taxonomy (6)
protein (46)
source (19)
structure (19)
composition (1)
disease (4)
reference (23)
site (52)
peptide (32)
- Homo sapiens (Human)
- Desmodus rotundus (Common vampire bat)
- Mesocricetus auratus (Golden hamster)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alkaline phosphatase, intestinal / Homo sapiens P09923
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-S1-casein / Homo sapiens P47710
- Carnitine O-acetyltransferase / Homo sapiens P43155
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens P20645
- CD166 antigen / Homo sapiens Q13740
- CD59 glycoprotein / Homo sapiens P13987
- CD97 antigen / Homo sapiens P48960
- Clusterin / Homo sapiens P10909
- Complement c3 / Homo sapiens P01024
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- Desmoglein-2 / Homo sapiens Q14126
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Erythropoietin / Homo sapiens P01588
- Fibromodulin / Homo sapiens Q06828
- Haptoglobin / Homo sapiens P00738
- Inositol monophosphatase 3 / Homo sapiens Q9NX62
- Integrin beta-1 / Homo sapiens P05556
- Intercellular adhesion molecule-3 (CD50) / Homo sapiens P32942
- L-selectin / Homo sapiens P14151
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-5 / Homo sapiens O15230
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Lumican / Homo sapiens P51884
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- Prostaglandin F2 receptor negative regulator / Homo sapiens Q9P2B2
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Secretogranin-3 / Homo sapiens Q8WXD2
- T-cell surface antigen cd2 / Homo sapiens P06729
- Tissue factor pathway inhibitor / Homo sapiens P10646
- Von willebrand factor / Homo sapiens P04275
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amnion (UBERON_0000305) FL (CVCL_1905)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Zona Pellucida (UBERON_0000086)
- 3Y1-B clone 1 (CVCL_4563)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Leukocyte (CL_0000738)
- T-Lymphocyte (CL_0000084)
Source
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + Gal(b1-4)GlcNAc(?1-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-3)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a2-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9465
- N-Linked / Complex / Structure 9998
Reported structure
- Hex:8 HexNAc:7 dHex:1 (avg mass : 2883.6625 )
Composition
- Anemia, Aplastic (DOID:12449)
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
Disease
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50). (2001 - Funatsu O, Sato T, Kotovuori P, Gahmberg CG, Ikekita M, Furukawa K) / Status : Reviewed
- Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
- Amino acid sequence and carbohydrate structure of a recombinant human tissue factor pathway inhibitor expressed in Chinese hamster ovary cells: one N-and two O-linked carbohydrate chains are located between Kunitz domains 2 and 3 and one N-linked carbohydrate chain is in Kunitz domain 2. (1996 - Nakahara Y, Miyata T, Hamuro T, Funatsu A, Miyagi M, Tsunasawa S, Kato H) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
- Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
- The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed
Reference
-
Alkaline phosphatase, intestinal / Homo sapiens
- Undefined site
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
- Alpha-S1-casein / Homo sapiens
- Carnitine O-acetyltransferase / Homo sapiens
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens
- CD166 antigen / Homo sapiens
-
CD59 glycoprotein / Homo sapiens
- Undefined site
- CD97 antigen / Homo sapiens
- Clusterin / Homo sapiens
- Complement c3 / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
- Fibromodulin / Homo sapiens
- Haptoglobin / Homo sapiens
- Inositol monophosphatase 3 / Homo sapiens
- Integrin beta-1 / Homo sapiens
-
Intercellular adhesion molecule-3 (CD50) / Homo sapiens
- Undefined site
-
L-selectin / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Prostaglandin F2 receptor negative regulator / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Secretogranin-3 / Homo sapiens
-
T-cell surface antigen cd2 / Homo sapiens
- Undefined site
-
Tissue factor pathway inhibitor / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- KDTRNESTQNCVVAEPEKM (19aa)
- EAGNHTSGAGIVQINK (16aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- VYSSANNCTFE (11aa)
- IYIDHNNITR (10aa)
- RFSDGLESNSSTQFEVKK (18aa)
- NSSLQTNK (8aa)
- KVVLHPNYSQVDIGLIKL (18aa)
- FGNQTTIIPAGGAGYK (16aa)
