Hex:3 HexNAc:4

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Canis lupus familiaris (Dog)
• Equus caballus (Domestic horse)
• Felis catus (Cat)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Nicotiana tabacum (Common tobacco)
• Gallus gallus (Chicken)
• Physomitrella patens
• Torpedo californica (Pacific electric ray)
• Trichinella spiralis
• Apis mellifera (Honeybee)
• Drosophila melanogaster (Fruit fly)
• Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens    P30533
• Alpha-fetoprotein / Homo sapiens    P02771
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein D / Homo sapiens    P05090
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Cartilage intermediate layer protein 1 / Homo sapiens    O75339
• CD59 glycoprotein / Homo sapiens    P13987
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Complement component C8 beta chain / Homo sapiens    P07358
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Erythropoietin / Homo sapiens    P01588
• Fibronectin / Homo sapiens    P02751
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• High affinity immunoglobulin gamma Fc receptor I / Homo sapiens    P12314-2
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• IgG-IL2 fusion protein / Homo sapiens    P60568
• IgG1-NK08-V/F genotype / Homo sapiens    P01857
• IgG1-NK09-V/F genotype / Homo sapiens    P01857
• IgG1-NK11-F/F genotype / Homo sapiens    P01857
• IgG1-NK12-V/F genotype / Homo sapiens    P01857
• IgG1-NK13-V/F genotype / Homo sapiens    P01857
• Immunoglobulin alpha (non secretory) / Homo sapiens    P01877    P01876
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens    P0DOX2
• Immunoglobulin gamma / Homo sapiens    P01857    P01859    P01861    P01860
• Immunoglobulin gamma-1 heavy chain / Homo sapiens    P0DOX5
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens    
• Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens    P01860
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens    
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interferon gamma / Homo sapiens    P01579
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens    P12318-1
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens    P31994-3
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens    O75015
• Mammaglobin-A / Homo sapiens    Q13296
• Mucin-2 / Homo sapiens    Q02817
• Nicalin / Homo sapiens    Q969V3
• Periostin / Homo sapiens    Q15063
• Plexin-c1 / Homo sapiens    O60486
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Protein sel-1 homolog 1 / Homo sapiens    Q9UBV2
• Recombinant IgG / Homo sapiens    P01857
• Rituximab – IgG1-kappa / Homo sapiens    P01857
• Sciellin / Homo sapiens    O95171
• Serpin h1 / Homo sapiens    P50454
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens    O15389
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens    Q9Y286
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens    Q9NYZ4
• Thrombospondin-1 / Homo sapiens    P07996
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens    P29965
• UPF0688 protein C1orf174 / Homo sapiens    Q8IYL3
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Immunoglobulin gamma / Bos taurus    
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Uncharacterized protein (gene name abca4) / Bos taurus    F1MWM0
• Immunoglobulin gamma / Canis lupus familiaris    
• Immunoglobulin gamma / Equus caballus    
• Immunoglobulin gamma / Felis catus    
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus    
• Endoplasmic reticulum-Golgi intermediate compartment protein 2 / Mus musculus    Q9CR89
• Immunoglobulin gamma / Mus musculus    
• Immunoglobulin mu chain C region / Mus musculus    P01872
• Laminin subunit beta-2 / Mus musculus    Q61292
• Laminin subunit gamma-1 / Mus musculus    P02468
• Monoclonal antibody okt3 / Mus musculus    
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Nicalin / Mus musculus    Q8VCM8
• Prenylcysteine oxidase / Mus musculus    Q9CQF9
• Receptor-type tyrosine-protein phosphatase C / Mus musculus    P06800
• Tenascin-r / Mus musculus    Q8BYI9
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Immunoglobulin gamma / Oryctolagus cuniculus    
• Immunoglobulin gamma / Ovis aries    
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• T-cell surface glycoprotein cd4 / Rattus norvegicus    P05540
• Amiloride-sensitive amine oxidase / Sus scrofa    Q9TRC7
• Uncharacterized protein from Aorta / Sus scrofa    
• Uncharacterized protein / Nicotiana tabacum    
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein / Gallus gallus    
• Uncharacterized protein / Physomitrella patens    
• Acetylcholine receptor protein / Torpedo californica    P02710    P02714    P02718    P02712
• Tsl-1 antigens / Trichinella spiralis    
• Uncharacterized protein from Royal Jelly / Apis mellifera    
• Uncharacterized protein / Drosophila melanogaster    
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Aorta (UBERON_0000947)   MYP30 (CVCL_Z591)   Endothelial Cell (CL_0000115)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)   Mature NK T cell (CL_0000814)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Colonic Mucosa (UBERON_0000317)  
• Electric Organ (UBERON_0006869)  
• Embryo (UBERON_0000922)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   BHK-21A (CVCL_RQ70)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)  
• Lung (UBERON_0002048)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Ovary (UBERON_0000992)   CHO-K1 (CVCL_0214)  
• Ovary (UBERON_0000992)   IM4 (CVCL_VT63)  
• Ovary (UBERON_0000992)   IM4/V/IV (CVCL_VT67)  
• Ovary (UBERON_0000992)   IM4/V/IV-G1 (CVCL_VT68)  
• Ovary (UBERON_0000992)   IM4/V/IV-G2 (CVCL_VT69)  
• Ovary (UBERON_0000992)   IM4/V/IV-G3 (CVCL_VT70)  
• Ovary (UBERON_0000992)   IM4/V/IV-G4 (CVCL_VT71)  
• Ovary (UBERON_0000992)   IM4/V/IV-G5 (CVCL_VT72)  
• Ovary (UBERON_0000992)   IM4/Vm (CVCL_VT66)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Pituitary Gland (UBERON_0000007)  
• Retina (UBERON_0000966)  
• Royal Jelly  
• Seminal Fluid (UBERON_0006530)  
• Spleen (UBERON_0002106)  
• Striatum (UBERON_0002345)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• BTI-Tn-5B1-4 (CVCL_C190)  
• CHO (CVCL_0213)  
• CHO-DG44 (CVCL_7180)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293-F (CVCL_6642)  
• J558L (CVCL_3949)  
• LS174T (CVCL_1384)  
• P3X63Ag8U.1 (CVCL_3412)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  
• Egg Cell  
• Egg Cell   Egg White  

Reported structure

• N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ HexNAc(b1-?)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x GlcNAc"
• N-Linked / Complex / Structure 9533
• N-Linked / Complex / Structure 9580
• N-Linked / Complex / Structure 9828
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Structure 9793
• N-Linked / No-core / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / No-core / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• O-Linked / Core 2 / Structure 11387
• O-Linked / Core 2 / Structure 11407
• O-Linked / Core 3 / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc

Composition

• Hex:3 HexNAc:4 (avg mass : 1317.2225 )

Disease

• Arthritis (DOID:848)
• Arthritis, Rheumatoid (DOID:7148)
• Asymptomatic myositis (DOID:633)
• Cancer, breast (DOID:1612)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Diverticulosis (DOID:7475)
• Gangliosidosis GM1 (DOID:3322)
• Gangliosidosis GM2, Sandhoff Disease (DOID:3323)
• Gastritis (DOID:4029)
• Gaucher Disease (DOID:1926)
• Multiple myeloma (DOID:9538)
• Myeloma (DOID:0070004)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Myositis (DOID:633)
• Parkinson's disease (DOID:14330)
• Plasmacytoma (Mouse) (DOID:3721)
• Prostate cancer (DOID:10283)
• Sjogren's Syndrome (DOID:12894)
• Systemic lupus erythematosus (DOID:9074)

Reference

• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
• The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
• Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
• Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
• Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
• The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
• Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
• Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
• Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
• Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
• Glycoproteins secreted from suspension-cultured tobacco BY2 cells have distinct glycan structures from intracellular glycoproteins. (2001 - Misaki R, Kimura Y, Fujiyama K, Seki T) / Status : Reviewed
• Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Down-regulation of the alpha-Gal epitope expression in N-glycans of swine endothelial cells by transfection with the N-acetylglucosaminyltransferase III gene. Modulation of the biosynthesis of terminal structures by a bisecting GlcNAc (2001 - Koyoto, Ikeda, Miyagawa, Ihara, Koma, Honke, Shirakura, Taniguchi) / Status : Reviewed
• Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
• The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
• A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
• Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
• Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
• Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
• Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
• Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
• Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Oligosaccharide structures of isolated human colonic mucin species. (1985 - Podolsky D) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
• Characterization and analysis of branched-chain N-acetylglucosaminyl oligosaccharides accumulating in Sandhoff disease tissue. Evidence that biantennary bisected oligosaccharide side chains of glycoproteins are abundant substrates for lysosomes. (1985 - Warner TG, deKremer RD, Sjoberg ER, Mock AK) / Status : Reviewed
• Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
• Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed

