Hex:8 HexNAc:7 dHex:1

Taxonomy

• Homo sapiens (Human)
• Desmodus rotundus (Common vampire bat)
• Mesocricetus auratus (Golden hamster)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alkaline phosphatase, intestinal / Homo sapiens    P09923
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-S1-casein / Homo sapiens    P47710
• Carnitine O-acetyltransferase / Homo sapiens    P43155
• Cation-dependent mannose-6-phosphate receptor / Homo sapiens    P20645
• CD166 antigen / Homo sapiens    Q13740
• CD59 glycoprotein / Homo sapiens    P13987
• CD97 antigen / Homo sapiens    P48960
• Clusterin / Homo sapiens    P10909
• Complement c3 / Homo sapiens    P01024
• Complement c4-a / Homo sapiens    P0C0L4
• Complement C4-B / Homo sapiens    P0C0L5
• Desmoglein-2 / Homo sapiens    Q14126
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Erythropoietin / Homo sapiens    P01588
• Fibromodulin / Homo sapiens    Q06828
• Haptoglobin / Homo sapiens    P00738
• Inositol monophosphatase 3 / Homo sapiens    Q9NX62
• Integrin beta-1 / Homo sapiens    P05556
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens    P32942
• L-selectin / Homo sapiens    P14151
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• N-acetylglucosamine-6-sulfatase / Homo sapiens    P15586
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Secretogranin-3 / Homo sapiens    Q8WXD2
• T-cell surface antigen cd2 / Homo sapiens    P06729
• Tissue factor pathway inhibitor / Homo sapiens    P10646
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus    
• Uncharacterized protein from Undefined tissue / Rattus norvegicus    
• Uncharacterized protein from Undefined tissue / Rattus norvegicus    
• Uncharacterized protein from Undefined tissue / Rattus norvegicus    
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa    
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amnion (UBERON_0000305)   FL (CVCL_1905)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   BHK21/13/Py6 (CVCL_LM74)   Plasma Membrane (GO_0005886)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Seminal Fluid (UBERON_0006530)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Zona Pellucida (UBERON_0000086)  
• 3Y1-B clone 1 (CVCL_4563)  
• HEK293 (CVCL_0045)  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  
• Leukocyte (CL_0000738)  
• T-Lymphocyte (CL_0000084)  

Reported structure

• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + Gal(b1-4)GlcNAc(?1-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-3)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a2-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 9465

Composition

• Hex:8 HexNAc:7 dHex:1 (avg mass : 2883.6625 )

Disease

• Anemia, Aplastic (DOID:12449)
• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Prostate cancer (DOID:10283)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50). (2001 - Funatsu O, Sato T, Kotovuori P, Gahmberg CG, Ikekita M, Furukawa K) / Status : Reviewed
• Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
• Amino acid sequence and carbohydrate structure of a recombinant human tissue factor pathway inhibitor expressed in Chinese hamster ovary cells: one N-and two O-linked carbohydrate chains are located between Kunitz domains 2 and 3 and one N-linked carbohydrate chain is in Kunitz domain 2. (1996 - Nakahara Y, Miyata T, Hamuro T, Funatsu A, Miyagi M, Tsunasawa S, Kato H) / Status : Reviewed
• Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
• Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
• Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
• Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
• The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed

Reported glycosite

• Alkaline phosphatase, intestinal / Homo sapiens
  •        Undefined site
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Carnitine O-acetyltransferase / Homo sapiens
  •        Asn-238
• Cation-dependent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-83
• CD166 antigen / Homo sapiens
  •        Asn-306
  •        Asn-361
• CD59 glycoprotein / Homo sapiens
  •        Undefined site
• CD97 antigen / Homo sapiens
  •        Asn-453
• Clusterin / Homo sapiens
  •        Asn-374
• Complement c3 / Homo sapiens
  •        Asn-939
• Complement c4-a / Homo sapiens
  •        Asn-226
• Complement C4-B / Homo sapiens
  •        Asn-226
• Desmoglein-2 / Homo sapiens
  •        Asn-462
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-294
  •        Asn-378
• Erythropoietin / Homo sapiens
  •        Undefined site
• Fibromodulin / Homo sapiens
  •        Asn-166
• Haptoglobin / Homo sapiens
  •        Asn-241
• Inositol monophosphatase 3 / Homo sapiens
  •        Asn-259
• Integrin beta-1 / Homo sapiens
  •        Asn-669
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens
  •        Undefined site
• L-selectin / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Asn-156
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-2707
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-249
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-356
• N-acetylglucosamine-6-sulfatase / Homo sapiens
  •        Asn-387
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-286
  •        Asn-413
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Secretogranin-3 / Homo sapiens
  •        Asn-346
• T-cell surface antigen cd2 / Homo sapiens
  •        Undefined site
• Tissue factor pathway inhibitor / Homo sapiens
  •        Undefined site
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-657

Mass spectrometry observed peptide

• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69
• EAGNHTSGAGIVQINK (16aa)
  •    P20645    Asn-83
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156
• RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
  •    P02788    Asn-156
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166
• RFSDGLESNSSTQFEVKK (18aa)
  •    P0C0L4    Asn-226
  •    P0C0L5    Asn-226
• NSSLQTNK (8aa)
  •    P43155    Asn-238
• KVVLHPNYSQVDIGLIKL (18aa)
  •    P00738    Asn-241
• FGNQTTIIPAGGAGYK (16aa)
  •    Q9NX62    Asn-259
• IININPNK (8aa)
  •    P11279    Asn-261
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• NVSVAEGK (8aa)
  •    Q9P2B2    Asn-286
• GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
  •    Q9Y5L3    Asn-294
• NATGDYK (7aa)
  •    Q13740    Asn-306
• MFSQNDTR (8aa)
  •    P02750    Asn-325
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• NATDNISK (8aa)
  •    Q8WXD2    Asn-346
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• NATVVWMK (8aa)
  •    Q13740    Asn-361
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374
• TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
  •    Q9Y5L3    Asn-378
• IAGYDLNK (8aa)
  •    P15586    Asn-387
• VAEAVSSPAGVGVTWIEPDYQVYINASK (28aa)
  •    Q9P2B2    Asn-413
• SIFLSHNNTK (10aa)
  •    P48960    Asn-453
• YVQNGTYTVK (10aa)
  •    Q14126    Asn-462
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• DTCTQECSYFNITK (14aa)
  •    P05556    Asn-669
• VVPEGIRMNK (10aa)
  •    P01024    Asn-939
• NASLALSASIGR (12aa)
  •    O15230    Asn-2707