Hex:4 HexNAc:5 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Calloselasma rhodostoma (Malayan pit viper)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-2-macroglobulin / Homo sapiens    P01023
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Asporin / Homo sapiens    Q9BXN1
• Beta-hexosaminidase subunit alpha / Homo sapiens    P06865
• Biglycan / Homo sapiens    P21810
• Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens    Q9NYQ6
• Cadherin-5 / Homo sapiens    P33151
• Calumenin / Homo sapiens    O43852
• Calumenin, isoform CRA_a / Homo sapiens    
• Cartilage oligomeric matrix protein / Homo sapiens    P49747
• Cathepsin F / Homo sapiens    Q9UBX1
• CD59 glycoprotein / Homo sapiens    P13987
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-1(XIV) chain / Homo sapiens    Q05707
• Decorin / Homo sapiens    P07585
• Desmoglein-2 / Homo sapiens    Q14126
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Extracellular sulfatase Sulf-1 / Homo sapiens    Q8IWU6
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Galectin-3-binding protein / Homo sapiens    Q08380
• Glycodelin-a / Homo sapiens    P09466
• HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens    P30685
• HLA class I histocompatibility antigen, B-44 alpha chain / Homo sapiens    P30481
• HLA class I histocompatibility antigen, B-53 alpha chain / Homo sapiens    P30491
• HLA class I histocompatibility antigen, B-58 alpha chain / Homo sapiens    P10319
• HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens    Q07000
• HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens    P04222
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interstitial collagenase / Homo sapiens    P03956
• Keratin, type II cytoskeletal 8 / Homo sapiens    P05787
• Kininogen-1 / Homo sapiens    P01042
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrilin-4 / Homo sapiens    O95460
• Mesothelin / Homo sapiens    Q13421
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Nephronectin / Homo sapiens    Q6UXI9
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Periostin / Homo sapiens    Q15063
• Phospholipase B-like 1 / Homo sapiens    Q6P4A8
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens    O00469
• Prominin-1 / Homo sapiens    O43490
• Prosaposin / Homo sapiens    P07602
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Stanniocalcin-2 / Homo sapiens    O76061
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 / Homo sapiens    Q9NZC9
• Thrombopoietin / Homo sapiens    P40225
• Thrombospondin-1 / Homo sapiens    P07996
• Tissue-type plasminogen activator / Homo sapiens    P00750
• WAP four-disulfide core domain protein 2 / Homo sapiens    Q14508
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus    P08101
• Myelin-oligodendrocyte glycoprotein / Mus musculus    Q61885
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries    Q712V9
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries    Q712V9
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Neuroligin 1 / Rattus norvegicus    Q62765
• 32 kDa enamelin / Sus scrofa    O97939
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Immunoglobulin gamma / Gallus gallus    
• Ancrod / Calloselasma rhodostoma    P26324
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Acetabular Part of Hip Bone (UBERON_0001269)   HT-1080 (CVCL_0317)   Fibroblast (CL_0000057)  
• Amniotic Fluid (UBERON_0000173)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Enamel Organ (UBERON_0005176)  
• Kidney (UBERON_0002113)   6/9CII (CVCL_VT76)  
• Kidney (UBERON_0002113)   BHK570 (CVCL_6370)   Fibroblast (CL_0000057)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Seminal Fluid (UBERON_0006530)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Umbilical Vein (UBERON_0002066)   HUVEC-C (CVCL_2959)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Adipocytes (CL_0000136)  
• Microsome (GO_0005792)  

Reported structure

• N-Linked / Complex / Structure 304
• N-Linked / Complex / Gal(?1-?)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ NeuAc(a2-6)"
• N-Linked / Complex / Structure 1134
• N-Linked / Complex / Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-6)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc(a2-6)Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4) + NeuAc(a2-6)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[HexNAc(?1-?)HexNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-?)GlcNAc(b1-2)Man(b1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 9263
• N-Linked / Complex / Structure 9511
• N-Linked / Complex / Structure 9582
• N-Linked / Complex / Structure 9607
• N-Linked / Complex / Structure 9695
• N-Linked / Complex / Structure 9733
• N-Linked / Complex / Structure 9788
• N-Linked / Complex / Structure 9935
• N-Linked / Complex / Structure 10020
• N-Linked / Undefined core / NeuAc(??-?)HexNAc(??-?)HexNAc(??-?)Hex(??-?)[Hex(??-?)HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
• N-Linked / Undefined core / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc

Composition

• Hex:4 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2119.9608 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Fibrosarcoma (DOID:3355)
• Melanoma (DOID:1909)
• Oral squamous cell carcinoma (DOID:0050866)
• Prostate cancer (DOID:10283)
• Scrapie (DOID:5434)

Reference

• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
• N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
• N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
• Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
• Carbohydrate moieties of porcine 32 kDa enamelin. (1995 - Yamakoshi Y) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Carbohydrate structure of a thrombin-like serine protease from Agkistrodon rhodostoma. Structure elucidation of oligosaccharides by methylation analysis, liquid secondary-ion mass spectrometry and proton magnetic resonance. (1992 - Pfeiffer G, Dabrowski U, Dabrowski J, Stirm S, Strube K, Geyer R) / Status : Reviewed
• A novel sialylated N-acetylgalactosamine-containing oligosaccharide is the major complex-type structure present in Bowes melanoma tissue plasminogen activator. (1991 - Chan A, Morris H, Panico M, Etienne A, Rogers M, Gaffney P, Creighton-Kempsford L, Dell A) / Status : Reviewed

Reported glycosite

• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-1424
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Asporin / Homo sapiens
  •        Asn-282
• Beta-hexosaminidase subunit alpha / Homo sapiens
  •        Asn-157
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens
  •        Asn-403
• Cadherin-5 / Homo sapiens
  •        Undefined site
• Calumenin / Homo sapiens
  •        Asn-131
• Calumenin, isoform CRA_a / Homo sapiens
  •        Asn-131
• Cartilage oligomeric matrix protein / Homo sapiens
  •        Asn-121
• Cathepsin F / Homo sapiens
  •        Asn-195
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Clusterin / Homo sapiens
  •        Asn-103
  •        Asn-374
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2679
• Collagen alpha-1(XIV) chain / Homo sapiens
  •        Asn-94
• Decorin / Homo sapiens
  •        Asn-262
• Desmoglein-2 / Homo sapiens
  •        Asn-182
• Erythropoietin / Homo sapiens
  •        Asn-65
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-354
• Extracellular sulfatase Sulf-1 / Homo sapiens
  •        Asn-623
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
• Galectin-3-binding protein / Homo sapiens
  •        Asn-551
• Glycodelin-a / Homo sapiens
  •        Asn-46
  •        Asn-81
• HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-44 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-53 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-58 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens
  •        Asn-110
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-205
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-209
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-207
  •        Asn-517
  •        Asn-577
• Interstitial collagenase / Homo sapiens
  •        Asn-120
• Keratin, type II cytoskeletal 8 / Homo sapiens
  •        Asn-408
• Kininogen-1 / Homo sapiens
  •        Asn-294
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-215
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
  •        Asn-252
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-58
• Matrilin-4 / Homo sapiens
  •        Asn-69
• Mesothelin / Homo sapiens
  •        Asn-496
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Nephronectin / Homo sapiens
  •        Asn-273
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
  •        Asn-248
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-212
• Periostin / Homo sapiens
  •        Asn-599
• Phospholipase B-like 1 / Homo sapiens
  •        Asn-411
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-186
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
  •        Asn-209
• Prominin-1 / Homo sapiens
  •        Asn-274
• Prosaposin / Homo sapiens
  •        Asn-215
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-286
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Stanniocalcin-2 / Homo sapiens
  •        Asn-73
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 / Homo sapiens
  •        Asn-203
• Thrombopoietin / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-248
  •        Asn-360
• Tissue-type plasminogen activator / Homo sapiens
  •        Asn-219
  •        Asn-483
• WAP four-disulfide core domain protein 2 / Homo sapiens
  •        Asn-44
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
  •        Undefined site
• Myelin-oligodendrocyte glycoprotein / Mus musculus
  •        Asn-59
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •        Asn-184
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •        Asn-184
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• 32 kDa enamelin / Sus scrofa
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Ancrod / Calloselasma rhodostoma
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-74
  •        Asn-149
  •        Asn-331
  •        Asn-343
  •        Asn-615
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-331
  •        Asn-343

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• TGVCPELQADQNCTQECVSDSECADNLK (28aa)
  •    Q14508    Asn-44     WAP four-disulfide core domain protein 2 / Homo sapiens
• KNNSDISSTRG (11aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• FVGTPEVNQTTIYQR (15aa)
  •    P01033    Asn-53     Metalloproteinase inhibitor 1 / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• NATGMEVGWYR (11aa)
  •    Q61885    Asn-59     Myelin-oligodendrocyte glycoprotein / Mus musculus
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• GLNVGPNATR (10aa)
  •    O95460    Asn-69     Matrilin-4 / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• RIIVPLNNRENISDPTSPLRT (21aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• LSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIR (35aa)
  •    O76061    Asn-73     Stanniocalcin-2 / Homo sapiens
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• AIIQGLMPDQNYTVQIIAYNK (21aa)
  •    Q05707    Asn-94     Collagen alpha-1(XIV) chain / Homo sapiens
• AIIQGLMPDQNYTVQIIAYNKDK (23aa)
  •    Q05707    Asn-94     Collagen alpha-1(XIV) chain / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• DIVEYYNDSNGSHVIQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• YYNQSEAGSHIIQR (14aa)
  •    Q07000    Asn-110     HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens
  •    P04222    Asn-110     HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens
  •    P30491    Asn-110     HLA class I histocompatibility antigen, B-53 alpha chain / Homo sapiens
  •    P10319    Asn-110     HLA class I histocompatibility antigen, B-58 alpha chain / Homo sapiens
  •    P30481    Asn-110     HLA class I histocompatibility antigen, B-44 alpha chain / Homo sapiens
  •    P30685    Asn-110     HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens
• CGPCPAGFTGNGSHCTDVNECNAHPCFPR (29aa)
  •    P49747    Asn-121     Cartilage oligomeric matrix protein / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NVTYGTYIDDPDPDDGFNYK (20aa)
  •        Asn-131     Calumenin, isoform CRA_a / Homo sapiens
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SAEGTFFINK (10aa)
  •    P06865    Asn-157     Beta-hexosaminidase subunit alpha / Homo sapiens
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• INATDADEPNTINSK (15aa)
  •    Q14126    Asn-182     Desmoglein-2 / Homo sapiens
• YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
• QIGLYPVLVIDSSGYVNPNYTGR (23aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• NFVITYNR (8aa)
  •    Q9UBX1    Asn-195     Cathepsin F / Homo sapiens
• ASPSGQNISYIHSSSESVTPRTEGR (25aa)
  •    Q9NZC9    Asn-203     SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 / Homo sapiens
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• RGLTFQQNASSMCVPDQDTAIRV (23aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• EAINITIDHK (10aa)
  •    O00469    Asn-209     Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GINESYKK (8aa)
  •    P50897    Asn-212     Palmitoyl-protein thioesterase 1 / Homo sapiens
• NTTGFK (6aa)
  •    Q16363    Asn-215     Laminin subunit alpha-4 / Homo sapiens
• TNSTFVQALVEHVK (14aa)
  •    P07602    Asn-215     Prosaposin / Homo sapiens
• GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
  •    P07996    Asn-248     Thrombospondin-1 / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
  •    P51884    Asn-252     Lumican / Homo sapiens
• LGLSFNSISAVDNGSLANTPH (21aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• GLSFNSISAVDNGSLANTPHLR (22aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• GNGTILK (7aa)
  •    Q6UXI9    Asn-273     Nephronectin / Homo sapiens
• EALENMNSTLK (11aa)
  •    O43490    Asn-274     Prominin-1 / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• NVSVAEGK (8aa)
  •    Q9P2B2    Asn-286     Prostaglandin F2 receptor negative regulator / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LQVVYLHSNNITK (13aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• IAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NATRF (5aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QGNNHTCTWK (10aa)
  •    Q16610    Asn-354     Extracellular matrix protein 1 / Homo sapiens
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• VLGGAWDVFQLNESSGVVSTR (21aa)
  •    Q9NYQ6    Asn-403     Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens
• NMSIHTK (7aa)
  •    P05787    Asn-408     Keratin, type II cytoskeletal 8 / Homo sapiens
• IYNWSGYPIIVQK (13aa)
  •    Q6P4A8    Asn-411     Phospholipase B-like 1 / Homo sapiens
• GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• LAFQNMNGSEYFVK (14aa)
  •    Q13421    Asn-496     Mesothelin / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• CFILPNDSIHCER (13aa)
  •    Q8IWU6    Asn-623     Extracellular sulfatase Sulf-1 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NQTLSLFFTVLQDVPVR (17aa)
  •    P01023    Asn-1424     Alpha-2-macroglobulin / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens