Hex:3 HexNAc:4

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Nicotiana tabacum (Common tobacco)
• Gallus gallus (Chicken)
• Physomitrella patens
• Torpedo californica (Pacific electric ray)
• Trichinella spiralis
• Apis mellifera (Honeybee)
• Drosophila melanogaster (Fruit fly)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens    P30533
• Alpha-fetoprotein / Homo sapiens    P02771
• Apolipoprotein d / Homo sapiens    P05090
• Cartilage intermediate layer protein 1 / Homo sapiens    O75339
• CD59 glycoprotein / Homo sapiens    P13987
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Complement component C8 beta chain / Homo sapiens    P07358
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Erythropoietin / Homo sapiens    P01588
• Fibronectin / Homo sapiens    P02751
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• IgG-IL2 fusion protein / Homo sapiens    P60568
• Immunoglobulin gamma / Homo sapiens    P01857    P01860    P01861    P01859
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa234] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interferon gamma / Homo sapiens    P01579
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Mammaglobin-A / Homo sapiens    Q13296
• Mucin-2 / Homo sapiens    Q02817
• Nicalin / Homo sapiens    Q969V3
• Periostin / Homo sapiens    Q15063
• Plexin-c1 / Homo sapiens    O60486
• Prosaposin / Homo sapiens    P07602
• Protein sel-1 homolog 1 / Homo sapiens    Q9UBV2
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Sciellin / Homo sapiens    O95171
• Serpin h1 / Homo sapiens    P50454
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens    O15389
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens    Q9Y286
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens    Q9NYZ4
• Thrombospondin-1 / Homo sapiens    P07996
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens    P29965
• UPF0688 protein C1orf174 / Homo sapiens    Q8IYL3
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Immunoglobulin gamma / Bos taurus
• Thyrotropin-aplha and beta chains / Bos taurus    P01217    P01223
• Uncharacterized protein (gene name abca4) / Bos taurus    F1MWM0
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Endoplasmic reticulum-Golgi intermediate compartment protein 2 / Mus musculus    Q9CR89
• Immunoglobulin gamma / Mus musculus
• Immunoglobulin mu chain C region / Mus musculus    P01872
• Laminin subunit beta-2 / Mus musculus    Q61292
• Laminin subunit gamma-1 / Mus musculus    P02468
• Monoclonal antibody okt3 / Mus musculus
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Nicalin / Mus musculus    Q8VCM8
• Prenylcysteine oxidase / Mus musculus    Q9CQF9
• Receptor-type tyrosine-protein phosphatase C / Mus musculus    P06800
• Tenascin-r / Mus musculus    Q8BYI9
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Immunoglobulin gamma / Oryctolagus cuniculus
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• T-cell surface glycoprotein cd4 / Rattus norvegicus    P05540
• Amiloride-sensitive amine oxidase / Sus scrofa    Q9TRC7
• Uncharacterized protein from Endothelial Cell / Sus scrofa
• Uncharacterized protein from Supernatant / Nicotiana tabacum
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein from Egg Cell / Gallus gallus
• Uncharacterized protein from Whole Plant / Physomitrella patens
• Acetylcholine receptor protein / Torpedo californica    P02712    P02714    P02718    P02710
• Tsl-1 antigens / Trichinella spiralis
• Uncharacterized protein from Royal Jelly / Apis mellifera
• Uncharacterized protein from Undefined tissue / Drosophila melanogaster
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Aorta (UBERON_0000947)   MYP30 (CVCL_Z591)   Endothelial Cell (CL_0000115)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Colonic Mucosa (UBERON_0000317)  
• Electric Organ (UBERON_0006869)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   BHK-21A (CVCL_RQ70)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)  
• Lung (UBERON_0002048)  
• Mammary Gland (UBERON_0001911)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Ovary (UBERON_0000992)   CHO-K1 (CVCL_0214)  
• Ovary (UBERON_0000992)   IM4 (CVCL_VT63)  
• Ovary (UBERON_0000992)   IM4/V/IV (CVCL_VT67)  
• Ovary (UBERON_0000992)   IM4/V/IV-G1 (CVCL_VT68)  
• Ovary (UBERON_0000992)   IM4/V/IV-G2 (CVCL_VT69)  
• Ovary (UBERON_0000992)   IM4/V/IV-G3 (CVCL_VT70)  
• Ovary (UBERON_0000992)   IM4/V/IV-G4 (CVCL_VT71)  
• Ovary (UBERON_0000992)   IM4/V/IV-G5 (CVCL_VT72)  
• Ovary (UBERON_0000992)   IM4/Vm (CVCL_VT66)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Pituitary Gland (UBERON_0000007)  
• Retina (UBERON_0000966)  
• Royal Jelly  
• Spleen (UBERON_0002106)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• BTI-Tn-5B1-4 (CVCL_C190)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• J558L (CVCL_3949)  
• P3X63Ag8U.1 (CVCL_3412)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  
• Egg Cell  
• Egg Cell   Egg White  