Reported glycosite

• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
  •        Asn-268
• Alpha-fetoprotein / Homo sapiens
  •        Asn-251
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Cartilage intermediate layer protein 1 / Homo sapiens
  •        Asn-631
• CD59 glycoprotein / Homo sapiens
  •        Undefined site
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
• Complement component C8 beta chain / Homo sapiens
  •        Asn-243
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-53
• Erythropoietin / Homo sapiens
  •        Asn-51
• Fibronectin / Homo sapiens
  •        Asn-542
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-63
• High affinity immunoglobulin gamma Fc receptor I / Homo sapiens
  •        Undefined site
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-515
• IgG-IL2 fusion protein / Homo sapiens
  •        Undefined site
• IgG1-NK08-V/F genotype / Homo sapiens
  •        Asn-180
• IgG1-NK09-V/F genotype / Homo sapiens
  •        Asn-180
• IgG1-NK11-F/F genotype / Homo sapiens
  •        Asn-180
• IgG1-NK12-V/F genotype / Homo sapiens
  •        Asn-180
• IgG1-NK13-V/F genotype / Homo sapiens
  •        Asn-180
• Immunoglobulin alpha (non secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-1 heavy chain / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Asn-144
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
  •        Asn-205
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Undefined site
  •        Asn-227
  •        Asn-180
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Undefined site
  •        Asn-227
  •        Asn-176
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
  •        Asn-227
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
• Interferon gamma / Homo sapiens
  •        Undefined site
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-1366
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
  •        Undefined site
• Mammaglobin-A / Homo sapiens
  •        Asn-53
• Mucin-2 / Homo sapiens
  •        Undefined site
• Nicalin / Homo sapiens
  •        Asn-428
• Periostin / Homo sapiens
  •        Asn-599
• Plexin-c1 / Homo sapiens
  •        Asn-407
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Protein sel-1 homolog 1 / Homo sapiens
  •        Asn-217
• Recombinant IgG / Homo sapiens
  •        Asn-180
• Rituximab – IgG1-kappa / Homo sapiens
  •        Undefined site
• Sciellin / Homo sapiens
  •        Asn-562
• Serpin h1 / Homo sapiens
  •        Asn-120
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-1067
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
  •        Undefined site
• UPF0688 protein C1orf174 / Homo sapiens
  •        Asn-154
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Immunoglobulin gamma / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein (gene name abca4) / Bos taurus
  •        Asn-1455
• Immunoglobulin gamma / Canis lupus familiaris
  •        Undefined site
• Immunoglobulin gamma / Equus caballus
  •        Undefined site
• Immunoglobulin gamma / Felis catus
  •        Undefined site
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Endoplasmic reticulum-Golgi intermediate compartment protein 2 / Mus musculus
  •        Asn-212
• Immunoglobulin gamma / Mus musculus
  •        Undefined site
• Immunoglobulin mu chain C region / Mus musculus
  •        Asn-280
• Laminin subunit beta-2 / Mus musculus
  •        Asn-1500
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
• Monoclonal antibody okt3 / Mus musculus
  •        Undefined site
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Nicalin / Mus musculus
  •        Asn-428
• Prenylcysteine oxidase / Mus musculus
  •        Asn-353
• Receptor-type tyrosine-protein phosphatase C / Mus musculus
  •        Asn-427
• Tenascin-r / Mus musculus
  •        Undefined site
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Immunoglobulin gamma / Ovis aries
  •        Undefined site
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• T-cell surface glycoprotein cd4 / Rattus norvegicus
  •        Undefined site
• Amiloride-sensitive amine oxidase / Sus scrofa
  •        Undefined site
• Uncharacterized protein from Aorta / Sus scrofa
  •        Undefined site
• Uncharacterized protein / Nicotiana tabacum
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
  •        Asn-293
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Physomitrella patens
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Uncharacterized protein from Royal Jelly / Apis mellifera
  •        Undefined site
• Uncharacterized protein / Drosophila melanogaster
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-165
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-615
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-1074
  •        Asn-1098

