Hex:4 HexNAc:5 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Calloselasma rhodostoma (Malayan pit viper)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-2-macroglobulin / Homo sapiens    P01023
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Asporin / Homo sapiens    Q9BXN1
• Beta-hexosaminidase subunit alpha / Homo sapiens    P06865
• Biglycan / Homo sapiens    P21810
• Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens    Q9NYQ6
• Cadherin-5 / Homo sapiens    P33151
• Calumenin / Homo sapiens    O43852
• Calumenin, isoform CRA_a / Homo sapiens    
• Cartilage oligomeric matrix protein / Homo sapiens    P49747
• Cathepsin F / Homo sapiens    Q9UBX1
• CD59 glycoprotein / Homo sapiens    P13987
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-1(XIV) chain / Homo sapiens    Q05707
• Decorin / Homo sapiens    P07585
• Desmoglein-2 / Homo sapiens    Q14126
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Extracellular sulfatase Sulf-1 / Homo sapiens    Q8IWU6
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Galectin-3-binding protein / Homo sapiens    Q08380
• Glycodelin-a / Homo sapiens    P09466
• HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens    P30685
• HLA class I histocompatibility antigen, B-44 alpha chain / Homo sapiens    P30481
• HLA class I histocompatibility antigen, B-53 alpha chain / Homo sapiens    P30491
• HLA class I histocompatibility antigen, B-58 alpha chain / Homo sapiens    P10319
• HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens    Q07000
• HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens    P04222
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens    P01880
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interstitial collagenase / Homo sapiens    P03956
• Keratin, type II cytoskeletal 8 / Homo sapiens    P05787
• Kininogen-1 / Homo sapiens    P01042
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrilin-4 / Homo sapiens    O95460
• Mesothelin / Homo sapiens    Q13421
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Nephronectin / Homo sapiens    Q6UXI9
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Periostin / Homo sapiens    Q15063
• Phospholipase B-like 1 / Homo sapiens    Q6P4A8
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens    O00469
• Prominin-1 / Homo sapiens    O43490
• Prosaposin / Homo sapiens    P07602
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Stanniocalcin-2 / Homo sapiens    O76061
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 / Homo sapiens    Q9NZC9
• Thrombopoietin / Homo sapiens    P40225
• Thrombospondin-1 / Homo sapiens    P07996
• Tissue-type plasminogen activator / Homo sapiens    P00750
• WAP four-disulfide core domain protein 2 / Homo sapiens    Q14508
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus    P08101
• Myelin-oligodendrocyte glycoprotein / Mus musculus    Q61885
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries    Q712V9
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries    Q712V9
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Neuroligin 1 / Rattus norvegicus    Q62765
• 32 kDa enamelin / Sus scrofa    O97939
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Immunoglobulin gamma / Gallus gallus    
• Ancrod / Calloselasma rhodostoma    P26324
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Acetabular Part of Hip Bone (UBERON_0001269)   HT-1080 (CVCL_0317)   Fibroblast (CL_0000057)  
• Amniotic Fluid (UBERON_0000173)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Enamel Organ (UBERON_0005176)  
• Kidney (UBERON_0002113)   6/9CII (CVCL_VT76)  
• Kidney (UBERON_0002113)   BHK570 (CVCL_6370)   Fibroblast (CL_0000057)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Seminal Fluid (UBERON_0006530)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Umbilical Vein (UBERON_0002066)   HUVEC-C (CVCL_2959)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• CHO (CVCL_0213)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293T (CVCL_0063)  
• Adipocytes (CL_0000136)  
• Neutrophil (CL_0000775)  
• Microsome (GO_0005792)  

Reported structure

• N-Linked / Complex / Gal(?1-?)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ NeuAc(a2-6)"
• N-Linked / Complex / Structure 1134
• N-Linked / Complex / Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-6)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc(a2-6)Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4) + NeuAc(a2-6)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[HexNAc(?1-?)HexNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-?)GlcNAc(b1-2)Man(b1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 9263
• N-Linked / Complex / Structure 9511
• N-Linked / Complex / Structure 9582
• N-Linked / Complex / Structure 9607
• N-Linked / Complex / Structure 9695
• N-Linked / Complex / Structure 9733
• N-Linked / Complex / Structure 9788
• N-Linked / Complex / Structure 9935
• N-Linked / Complex / Structure 10020
• N-Linked / Complex / Structure 10110
• N-Linked / Complex / Structure 10174
• N-Linked / Complex / Structure 10191
• N-Linked / Complex / Structure 10295
• N-Linked / Complex / Structure 10697
• N-Linked / Complex / Structure 10776
• N-Linked / Complex / Structure 10935
• N-Linked / Complex / Structure 10937
• N-Linked / Complex / Structure 10987
• N-Linked / Undefined core / NeuAc(??-?)HexNAc(??-?)HexNAc(??-?)Hex(??-?)[Hex(??-?)HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
• N-Linked / Undefined core / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc

Composition

• Hex:4 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2119.9608 )

Disease

• Cancer, breast (DOID:1612)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Fibrosarcoma (DOID:3355)
• Gastritis (DOID:4029)
• Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
• Melanoma (DOID:1909)
• Myeloma, Multiple (DOID:9538)
• Oral squamous cell carcinoma (DOID:0050866)
• Prostate cancer (DOID:10283)
• Prostate Disease (DOID:47)
• Scrapie (DOID:5434)

Reference

• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
• A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
• Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
• The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
• N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
• N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
• Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
• Carbohydrate moieties of porcine 32 kDa enamelin. (1995 - Yamakoshi Y) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Carbohydrate structure of a thrombin-like serine protease from Agkistrodon rhodostoma. Structure elucidation of oligosaccharides by methylation analysis, liquid secondary-ion mass spectrometry and proton magnetic resonance. (1992 - Pfeiffer G, Dabrowski U, Dabrowski J, Stirm S, Strube K, Geyer R) / Status : Reviewed
• A novel sialylated N-acetylgalactosamine-containing oligosaccharide is the major complex-type structure present in Bowes melanoma tissue plasminogen activator. (1991 - Chan A, Morris H, Panico M, Etienne A, Rogers M, Gaffney P, Creighton-Kempsford L, Dell A) / Status : Reviewed

