taxonomy (3)
protein (6)
source (4)
structure (3)
composition (1)
disease (2)
reference (5)
site (6)
peptide (5)
- Alpha-S1-casein / Homo sapiens P47710
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Haptoglobin / Homo sapiens P00738
- Lactotransferrin / Homo sapiens P02788
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Tsl-1 antigens / Trichinella spiralis
Protein
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
Source
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x GalNAc(b1-4)"
- N-Linked / Complex / Structure 9477
- N-Linked / Undefined core / HexNAc(??-?)HexNAc(??-?)[HexNAc(??-?)]Hex(??-?)[HexNAc(??-?)HexNAc(??-?)[HexNAc(??-?)HexNAc(??-?)]Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
Reported structure
- Hex:3 HexNAc:9 (avg mass : 2333.1975 )
Composition
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
Reference
- Alpha-S1-casein / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Haptoglobin / Homo sapiens
- Lactotransferrin / Homo sapiens
- BDNF/NT-3 growth factors receptor / Mus musculus
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
Reported glycosite
- RNESTQNCVVAEPEKM (16aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- GNITEYQCHQYITK (14aa)
- VVLHPNYSQVDIGLIK (16aa)
- IHVTNHTEYHGCLQLDNPTHMNNGDYTLMAK (31aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2333.1975)
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 2333.1975)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Lactotransferrin / Homo sapiens
- RNESTQNCVVAEPEKM (16aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
-
- N-Linked / Undefined core
(avg mass : 2333.1975)
- Blood Serum (UBERON_0001977)
- Haptoglobin / Homo sapiens
- VVLHPNYSQVDIGLIK (16aa)
-
- Hex:3 HexNAc:9 / N-Linked
(avg mass : 2333.1975)
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x GalNAc(b1-4)"
- N-Linked / Complex / Structure 9477
- N-Linked / Undefined core / HexNAc(??-?)HexNAc(??-?)[HexNAc(??-?)]Hex(??-?)[HexNAc(??-?)HexNAc(??-?)[HexNAc(??-?)HexNAc(??-?)]Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
- Cancer, breast (DOID:1612)
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
Suggested structure
Disease
Reference
- Hex:3 HexNAc:9 / N-Linked
(avg mass : 2333.1975)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Undefined core
(avg mass : 2333.1975)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2333.1975)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2333.1975)