Mass spectrometry observed peptide

• NSGALTSGVHTFPAVLQSSGLY (22aa)
  •    P01857        Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
  •       177:L→N
• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53     Dipeptidyl peptidase 1 / Homo sapiens
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53     Mammaglobin-A / Homo sapiens
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• APLVNVTLYYEALCGGCR (18aa)
  •    P13284    Asn-63     Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• SISNSTAR (8aa)
  •    P50454    Asn-120     Serpin h1 / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01877    Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• NSSSTVQK (8aa)
  •    Q8IYL3    Asn-154     UPF0688 protein C1orf174 / Homo sapiens
• SSANNCTF (8aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SSANNCTFEY (10aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KTKPREEQFNSTFRV (15aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
• EEQYNSTYR (9aa)
  •    P01857    Asn-227     Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •    P01857    Asn-180     Recombinant IgG / Homo sapiens
• KTKPREEQYNSTYRV (15aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• TKPREEQYNSTY (12aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• TKPREEQYNSTYR (13aa)
  •    P01857    Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
  •    P01857    Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
  •    P01857    Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
  •    P01857    Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
  •    P01857    Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
• EEQYNSTY (8aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• GHAHLAALVNHDSYNFSHR (19aa)
  •    Q9CR89    Asn-212     Endoplasmic reticulum-Golgi intermediate compartment protein 2 / Mus musculus
• AASMNHTK (8aa)
  •    Q9UBV2    Asn-217     Protein sel-1 homolog 1 / Homo sapiens
• EEQFNSTFR (9aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •    P01859    Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •    P01860    Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •    VAR_003892   226:Y→F
• GINIT (5aa)
  •    P0DTC2    Asn-234     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SYSDFERNVTE (11aa)
  •    P07358    Asn-243     Complement component C8 beta chain / Homo sapiens
• VIDLWDLAQSANLTDK (16aa)
  •    P30533    Asn-268     Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
• IMESHPNGTFSAK (13aa)
  •    P01872    Asn-280     Immunoglobulin mu chain C region / Mus musculus
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VIYQNHNK (8aa)
  •    P11627    Asn-293     Neural cell adhesion molecule L1 / Mus musculus
• YNLT (4aa)
  •    P01012    Asn-293     Ovalbumin / Gallus gallus
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GELNSTLFSSRPK (13aa)
  •    Q9CQF9    Asn-353     Prenylcysteine oxidase / Mus musculus
• SLPNNVTSFEVESLKPYK (18aa)
  •    P06800    Asn-427     Receptor-type tyrosine-protein phosphatase C / Mus musculus
• VIYNITEK (8aa)
  •    Q969V3    Asn-428     Nicalin / Homo sapiens
• VIYNLTEK (8aa)
  •    Q8VCM8    Asn-428     Nicalin / Mus musculus
• VFGSQNITTVK (11aa)
  •    Q9Y4L1    Asn-515     Hypoxia up-regulated protein 1 / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• NGSSNTGAK (9aa)
  •    O95171    Asn-562     Sciellin / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NISTATAAQTDLNFINDEGDTFPLR (25aa)
  •    O75339    Asn-631     Cartilage intermediate layer protein 1 / Homo sapiens
• NFTIS (5aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• KNFTTAPAICHDGK (14aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNFTTAPA (13aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VSNGTHWFVTQR (12aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• AHFPREGVFVSNGTHW (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105     Laminin subunit gamma-1 / Mus musculus
• CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
  •    Q14766    Asn-1366     Latent transforming growth factor beta binding protein 1 / Homo sapiens
• AQAALDKANASR (12aa)
  •    Q61292    Asn-1500     Laminin subunit beta-2 / Mus musculus
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763     Collagen alpha-1(XII) chain / Homo sapiens