GlyConnect

taxonomy (5) protein (39) source (16) structure (17) composition (1) disease (3) reference (20) site (44) peptide (24)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:8 HexNAc:7 dHex:1 (avg mass : 2883.6625 )

Disease

Reference

Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50). (2001 - Funatsu O, Sato T, Kotovuori P, Gahmberg CG, Ikekita M, Furukawa K) / Status : Reviewed
Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
Amino acid sequence and carbohydrate structure of a recombinant human tissue factor pathway inhibitor expressed in Chinese hamster ovary cells: one N-and two O-linked carbohydrate chains are located between Kunitz domains 2 and 3 and one N-linked carbohydrate chain is in Kunitz domain 2. (1996 - Nakahara Y, Miyata T, Hamuro T, Funatsu A, Miyagi M, Tsunasawa S, Kato H) / Status : Reviewed
Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed

Reported glycosite

Alkaline phosphatase, intestinal / Homo sapiens
- Undefined site
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
Carnitine O-acetyltransferase / Homo sapiens
- Asn-238
Cation-dependent mannose-6-phosphate receptor / Homo sapiens
- Asn-83
CD166 antigen / Homo sapiens
- Asn-306
- Asn-361
CD59 glycoprotein / Homo sapiens
- Undefined site
CD97 antigen / Homo sapiens
- Asn-453
Clusterin / Homo sapiens
- Asn-374
Complement c3 / Homo sapiens
- Asn-939
Desmoglein-2 / Homo sapiens
- Asn-462
Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Asn-294
- Asn-378
Erythropoietin / Homo sapiens
- Undefined site
Fibromodulin / Homo sapiens
- Asn-166
Inositol monophosphatase 3 / Homo sapiens
- Asn-259
Integrin beta-1 / Homo sapiens
- Asn-669
Intercellular adhesion molecule-3 (CD50) / Homo sapiens
- Undefined site
L-selectin / Homo sapiens
- Undefined site
Laminin subunit alpha-5 / Homo sapiens
- Asn-2707
Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Asn-325
Lumican / Homo sapiens
- Asn-88
- Asn-127
Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Asn-249
- Asn-261
Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Asn-356
N-acetylglucosamine-6-sulfatase / Homo sapiens
- Asn-387
Prostaglandin F2 receptor negative regulator / Homo sapiens
- Asn-286
- Asn-413
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
Secretogranin-3 / Homo sapiens
- Asn-346
T-cell surface antigen cd2 / Homo sapiens
- Undefined site
Tissue factor pathway inhibitor / Homo sapiens
- Undefined site
Von willebrand factor / Homo sapiens
- Undefined site
Zinc-alpha-2-glycoprotein / Homo sapiens
- Asn-128
Salivary plasminogen activator alpha 1 / Desmodus rotundus
- Asn-398
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus
- Undefined site
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
Major seminal plasma glycoprotein psp-i / Sus scrofa
- Asn-71
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Asn-119
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site

Mass spectrometry observed peptide

EAGNHTSGAGIVQINK (16aa)
- P20645 Asn-83
AFENVTDLQWLILDHNLLENSK (22aa)
- P51884 Asn-88
LHINHNNLTESVGPLPK (17aa)
- P51884 Asn-127
FGCEIENNR (9aa)
- P25311 Asn-128
IYIDHNNITR (10aa)
- Q06828 Asn-166
NSSLQTNK (8aa)
- P43155 Asn-238
FGNQTTIIPAGGAGYK (16aa)
- Q9NX62 Asn-259
IININPNK (8aa)
- P11279 Asn-261
NVSVAEGK (8aa)
- Q9P2B2 Asn-286
GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- Q9Y5L3 Asn-294
NATGDYK (7aa)
- Q13740 Asn-306
MFSQNDTR (8aa)
- P02750 Asn-325
NATDNISK (8aa)
- Q8WXD2 Asn-346
VQPFNVTQGK (10aa)
- P13473 Asn-356
NATVVWMK (8aa)
- Q13740 Asn-361
LANLTQGEDQYYLR (14aa)
- P10909 Asn-374
TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- Q9Y5L3 Asn-378
IAGYDLNK (8aa)
- P15586 Asn-387
VAEAVSSPAGVGVTWIEPDYQVYINASK (28aa)
- Q9P2B2 Asn-413
SIFLSHNNTK (10aa)
- P48960 Asn-453
YVQNGTYTVK (10aa)
- Q14126 Asn-462
DTCTQECSYFNITK (14aa)
- P05556 Asn-669
VVPEGIRMNK (10aa)
- P01024 Asn-939
NASLALSASIGR (12aa)
- O15230 Asn-2707

- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)
- N-Linked / Complex (avg mass : 2883.6625)

- Hex:8 HexNAc:7 dHex:1 / N-Linked (avg mass : 2883.6625)