- IININPNK (8aa)
- NVSVAEGK (8aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- NATGDYK (7aa)
- MFSQNDTR (8aa)
- FPNIT (5aa)
- GEVFNATR (8aa)
- NATDNISK (8aa)
- VQPFNVTQGK (10aa)
- NATVVWMK (8aa)
- LANLTQGEDQYYLR (14aa)
- TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- IAGYDLNK (8aa)
- VAEAVSSPAGVGVTWIEPDYQVYINASK (28aa)
- SIFLSHNNTK (10aa)
- YVQNGTYTVK (10aa)
- DTCTQECSYFNITK (14aa)
- VVPEGIRMNK (10aa)
- NASLALSASIGR (12aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Blood Plasma (UBERON_0001969)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Urine (UBERON_0001088)
- Zona Pellucida (UBERON_0000086)
- 3Y1-B clone 1 (CVCL_4563)
- Anemia, Aplastic (DOID:12449)
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
- Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
-
Erythropoietin / Homo sapiens
- Undefined site
-
T-cell surface antigen cd2 / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Zona Pellucida (UBERON_0000086)
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- T-Lymphocyte (CL_0000084)
-
Intercellular adhesion molecule-3 (CD50) / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Leukocyte (CL_0000738)
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- T-Lymphocyte (CL_0000084)
-
Intercellular adhesion molecule-3 (CD50) / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Blood Plasma (UBERON_0001969)
-
Von willebrand factor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Zona Pellucida (UBERON_0000086)
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Amnion (UBERON_0000305) FL (CVCL_1905)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
- Amino acid sequence and carbohydrate structure of a recombinant human tissue factor pathway inhibitor expressed in Chinese hamster ovary cells: one N-and two O-linked carbohydrate chains are located between Kunitz domains 2 and 3 and one N-linked carbohydrate chain is in Kunitz domain 2. (1996 - Nakahara Y, Miyata T, Hamuro T, Funatsu A, Miyagi M, Tsunasawa S, Kato H) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
-
Alkaline phosphatase, intestinal / Homo sapiens
- Undefined site
-
Erythropoietin / Homo sapiens
- Undefined site
-
Tissue factor pathway inhibitor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
CD59 glycoprotein / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Amnion (UBERON_0000305) FL (CVCL_1905)
-
Alkaline phosphatase, intestinal / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
-
L-selectin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2883.6625)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Haptoglobin / Homo sapiens
- Lactotransferrin / Homo sapiens
- KDTRNESTQNCVVAEPEKM (19aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- RFSDGLESNSSTQFEVKK (18aa)
- KVVLHPNYSQVDIGLIKL (18aa)
-
- N-Linked / Complex
(avg mass : 2883.6625)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VYSSANNCTFE (11aa)
- FPNIT (5aa)
- GEVFNATR (8aa)
-
- Hex:8 HexNAc:7 dHex:1 / N-Linked
(avg mass : 2883.6625)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + Gal(b1-4)GlcNAc(?1-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-3)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a2-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9465
- N-Linked / Complex / Structure 9998
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Carnitine O-acetyltransferase / Homo sapiens
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens
- CD166 antigen / Homo sapiens
- CD97 antigen / Homo sapiens
- Clusterin / Homo sapiens
- Complement c3 / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Fibromodulin / Homo sapiens
- Inositol monophosphatase 3 / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Prostaglandin F2 receptor negative regulator / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- EAGNHTSGAGIVQINK (16aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- IYIDHNNITR (10aa)
- NSSLQTNK (8aa)
- FGNQTTIIPAGGAGYK (16aa)
- IININPNK (8aa)
- NVSVAEGK (8aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- NATGDYK (7aa)
- MFSQNDTR (8aa)
- NATDNISK (8aa)
- VQPFNVTQGK (10aa)
- NATVVWMK (8aa)
- LANLTQGEDQYYLR (14aa)
- TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- IAGYDLNK (8aa)
- VAEAVSSPAGVGVTWIEPDYQVYINASK (28aa)
- SIFLSHNNTK (10aa)
- YVQNGTYTVK (10aa)
- DTCTQECSYFNITK (14aa)
- VVPEGIRMNK (10aa)
- NASLALSASIGR (12aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:8 HexNAc:7 dHex:1 / N-Linked
(avg mass : 2883.6625)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2883.6625)