taxonomy (20)
protein (100)
source (47)
structure (18)
composition (1)
disease (20)
reference (70)
site (122)
peptide (59)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis lupus familiaris (Dog)
- Equus caballus (Domestic horse)
- Felis catus (Cat)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Nicotiana tabacum (Common tobacco)
- Gallus gallus (Chicken)
- Physomitrella patens
- Torpedo californica (Pacific electric ray)
- Trichinella spiralis
- Apis mellifera (Honeybee)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens P30533
- Alpha-fetoprotein / Homo sapiens P02771
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein D / Homo sapiens P05090
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cartilage intermediate layer protein 1 / Homo sapiens O75339
- CD59 glycoprotein / Homo sapiens P13987
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Complement component C8 beta chain / Homo sapiens P07358
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Erythropoietin / Homo sapiens P01588
- Fibronectin / Homo sapiens P02751
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- IgG-IL2 fusion protein / Homo sapiens P60568
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens P01860
- Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interferon gamma / Homo sapiens P01579
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Mammaglobin-A / Homo sapiens Q13296
- Mucin-2 / Homo sapiens Q02817
- Nicalin / Homo sapiens Q969V3
- Periostin / Homo sapiens Q15063
- Plexin-c1 / Homo sapiens O60486
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Protein sel-1 homolog 1 / Homo sapiens Q9UBV2
- Sciellin / Homo sapiens O95171
- Serpin h1 / Homo sapiens P50454
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- Sialic acid-binding Ig-like lectin 8 / Homo sapiens Q9NYZ4
- Thrombospondin-1 / Homo sapiens P07996
- Tumor necrosis factor ligand superfamily member 5 / Homo sapiens P29965
- UPF0688 protein C1orf174 / Homo sapiens Q8IYL3
- Collagen alpha-1(IV) chain / Bos taurus Q7SIB2
- Collagen alpha-2 (IV) chain / Bos taurus Q7SIB3
- Immunoglobulin gamma / Bos taurus
- Thyrotropin-aplha and beta chains / Bos taurus P01217 P01223
- Uncharacterized protein (gene name abca4) / Bos taurus F1MWM0
- Immunoglobulin gamma / Canis lupus familiaris
- Immunoglobulin gamma / Equus caballus
- Immunoglobulin gamma / Felis catus
- Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Endoplasmic reticulum-Golgi intermediate compartment protein 2 / Mus musculus Q9CR89
- Immunoglobulin gamma / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus P01872
- Laminin subunit beta-2 / Mus musculus Q61292
- Laminin subunit gamma-1 / Mus musculus P02468
- Monoclonal antibody okt3 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Nicalin / Mus musculus Q8VCM8
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Receptor-type tyrosine-protein phosphatase C / Mus musculus P06800
- Tenascin-r / Mus musculus Q8BYI9
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Immunoglobulin gamma / Oryctolagus cuniculus
- Immunoglobulin gamma / Ovis aries
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- T-cell surface glycoprotein cd4 / Rattus norvegicus P05540
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Uncharacterized protein from Aorta / Sus scrofa
- Uncharacterized protein / Nicotiana tabacum
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Uncharacterized protein / Physomitrella patens
- Acetylcholine receptor protein / Torpedo californica P02712 P02718 P02710 P02714
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein from Royal Jelly / Apis mellifera
- Uncharacterized protein / Drosophila melanogaster
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Aorta (UBERON_0000947) MYP30 (CVCL_Z591) Endothelial Cell (CL_0000115)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Colonic Mucosa (UBERON_0000317)
- Electric Organ (UBERON_0006869)
- Embryo (UBERON_0000922)
- Glomerular Basement Membrane (UBERON_0005777)
- Kidney (UBERON_0002113) BHK-21A (CVCL_RQ70)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Lung (UBERON_0002048)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Ovary (UBERON_0000992) IM4 (CVCL_VT63)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Ovary (UBERON_0000992) IM4/Vm (CVCL_VT66)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Pituitary Gland (UBERON_0000007)