Reported structure

• N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ HexNAc(b1-?)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x GlcNAc"
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / No-core / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / No-core / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Undefined core / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc + " + 2x HexNAc "
• O-Linked / Core 3 / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc

Composition

• Hex:3 HexNAc:4 (avg mass : 1317.2225 )

Disease

• Arthritis (DOID:848)
• Arthritis, Rheumatoid (DOID:7148)
• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Diverticulosis (DOID:7475)
• Gangliosidosis GM1 (DOID:3322)
• Gangliosidosis GM2, Sandhoff Disease (DOID:3323)
• Gaucher Disease (DOID:1926)
• Myeloma (DOID:0070004)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Plasmacytoma (Mouse) (DOID:3721)
• Prostate cancer (DOID:10283)
• Sjogren's Syndrome (DOID:12894)

Reference

• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
• Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
• Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
• The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
• A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
• Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
• Down-regulation of the alpha-Gal epitope expression in N-glycans of swine endothelial cells by transfection with the N-acetylglucosaminyltransferase III gene. Modulation of the biosynthesis of terminal structures by a bisecting GlcNAc (2001 - Koyoto, Ikeda, Miyagawa, Ihara, Koma, Honke, Shirakura, Taniguchi) / Status : Reviewed
• Glycoproteins secreted from suspension-cultured tobacco BY2 cells have distinct glycan structures from intracellular glycoproteins. (2001 - Misaki R, Kimura Y, Fujiyama K, Seki T) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
• Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
• Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
• N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
• Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
• Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
• The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Oligosaccharide structures of isolated human colonic mucin species. (1985 - Podolsky D) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
• Characterization and analysis of branched-chain N-acetylglucosaminyl oligosaccharides accumulating in Sandhoff disease tissue. Evidence that biantennary bisected oligosaccharide side chains of glycoproteins are abundant substrates for lysosomes. (1985 - Warner TG, deKremer RD, Sjoberg ER, Mock AK) / Status : Reviewed
• Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
• Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed

Reported glycosite

• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
  •        Asn-268
• Alpha-fetoprotein / Homo sapiens
  •        Asn-251
• Apolipoprotein d / Homo sapiens
  •        Asn-65
  •        Asn-98
• Cartilage intermediate layer protein 1 / Homo sapiens
  •        Asn-631
• CD59 glycoprotein / Homo sapiens
  •        Undefined site
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
• Complement component C8 beta chain / Homo sapiens
  •        Asn-243
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-53
• Erythropoietin / Homo sapiens
  •        Asn-51
• Fibronectin / Homo sapiens
  •        Asn-542
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-63
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-515
• IgG-IL2 fusion protein / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa234] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
  •        Asn-205
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
• Interferon gamma / Homo sapiens
  •        Undefined site
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-1366
• Mammaglobin-A / Homo sapiens
  •        Asn-53
• Mucin-2 / Homo sapiens
  •        Undefined site
• Nicalin / Homo sapiens
  •        Asn-428
• Periostin / Homo sapiens
  •        Asn-599
• Plexin-c1 / Homo sapiens
  •        Asn-407
• Prosaposin / Homo sapiens
  •        Undefined site
• Protein sel-1 homolog 1 / Homo sapiens
  •        Asn-217
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
  •        Asn-90
  •        Asn-322
  •        Asn-546
  •        Asn-690
• Sciellin / Homo sapiens
  •        Asn-562
• Serpin h1 / Homo sapiens
  •        Asn-120
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-1067
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
  •        Undefined site
• UPF0688 protein C1orf174 / Homo sapiens
  •        Asn-154
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Immunoglobulin gamma / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein (gene name abca4) / Bos taurus
  •        Asn-1455
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Endoplasmic reticulum-Golgi intermediate compartment protein 2 / Mus musculus
  •        Asn-212
• Immunoglobulin gamma / Mus musculus
  •        Undefined site
• Immunoglobulin mu chain C region / Mus musculus
  •        Asn-280
• Laminin subunit beta-2 / Mus musculus
  •        Asn-1500
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
• Monoclonal antibody okt3 / Mus musculus
  •        Undefined site
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Nicalin / Mus musculus
  •        Asn-428
• Prenylcysteine oxidase / Mus musculus
  •        Asn-353
• Receptor-type tyrosine-protein phosphatase C / Mus musculus
  •        Asn-427
• Tenascin-r / Mus musculus
  •        Undefined site
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• T-cell surface glycoprotein cd4 / Rattus norvegicus
  •        Undefined site
• Amiloride-sensitive amine oxidase / Sus scrofa
  •        Undefined site
• Uncharacterized protein from Endothelial Cell / Sus scrofa
  •        Undefined site
• Uncharacterized protein from Supernatant / Nicotiana tabacum
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Egg Cell / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Whole Plant / Physomitrella patens
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Uncharacterized protein from Royal Jelly / Apis mellifera
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Drosophila melanogaster
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-74
  •        Asn-331
  •        Asn-709
  •        Asn-717
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159
  •        Asn-1174
  •        Asn-1194
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-165
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-615
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-657
  •        Asn-1074
  •        Asn-1098

