taxonomy (3)
protein (39)
source (9)
structure (3)
composition (1)
disease (3)
reference (10)
site (44)
peptide (29)
- Homo sapiens (Human)
- Torpedo californica (Pacific electric ray)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Arylsulfatase D / Homo sapiens P51689
- Clusterin / Homo sapiens P10909
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- GDNF family receptor alpha-1 / Homo sapiens P56159
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens P30464
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens P30466
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens P30475
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens P30484
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens Q29836
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens Q29718
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens P30508
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens Q95604
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens P30501
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens Q9TNN7
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens P30505
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Integrin alpha-1 / Homo sapiens P56199
- Myelin protein P0 / Homo sapiens P25189
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Phospholipid transfer protein / Homo sapiens P55058
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Pregnancy zone protein / Homo sapiens P20742
- Prolactin-inducible protein / Homo sapiens P12273
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Thrombospondin-1 / Homo sapiens P07996
- Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens Q9Y274
- Uromodulin / Homo sapiens P07911
- WAP four-disulfide core domain protein 2 / Homo sapiens Q14508
- Acetylcholine receptor protein / Torpedo californica P02712 P02718 P02710 P02714
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Serum (UBERON_0001977)
- Electric Organ (UBERON_0006869)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
- N-Linked / Complex / Structure 9537
- N-Linked / Complex / Structure 9759
Reported structure
- Hex:4 HexNAc:6 NeuAc:1 (avg mass : 2177.0128 )
Composition
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
Reference
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Arylsulfatase D / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- GDNF family receptor alpha-1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Integrin alpha-1 / Homo sapiens
- Myelin protein P0 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Phospholipid transfer protein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pregnancy zone protein / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
- Uromodulin / Homo sapiens
- WAP four-disulfide core domain protein 2 / Homo sapiens
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- WFSAGLASNSSWLREK (16aa)
- DVNCSVMGPQEK (12aa)
- ETNFSIASGIEAK (13aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- GYYNQSEAGSHTIQR (15aa)
- Q95604 Asn-110     HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- P30464 Asn-110     HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- P30484 Asn-110     HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- Q29836 Asn-110     HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- P30466 Asn-110     HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- P30505 Asn-110     HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- P30475 Asn-110     HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- Q9TNN7 Asn-110     HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- P30508 Asn-110     HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- P30501 Asn-110     HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- Q29718 Asn-110     HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- DGSIVIHNLDYSDNGTFTCDVK (22aa)
- TQSLLIVNNATNVVIK (16aa)
- KQIGLYPVLVIDSSGYVNPNYTGRIRL (27aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
- FHLANR (6aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- NVTAEQLFLK (10aa)
- GNISTEK (7aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- IEDNGLKNST (10aa)
- IANITQGEDQYYIR (14aa)
- VPGNVTAVIGETIK (14aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- IYVLNYLNETQQLTQEIK (18aa)
- NGTHWFV (7aa)
- EAGNITTDGYEIIGK (15aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2177.0128)
- Electric Organ (UBERON_0006869)
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 2177.0128)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- KQIGLYPVLVIDSSGYVNPNYTGRIRL (27aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
-
- N-Linked / Complex
(avg mass : 2177.0128)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
-
- Hex:4 HexNAc:6 NeuAc:1 / N-Linked
(avg mass : 2177.0128)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
- N-Linked / Complex / Structure 9537
- N-Linked / Complex / Structure 9759
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Arylsulfatase D / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- GDNF family receptor alpha-1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Integrin alpha-1 / Homo sapiens
- Myelin protein P0 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Phospholipid transfer protein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pregnancy zone protein / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
- Uromodulin / Homo sapiens
- WAP four-disulfide core domain protein 2 / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- WFSAGLASNSSWLREK (16aa)
- DVNCSVMGPQEK (12aa)
- ETNFSIASGIEAK (13aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- GYYNQSEAGSHTIQR (15aa)
- Q95604 Asn-110     HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- P30464 Asn-110     HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- P30484 Asn-110     HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- Q29836 Asn-110     HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- P30466 Asn-110     HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- P30505 Asn-110     HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- P30475 Asn-110     HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- Q9TNN7 Asn-110     HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- P30508 Asn-110     HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- P30501 Asn-110     HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- Q29718 Asn-110     HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- DGSIVIHNLDYSDNGTFTCDVK (22aa)
- FHLANR (6aa)
- GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- NVTAEQLFLK (10aa)
- GNISTEK (7aa)
- IEDNGLKNST (10aa)
- IANITQGEDQYYIR (14aa)
- VPGNVTAVIGETIK (14aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- IYVLNYLNETQQLTQEIK (18aa)
- NGTHWFV (7aa)
- EAGNITTDGYEIIGK (15aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:6 NeuAc:1 / N-Linked
(avg mass : 2177.0128)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2177.0128)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2177.0128)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2177.0128)