taxonomy (4)
protein (5)
source (4)
structure (2)
composition (1)
disease (3)
reference (5)
site (7)
peptide (6)
- Homo sapiens (Human)
- Mus musculus (House mouse)
- Trichinella spiralis
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Haptoglobin / Homo sapiens P00738
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Tsl-1 antigens / Trichinella spiralis
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- HEK293 (CVCL_0045)
Source
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x GalNAc(b1-4)"
- N-Linked / Undefined core / HexNAc(??-?)HexNAc(??-?)[HexNAc(??-?)]Hex(??-?)[HexNAc(??-?)HexNAc(??-?)[HexNAc(??-?)HexNAc(??-?)]Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
Reported structure
- Hex:3 HexNAc:9 (avg mass : 2333.1975 )
Composition
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Oral squamous cell carcinoma (DOID:0050866)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
Reference
-
- N-Linked / Complex (avg mass : 2333.1975)
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- N-Linked / Undefined core (avg mass : 2333.1975)
- Blood Serum (UBERON_0001977)
- Haptoglobin / Homo sapiens
-
- Hex:3 HexNAc:9 / N-Linked (avg mass : 2333.1975)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Golgi apparatus protein 1 / Homo sapiens
- BDNF/NT-3 growth factors receptor / Mus musculus
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- GNITEYQCHQYITK (14aa)
- PLVDLPIGINITR (13aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- IHVTNHTEYHGCLQLDNPTHMNNGDYTLMAK (31aa)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
Source
Reported glycosite
Source
Disease
Reported glycosite
