Hex:3 HexNAc:9

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Trichinella spiralis

Protein

• Alpha-S1-casein / Homo sapiens    P47710
• Golgi apparatus protein 1 / Homo sapiens    Q92896
• Haptoglobin / Homo sapiens    P00738
• Lactotransferrin / Homo sapiens    P02788
• BDNF/NT-3 growth factors receptor / Mus musculus    P15209
• Tsl-1 antigens / Trichinella spiralis    

Source

• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  

Reported structure

• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x GalNAc(b1-4)"
• N-Linked / Complex / Structure 9477
• N-Linked / Undefined core / HexNAc(??-?)HexNAc(??-?)[HexNAc(??-?)]Hex(??-?)[HexNAc(??-?)HexNAc(??-?)[HexNAc(??-?)HexNAc(??-?)]Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc

Composition

• Hex:3 HexNAc:9 (avg mass : 2333.1975 )

Disease

• Cancer, breast (DOID:1612)
• Oral squamous cell carcinoma (DOID:0050866)

Reference

• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed

Reported glycosite

• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Golgi apparatus protein 1 / Homo sapiens
  •        Asn-210
• Haptoglobin / Homo sapiens
  •        Asn-241
• Lactotransferrin / Homo sapiens
  •        Asn-156
• BDNF/NT-3 growth factors receptor / Mus musculus
  •        Asn-338
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site

Mass spectrometry observed peptide

• RNESTQNCVVAEPEKM (16aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• GNITEYQCHQYITK (14aa)
  •    Q92896    Asn-210     Golgi apparatus protein 1 / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• IHVTNHTEYHGCLQLDNPTHMNNGDYTLMAK (31aa)
  •    P15209    Asn-338     BDNF/NT-3 growth factors receptor / Mus musculus