Reported glycosite

• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-1424
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Asporin / Homo sapiens
  •        Asn-282
• Beta-hexosaminidase subunit alpha / Homo sapiens
  •        Asn-157
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens
  •        Asn-403
• Cadherin-5 / Homo sapiens
  •        Undefined site
• Calumenin / Homo sapiens
  •        Asn-131
• Calumenin, isoform CRA_a / Homo sapiens
  •        Asn-131
• Cartilage oligomeric matrix protein / Homo sapiens
  •        Asn-121
• Cathepsin F / Homo sapiens
  •        Asn-195
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Clusterin / Homo sapiens
  •        Asn-103
  •        Asn-374
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2679
• Collagen alpha-1(XIV) chain / Homo sapiens
  •        Asn-94
• Decorin / Homo sapiens
  •        Asn-262
• Desmoglein-2 / Homo sapiens
  •        Asn-182
• Erythropoietin / Homo sapiens
  •        Asn-65
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-354
• Extracellular sulfatase Sulf-1 / Homo sapiens
  •        Asn-623
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
• Galectin-3-binding protein / Homo sapiens
  •        Asn-551
• Glycodelin-a / Homo sapiens
  •        Asn-46
  •        Asn-81
• HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-44 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-53 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-58 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens
  •        Asn-110
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-252
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-205
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-46
  •        Asn-209
  •        Asn-272
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-207
  •        Asn-517
  •        Asn-577
• Interstitial collagenase / Homo sapiens
  •        Asn-120
• Keratin, type II cytoskeletal 8 / Homo sapiens
  •        Asn-408
• Kininogen-1 / Homo sapiens
  •        Asn-294
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-215
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
  •        Asn-252
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-58
• Matrilin-4 / Homo sapiens
  •        Asn-69
• Mesothelin / Homo sapiens
  •        Asn-496
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Nephronectin / Homo sapiens
  •        Asn-273
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
  •        Asn-248
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-212
• Periostin / Homo sapiens
  •        Asn-599
• Phospholipase B-like 1 / Homo sapiens
  •        Asn-411
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-186
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
  •        Asn-209
• Prominin-1 / Homo sapiens
  •        Asn-274
• Prosaposin / Homo sapiens
  •        Asn-215
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-286
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Stanniocalcin-2 / Homo sapiens
  •        Asn-73
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 / Homo sapiens
  •        Asn-203
• Thrombopoietin / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-248
  •        Asn-360
• Tissue-type plasminogen activator / Homo sapiens
  •        Asn-219
  •        Asn-483
• WAP four-disulfide core domain protein 2 / Homo sapiens
  •        Asn-44
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
  •        Undefined site
• Myelin-oligodendrocyte glycoprotein / Mus musculus
  •        Asn-59
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •        Asn-184
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •        Asn-184
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• 32 kDa enamelin / Sus scrofa
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Ancrod / Calloselasma rhodostoma
  •        Undefined site
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-343
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-74
  •        Asn-149
  •        Asn-331
  •        Asn-343
  •        Asn-615
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-331
  •        Asn-343
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• TGVCPELQADQNCTQECVSDSECADNLK (28aa)
  •    Q14508    Asn-44     WAP four-disulfide core domain protein 2 / Homo sapiens
• KNNSDISSTRG (11aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• FVGTPEVNQTTIYQR (15aa)
  •    P01033    Asn-53     Metalloproteinase inhibitor 1 / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• NATGMEVGWYR (11aa)
  •    Q61885    Asn-59     Myelin-oligodendrocyte glycoprotein / Mus musculus
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• AVCGGVLVHPQWVLTAAHCIRNK (23aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• GLNVGPNATR (10aa)
  •    O95460    Asn-69     Matrilin-4 / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• RIIVPLNNRENISDPTSPLRT (21aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• LSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIR (35aa)
  •    O76061    Asn-73     Stanniocalcin-2 / Homo sapiens
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• AIIQGLMPDQNYTVQIIAYNK (21aa)
  •    Q05707    Asn-94     Collagen alpha-1(XIV) chain / Homo sapiens
• AIIQGLMPDQNYTVQIIAYNKDK (23aa)
  •    Q05707    Asn-94     Collagen alpha-1(XIV) chain / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• DIVEYYNDSNGSHVIQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• YYNQSEAGSHIIQR (14aa)
  •    Q07000    Asn-110     HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens
  •    P04222    Asn-110     HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens
  •    P30491    Asn-110     HLA class I histocompatibility antigen, B-53 alpha chain / Homo sapiens
  •    P10319    Asn-110     HLA class I histocompatibility antigen, B-58 alpha chain / Homo sapiens
  •    P30481    Asn-110     HLA class I histocompatibility antigen, B-44 alpha chain / Homo sapiens
  •    P30685    Asn-110     HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens
• CGPCPAGFTGNGSHCTDVNECNAHPCFPR (29aa)
  •    P49747    Asn-121     Cartilage oligomeric matrix protein / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NVTYGTYIDDPDPDDGFNYK (20aa)
  •        Asn-131     Calumenin, isoform CRA_a / Homo sapiens
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SAEGTFFINK (10aa)
  •    P06865    Asn-157     Beta-hexosaminidase subunit alpha / Homo sapiens
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• INATDADEPNTINSK (15aa)
  •    Q14126    Asn-182     Desmoglein-2 / Homo sapiens
• YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
• QIGLYPVLVIDSSGYVNPNYTGR (23aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• NFVITYNR (8aa)
  •    Q9UBX1    Asn-195     Cathepsin F / Homo sapiens
• ASPSGQNISYIHSSSESVTPRTEGR (25aa)
  •    Q9NZC9    Asn-203     SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 / Homo sapiens
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• GLTFQQNASSM(SO)CVPDQDTAIR (25aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• RGLTFQQNASSMCVPDQDTAIRV (23aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• EAINITIDHK (10aa)
  •    O00469    Asn-209     Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GINESYKK (8aa)
  •    P50897    Asn-212     Palmitoyl-protein thioesterase 1 / Homo sapiens
• NTTGFK (6aa)
  •    Q16363    Asn-215     Laminin subunit alpha-4 / Homo sapiens
• TNSTFVQALVEHVK (14aa)
  •    P07602    Asn-215     Prosaposin / Homo sapiens
• GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
  •    P07996    Asn-248     Thrombospondin-1 / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
  •    P51884    Asn-252     Lumican / Homo sapiens
• LGLSFNSISAVDNGSLANTPH (21aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• GLSFNSISAVDNGSLANTPHLR (22aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• THTNISE (7aa)
  •    P01871    Asn-272     Immunoglobulin heavy constant mu / Homo sapiens
• GNGTILK (7aa)
  •    Q6UXI9    Asn-273     Nephronectin / Homo sapiens
• EALENMNSTLK (11aa)
  •    O43490    Asn-274     Prominin-1 / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• NVSVAEGK (8aa)
  •    Q9P2B2    Asn-286     Prostaglandin F2 receptor negative regulator / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LQVVYLHSNNITK (13aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• IAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NATRF (5aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QGNNHTCTWK (10aa)
  •    Q16610    Asn-354     Extracellular matrix protein 1 / Homo sapiens
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• VLGGAWDVFQLNESSGVVSTR (21aa)
  •    Q9NYQ6    Asn-403     Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens
• NMSIHTK (7aa)
  •    P05787    Asn-408     Keratin, type II cytoskeletal 8 / Homo sapiens
• IYNWSGYPIIVQK (13aa)
  •    Q6P4A8    Asn-411     Phospholipase B-like 1 / Homo sapiens
• GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• LAFQNMNGSEYFVK (14aa)
  •    Q13421    Asn-496     Mesothelin / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• CFILPNDSIHCER (13aa)
  •    Q8IWU6    Asn-623     Extracellular sulfatase Sulf-1 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NQTLSLFFTVLQDVPVR (17aa)
  •    P01023    Asn-1424     Alpha-2-macroglobulin / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens