- TLNCSGAHVK (10aa)
- NVTDTFKR (8aa)
- INNTHALVSLLQNLNK (16aa)
- CNNSHQTGQAK (11aa)
- NFTIS (5aa)
- KVEVEAVNATAVK (13aa)
- VFLNGTHR (8aa)
- LSHDGNETLPLHLYVK (16aa)
- FHINK (5aa)
- FGGFNFS (7aa)
- NVTAQICIDK (10aa)
- YVPFNGTK (8aa)
- ANVTSENNMPR (11aa)
- GVVTDEQGIPIANATISVSGINHGVK (26aa)
- NCTDIDECR (9aa)
- VVNSTTGPGEHIR (13aa)
- CDSGFALDSEERNCTDIDECR (21aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGK (13aa)
- NFSVKDR (7aa)
- EGVFVSNGTHW (11aa)
- NGTHWFVT (8aa)
- VSNGTHW (7aa)
- VNSSLHSQISR (11aa)
- ELVPDANSTQLK (12aa)
- RIPAINR (7aa)
- WTGHNVTVVQR (11aa)
- CENLSDEMYEILSNLPESVAYTCVNCTER (29aa)
- NLQVYNATSNSLTVK (15aa)
- ITLHENR (7aa)
- ITVHGNGSLDIR (12aa)
- VETGENCTSPAPK (13aa)
- MIEAYNITEK (10aa)
- FVEGSHNSTVSLTTK (15aa)
- FGTCSQLCNNTK (12aa)
- GVTHLNISGLK (11aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:3 / N-Linked
(avg mass : 1438.3123)
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:3 / N-Linked
(avg mass : 1438.3123)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1438.3123)
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Disease
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1438.3123)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1438.3123)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1438.3123)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1438.3123)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1438.3123)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1438.3123)