- Retina (UBERON_0000966)
- Royal Jelly
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- J558L (CVCL_3949)
- LS174T (CVCL_1384)
- P3X63Ag8U.1 (CVCL_3412)
- RPMI-1788 (CVCL_2710) B-Lymphocyte (CL_0000236)
- Egg Cell
- Egg Cell Egg White
Source
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x GlcNAc"
- N-Linked / Complex / Structure 9533
- N-Linked / Complex / Structure 9580
- N-Linked / Complex / Structure 9828
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9793
- N-Linked / No-core / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / No-core / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- O-Linked / Core 3 / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc
Reported structure
- Hex:3 HexNAc:4 (avg mass : 1317.2225 )
Composition
- Arthritis (DOID:848)
- Arthritis, Rheumatoid (DOID:7148)
- Asymptomatic myositis (DOID:633)
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Diverticulosis (DOID:7475)
- Gangliosidosis GM1 (DOID:3322)
- Gangliosidosis GM2, Sandhoff Disease (DOID:3323)
- Gastritis (DOID:4029)
- Gaucher Disease (DOID:1926)
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Myositis (DOID:633)
- Plasmacytoma (Mouse) (DOID:3721)
- Prostate cancer (DOID:10283)
- Sjogren's Syndrome (DOID:12894)
- Systemic lupus erythematosus (DOID:9074)
Disease
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Glycoproteins secreted from suspension-cultured tobacco BY2 cells have distinct glycan structures from intracellular glycoproteins. (2001 - Misaki R, Kimura Y, Fujiyama K, Seki T) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Down-regulation of the alpha-Gal epitope expression in N-glycans of swine endothelial cells by transfection with the N-acetylglucosaminyltransferase III gene. Modulation of the biosynthesis of terminal structures by a bisecting GlcNAc (2001 - Koyoto, Ikeda, Miyagawa, Ihara, Koma, Honke, Shirakura, Taniguchi) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
- Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Oligosaccharide structures of isolated human colonic mucin species. (1985 - Podolsky D) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Characterization and analysis of branched-chain N-acetylglucosaminyl oligosaccharides accumulating in Sandhoff disease tissue. Evidence that biantennary bisected oligosaccharide side chains of glycoproteins are abundant substrates for lysosomes. (1985 - Warner TG, deKremer RD, Sjoberg ER, Mock AK) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
Reference
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Alpha-fetoprotein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein D / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cartilage intermediate layer protein 1 / Homo sapiens
-
CD59 glycoprotein / Homo sapiens
- Undefined site
- Collagen alpha-1(XII) chain / Homo sapiens
- Complement component C8 beta chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
IgG-IL2 fusion protein / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Asn-144
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Asn-227
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
Interferon gamma / Homo sapiens
- Undefined site
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Mammaglobin-A / Homo sapiens
-
Mucin-2 / Homo sapiens
- Undefined site
- Nicalin / Homo sapiens
- Periostin / Homo sapiens
- Plexin-c1 / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
- Protein sel-1 homolog 1 / Homo sapiens
- Sciellin / Homo sapiens
- Serpin h1 / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
- Thrombospondin-1 / Homo sapiens
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
- UPF0688 protein C1orf174 / Homo sapiens
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
- Uncharacterized protein (gene name abca4) / Bos taurus
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
- Endoplasmic reticulum-Golgi intermediate compartment protein 2 / Mus musculus
-
Immunoglobulin gamma / Mus musculus
- Undefined site
- Immunoglobulin mu chain C region / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
-