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
  •    P0DTC2    Asn-74
• APLVNVTLYYEALCGGCR (18aa)
  •    P13284    Asn-63
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74
• AQMYPLQEIQNL (12aa)
  •    Q9BYF1    Asn-90
• NLTVK (5aa)
  •    Q9BYF1    Asn-90
• QEIQNL (6aa)
  •    Q9BYF1    Asn-90
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98
• SISNSTAR (8aa)
  •    P50454    Asn-120
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01877    Asn-131
• NSSSTVQK (8aa)
  •    Q8IYL3    Asn-154
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• SSANNCTF (8aa)
  •    P0DTC2    Asn-165
• SSANNCTFEY (10aa)
  •    P0DTC2    Asn-165
• EEQFNSTFR (9aa)
  •    P01859    Asn-176
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• TKPREEQYNSTY (12aa)
  •    P01857    Asn-180
• EEQYNSTY (8aa)
  •    P01857    Asn-180
• TPLTANITK (9aa)
  •    P01877    Asn-205
• GHAHLAALVNHDSYNFSHR (19aa)
  •    Q9CR89    Asn-212
• AASMNHTK (8aa)
  •    Q9UBV2    Asn-217
• GINIT (5aa)
  •    P0DTC2    Asn-234
• SYSDFERNVTE (11aa)
  •    P07358    Asn-243
• VIDLWDLAQSANLTDK (16aa)
  •    P30533    Asn-268
• IMESHPNGTFSAK (13aa)
  •    P01872    Asn-280
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• VIYQNHNK (8aa)
  •    P11627    Asn-293
• VSVGLPNMTQGFWENSML (18aa)
  •    Q9BYF1    Asn-322
• VSVGLPNMTQGFW (13aa)
  •    Q9BYF1    Asn-322
• VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
  •    P0DTC2    Asn-331
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• RFPNIT (6aa)
  •    P0DTC2    Asn-331
• GELNSTLFSSRPK (13aa)
  •    Q9CQF9    Asn-353
• SLPNNVTSFEVESLKPYK (18aa)
  •    P06800    Asn-427
• VIYNITEK (8aa)
  •    Q969V3    Asn-428
• VIYNLTEK (8aa)
  •    Q8VCM8    Asn-428
• VFGSQNITTVK (11aa)
  •    Q9Y4L1    Asn-515
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• CDISNSTEAGQK (12aa)
  •    Q9BYF1    Asn-546
• NGSSNTGAK (9aa)
  •    O95171    Asn-562
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615
• NISTATAAQTDLNFINDEGDTFPLR (25aa)
  •    O75339    Asn-631
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• NVSDIIPR (8aa)
  •    Q9BYF1    Asn-690
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-717
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-709
• NFTIS (5aa)
  •    P0DTC2    Asn-717
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• KNFTTAPAICHDGK (14aa)
  •    P0DTC2    Asn-1074
• VPAQEKNFTTAPA (13aa)
  •    P0DTC2    Asn-1074
• VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (47aa)
  •    P0DTC2    Asn-1074
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074
• GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098
• GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPR (46aa)
  •    P0DTC2    Asn-1074
• GVFVSNGTHWFVTQR (15aa)
  •    P0DTC2    Asn-1098
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098
• VSNGTHWFVTQR (12aa)
  •    P0DTC2    Asn-1098
• AHFPREGVFVSNGTHW (16aa)
  •    P0DTC2    Asn-1098
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105
• ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
  •    P0DTC2    Asn-1174
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1174
• VAKNLNE (7aa)
  •    P0DTC2    Asn-1194
• CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
  •    Q14766    Asn-1366
• AQAALDKANASR (12aa)
  •    Q61292    Asn-1500
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763