taxonomy (4)
protein (40)
source (12)
structure (6)
composition (1)
disease (4)
reference (13)
site (45)
peptide (29)
- Homo sapiens (Human)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Arylsulfatase D / Homo sapiens P51689
- Clusterin / Homo sapiens P10909
- Coagulation factor V / Homo sapiens P12259
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- GDNF family receptor alpha-1 / Homo sapiens P56159
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens P30464
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens P30466
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens P30475
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens P30484
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens Q29836
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens Q29718
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens P30508
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens Q95604
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens P30501
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens Q9TNN7
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens P30505
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Integrin alpha-1 / Homo sapiens P56199
- Myelin protein P0 / Homo sapiens P25189
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Phospholipid transfer protein / Homo sapiens P55058
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Pregnancy zone protein / Homo sapiens P20742
- Prolactin-inducible protein / Homo sapiens P12273
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Thrombospondin-1 / Homo sapiens P07996
- Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens Q9Y274
- Uromodulin / Homo sapiens P07911
- WAP four-disulfide core domain protein 2 / Homo sapiens Q14508
- Acetylcholine receptor protein / Torpedo californica P02710 P02714 P02718 P02712
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Electric Organ (UBERON_0006869)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Prefrontal Cortex (UBERON:0000451)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- Egg Cell Egg White
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
- N-Linked / Complex / Structure 9537
- N-Linked / Complex / Structure 9759
- N-Linked / Complex / Structure 11164
- N-Linked / Complex / Structure 11177
- N-Linked / Complex / Structure 11881
Reported structure
- Hex:4 HexNAc:6 NeuAc:1 (avg mass : 2177.0128 )
Composition
- Cancer, breast (DOID:1612)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
Reference
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Arylsulfatase D / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- GDNF family receptor alpha-1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Integrin alpha-1 / Homo sapiens
- Myelin protein P0 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Phospholipid transfer protein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pregnancy zone protein / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
- Uromodulin / Homo sapiens
- WAP four-disulfide core domain protein 2 / Homo sapiens
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- WFSAGLASNSSWLREK (16aa)
- DVNCSVMGPQEK (12aa)
- ETNFSIASGIEAK (13aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- GYYNQSEAGSHTIQR (15aa)
- P30505 Asn-110     HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- Q95604 Asn-110     HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- P30464 Asn-110     HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- P30484 Asn-110     HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- Q9TNN7 Asn-110     HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- P30508 Asn-110     HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- P30466 Asn-110     HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- Q29836 Asn-110     HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- P30501 Asn-110     HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- P30475 Asn-110     HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- Q29718 Asn-110     HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- DGSIVIHNLDYSDNGTFTCDVK (22aa)
- TQSLLIVNNATNVVIK (16aa)
- KQIGLYPVLVIDSSGYVNPNYTGRIRL (27aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
- FHLANR (6aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- NVTAEQLFLK (10aa)
- GNISTEK (7aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- IEDNGLKNST (10aa)
- IANITQGEDQYYIR (14aa)
- VPGNVTAVIGETIK (14aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- IYVLNYLNETQQLTQEIK (18aa)
- NGTHWFV (7aa)
- EAGNITTDGYEIIGK (15aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2177.0128)
- Electric Organ (UBERON_0006869)
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 2177.0128)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- KQIGLYPVLVIDSSGYVNPNYTGRIRL (27aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
-
- N-Linked / Complex
(avg mass : 2177.0128)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
-
- N-Linked / Complex
(avg mass : 2177.0128)
- Control/Healthy
-
- N-Linked / Complex
(avg mass : 2177.0128)
- Blood Plasma (UBERON_0001969)
- Coagulation factor V / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2177.0128)
-
- Hex:4 HexNAc:6 NeuAc:1 / N-Linked
(avg mass : 2177.0128)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
- N-Linked / Complex / Structure 9537
- N-Linked / Complex / Structure 9759
- N-Linked / Complex / Structure 11164
- N-Linked / Complex / Structure 11177
- N-Linked / Complex / Structure 11881
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Arylsulfatase D / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- GDNF family receptor alpha-1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Integrin alpha-1 / Homo sapiens
- Myelin protein P0 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Phospholipid transfer protein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pregnancy zone protein / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
- Uromodulin / Homo sapiens
- WAP four-disulfide core domain protein 2 / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- WFSAGLASNSSWLREK (16aa)
- DVNCSVMGPQEK (12aa)
- ETNFSIASGIEAK (13aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- GYYNQSEAGSHTIQR (15aa)
- P30505 Asn-110     HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- Q95604 Asn-110     HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- P30464 Asn-110     HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- P30484 Asn-110     HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- Q9TNN7 Asn-110     HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- P30508 Asn-110     HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- P30466 Asn-110     HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- Q29836 Asn-110     HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- P30501 Asn-110     HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- P30475 Asn-110     HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- Q29718 Asn-110     HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- DGSIVIHNLDYSDNGTFTCDVK (22aa)
- FHLANR (6aa)
- GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- NVTAEQLFLK (10aa)
- GNISTEK (7aa)
- IEDNGLKNST (10aa)
- IANITQGEDQYYIR (14aa)
- VPGNVTAVIGETIK (14aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- IYVLNYLNETQQLTQEIK (18aa)
- NGTHWFV (7aa)
- EAGNITTDGYEIIGK (15aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:6 NeuAc:1 / N-Linked
(avg mass : 2177.0128)
Reported glycosite
- N-Linked / Complex
(avg mass : 2177.0128)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2177.0128)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2177.0128)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2177.0128)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2177.0128)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2177.0128)