Monoclonal antibody okt3 / Mus musculus
- Undefined site
- Neural cell adhesion molecule L1 / Mus musculus
- Nicalin / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Receptor-type tyrosine-protein phosphatase C / Mus musculus
-
Tenascin-r / Mus musculus
- Undefined site
- Thy-1 membrane glycoprotein / Mus musculus
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Uncharacterized protein from Aorta / Sus scrofa
- Undefined site
-
Uncharacterized protein / Nicotiana tabacum
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- HENNTKDNSIQHEFSLTR (18aa)
- DVNCSVMGPQEK (12aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- FSNVTWF (7aa)
- APLVNVTLYYEALCGGCR (18aa)
- CIQANYSIMENGK (13aa)
- NK (2aa)
- FHAIHVSGTNGTKRF (15aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- SISNSTAR (8aa)
- TQSLLIVNNATNVVIK (16aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- NSSSTVQK (8aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- KTKPREEQFNSTFRV (15aa)
- EEQYNSTYR (9aa)
- KTKPREEQYNSTYRV (15aa)
- TKPREEQYNSTY (12aa)
- EEQYNSTY (8aa)
- TPLTANITK (9aa)
- GHAHLAALVNHDSYNFSHR (19aa)
- AASMNHTK (8aa)
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- GINIT (5aa)
- SYSDFERNVTE (11aa)
- VIDLWDLAQSANLTDK (16aa)
- IMESHPNGTFSAK (13aa)
- FLLKYNENGTIT (12aa)
- VIYQNHNK (8aa)
- RFPNIT (6aa)
- GELNSTLFSSRPK (13aa)
- SLPNNVTSFEVESLKPYK (18aa)
- VIYNITEK (8aa)
- VIYNLTEK (8aa)
- VFGSQNITTVK (11aa)
- RHEEGHMINCTCFGQGR (17aa)
- NGSSNTGAK (9aa)
- EVNDTLLVNELK (12aa)
- LYQDVNCT (8aa)
- NISTATAAQTDLNFINDEGDTFPLR (25aa)
- NFTIS (5aa)
- FGGFNFS (7aa)
- VVNSTTGPGEHIR (13aa)
- KNFTTAPAICHDGK (14aa)
- VPAQEKNFTTAPA (13aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- EGVFVSNGTHW (11aa)
- VSNGTHWFVTQR (12aa)
- AHFPREGVFVSNGTHW (16aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- VNSSLHSQISR (11aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- AQAALDKANASR (12aa)
- NLQVYNATSNSLTVK (15aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1317.2225)
-
Uncharacterized protein from Aorta / Sus scrofa
- Undefined site
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Embryo (UBERON_0000922)
- Kidney (UBERON_0002113) BHK-21A (CVCL_RQ70)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- BTI-Tn-5B1-4 (CVCL_C190)
- HEK293 (CVCL_0045)
- Asymptomatic myositis (DOID:633)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
IgG-IL2 fusion protein / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- EEQYNSTYR (9aa)
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- KNFTTAPAICHDGK (14aa)
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Electric Organ (UBERON_0006869)
- Glomerular Basement Membrane (UBERON_0005777)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Ovary (UBERON_0000992) IM4 (CVCL_VT63)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Ovary (UBERON_0000992) IM4/Vm (CVCL_VT66)
- Ovary (UBERON_0000992)
- Royal Jelly
- Urine (UBERON_0001088)
- HEK293 (CVCL_0045)
- J558L (CVCL_3949)
- P3X63Ag8U.1 (CVCL_3412)
- Egg Cell Egg White
- Arthritis (DOID:848)
- Arthritis, Rheumatoid (DOID:7148)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gangliosidosis GM1 (DOID:3322)
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Plasmacytoma (Mouse) (DOID:3721)
- Sjogren's Syndrome (DOID:12894)
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Glycoproteins secreted from suspension-cultured tobacco BY2 cells have distinct glycan structures from intracellular glycoproteins. (2001 - Misaki R, Kimura Y, Fujiyama K, Seki T) / Status : Reviewed
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
- Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
- Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
- Alpha-fetoprotein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
CD59 glycoprotein / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Interferon gamma / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma / Mus musculus
- Undefined site
-
Monoclonal antibody okt3 / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Uncharacterized protein / Nicotiana tabacum
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
- N-Linked / Complex
(avg mass : 1317.2225)
