Hex:4 HexNAc:6 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Torpedo californica (Pacific electric ray)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Arylsulfatase D / Homo sapiens    P51689
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• GDNF family receptor alpha-1 / Homo sapiens    P56159
• Golgi membrane protein 1 / Homo sapiens    Q8NBJ4
• HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens    P30464
• HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens    P30466
• HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens    P30475
• HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens    P30484
• HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens    Q29836
• HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens    Q29718
• HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens    P30508
• HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens    Q95604
• HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens    P30501
• HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens    Q9TNN7
• HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens    P30505
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin j chain / Homo sapiens    P01591
• Integrin alpha-1 / Homo sapiens    P56199
• Myelin protein P0 / Homo sapiens    P25189
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Phospholipid transfer protein / Homo sapiens    P55058
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Pregnancy zone protein / Homo sapiens    P20742
• Prolactin-inducible protein / Homo sapiens    P12273
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Thrombospondin-1 / Homo sapiens    P07996
• Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens    Q9Y274
• Uromodulin / Homo sapiens    P07911
• WAP four-disulfide core domain protein 2 / Homo sapiens    Q14508
• Acetylcholine receptor protein / Torpedo californica    P02712    P02714    P02718    P02710
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Serum (UBERON_0001977)  
• Electric Organ (UBERON_0006869)  
• Mammary Gland (UBERON_0001911)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
• N-Linked / Complex / Structure 1594
• N-Linked / Undefined core / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc + " + Hex + 4x HexNAc + NeuAc "

Composition

• Hex:4 HexNAc:6 NeuAc:1 (avg mass : 2177.0128 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Prostate cancer (DOID:10283)

Reference

• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed

Reported glycosite

• Arylsulfatase D / Homo sapiens
  •        Asn-347
• Clusterin / Homo sapiens
  •        Asn-374
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2679
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-53
  •        Asn-276
• GDNF family receptor alpha-1 / Homo sapiens
  •        Asn-59
• Golgi membrane protein 1 / Homo sapiens
  •        Asn-109
• HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
  •        Asn-110
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin j chain / Homo sapiens
  •        Asn-71
• Integrin alpha-1 / Homo sapiens
  •        Asn-317
• Myelin protein P0 / Homo sapiens
  •        Asn-122
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-248
• Phospholipid transfer protein / Homo sapiens
  •        Asn-117
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-469
• Pregnancy zone protein / Homo sapiens
  •        Asn-997
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
  •        Asn-53
  •        Asn-322
• Thrombospondin-1 / Homo sapiens
  •        Asn-248
• Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
  •        Asn-308
• Uromodulin / Homo sapiens
  •        Asn-513
• WAP four-disulfide core domain protein 2 / Homo sapiens
  •        Asn-44
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-74
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-657

Mass spectrometry observed peptide

• TGVCPELQADQNCTQECVSDSECADNLK (28aa)
  •    Q14508    Asn-44
• WFSAGLASNSSWLREK (16aa)
  •    P41222    Asn-51
• NYNTNITEENVQNMNNAGDK (20aa)
  •    Q9BYF1    Asn-53
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53
• NTNITEENVQNMNNAGDK (18aa)
  •    Q9BYF1    Asn-53
• ETNFSIASGIEAK (13aa)
  •    P56159    Asn-59
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105
• AVIVNNITTGER (12aa)
  •    Q8NBJ4    Asn-109
• GYYNQSEAGSHTIQR (15aa)
  •    Q29836    Asn-110
• GYYNQSEAGSHTIQR (15aa)
  •    P30484    Asn-110
• GYYNQSEAGSHTIQR (15aa)
  •    P30475    Asn-110
• GYYNQSEAGSHTIQR (15aa)
  •    P30466    Asn-110
• GYYNQSEAGSHTIQR (15aa)
  •    P30508    Asn-110
• GYYNQSEAGSHTIQR (15aa)
  •    P30505    Asn-110
• GYYNQSEAGSHTIQR (15aa)
  •    Q95604    Asn-110
• GYYNQSEAGSHTIQR (15aa)
  •    Q9TNN7    Asn-110
• GYYNQSEAGSHTIQR (15aa)
  •    P30501    Asn-110
• GYYNQSEAGSHTIQR (15aa)
  •    P30464    Asn-110
• GYYNQSEAGSHTIQR (15aa)
  •    Q29718    Asn-110
• DGSIVIHNLDYSDNGTFTCDVK (22aa)
  •    P25189    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
  •    P07996    Asn-248
• FHLANR (6aa)
  •    Q9NRN5    Asn-248
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• NVTAEQLFLK (10aa)
  •    Q9Y274    Asn-308
• GNISTEK (7aa)
  •    P56199    Asn-317
• VSVGLPNMTQGFW (13aa)
  •    Q9BYF1    Asn-322
• IEDNGLKNST (10aa)
  •    P51689    Asn-347
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• IYVLNYLNETQQLTQEIK (18aa)
  •    P20742    Asn-997
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679