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Colon adenocarcinoma (DOID:234)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Tenascin-r / Mus musculus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1317.2225)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- KTKPREEQFNSTFRV (15aa)
- KTKPREEQYNSTYRV (15aa)
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Embryo (UBERON_0000922)
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Hybrid
(avg mass : 1317.2225)
- Spleen (UBERON_0002106)
- Egg Cell
- Gaucher Disease (DOID:1926)
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1317.2225)
- Embryo (UBERON_0000922)
-
- N-Linked / No-core
(avg mass : 1317.2225)
- Brain (UBERON_0000955)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Lung (UBERON_0002048)
- Pancreas (UBERON_0001264)
- Spleen (UBERON_0002106)
-
- N-Linked / No-core
(avg mass : 1317.2225)
- Brain (UBERON_0000955)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Lung (UBERON_0002048)
- Pancreas (UBERON_0001264)
- Spleen (UBERON_0002106)
-
- O-Linked / Core 3
(avg mass : 1317.2225)
- Colonic Mucosa (UBERON_0000317)
- Diverticulosis (DOID:7475)
-
Mucin-2 / Homo sapiens
- Undefined site
-
- Hex:3 HexNAc:4 / N-Linked
(avg mass : 1317.2225)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Retina (UBERON_0000966)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x GlcNAc"
- N-Linked / Complex / Structure 9533
- N-Linked / Complex / Structure 9580
- N-Linked / Complex / Structure 9828
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9793
- N-Linked / No-core / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / No-core / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Cartilage intermediate layer protein 1 / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Complement component C8 beta chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Nicalin / Homo sapiens
- Periostin / Homo sapiens
- Plexin-c1 / Homo sapiens
- Protein sel-1 homolog 1 / Homo sapiens
- Sciellin / Homo sapiens
- Serpin h1 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- UPF0688 protein C1orf174 / Homo sapiens
- Uncharacterized protein (gene name abca4) / Bos taurus
- Endoplasmic reticulum-Golgi intermediate compartment protein 2 / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Nicalin / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Receptor-type tyrosine-protein phosphatase C / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- HENNTKDNSIQHEFSLTR (18aa)
- DVNCSVMGPQEK (12aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- FSNVTWF (7aa)
- APLVNVTLYYEALCGGCR (18aa)
- CIQANYSIMENGK (13aa)
- FHAIHVSGTNGTKRF (15aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- SISNSTAR (8aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- NSSSTVQK (8aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- EEQYNSTYR (9aa)
- TKPREEQYNSTY (12aa)
- EEQYNSTY (8aa)
- TPLTANITK (9aa)
- GHAHLAALVNHDSYNFSHR (19aa)
- AASMNHTK (8aa)
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- GINIT (5aa)
- SYSDFERNVTE (11aa)
- VIDLWDLAQSANLTDK (16aa)
- IMESHPNGTFSAK (13aa)
- FLLKYNENGTIT (12aa)
- VIYQNHNK (8aa)
- RFPNIT (6aa)
- GELNSTLFSSRPK (13aa)
- SLPNNVTSFEVESLKPYK (18aa)
- VIYNITEK (8aa)
- VIYNLTEK (8aa)
- VFGSQNITTVK (11aa)
- RHEEGHMINCTCFGQGR (17aa)
- NGSSNTGAK (9aa)
- EVNDTLLVNELK (12aa)
- LYQDVNCT (8aa)
- NISTATAAQTDLNFINDEGDTFPLR (25aa)
- NFTIS (5aa)
- FGGFNFS (7aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNFTTAPA (13aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- EGVFVSNGTHW (11aa)
- VSNGTHWFVTQR (12aa)
- AHFPREGVFVSNGTHW (16aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- VNSSLHSQISR (11aa)
- AQAALDKANASR (12aa)
- NLQVYNATSNSLTVK (15aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:4 / N-Linked
(avg mass : 1317.2225)
Source
Disease
Reported glycosite
- O-Linked / Core 3
(avg mass : 1317.2225)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1317.2225)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1317.2225)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1317.2225)
Source
Disease
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1317.2225)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1317.2225)
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1317.2225)
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)