taxonomy (7)
protein (76)
source (21)
structure (22)
composition (1)
disease (6)
reference (37)
site (97)
peptide (82)
- Homo sapiens (Human)
- Desmodus rotundus (Common vampire bat)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Gallus gallus (Chicken)
- Influenza a virus (strain a/ussr/90/1977 h1n1) (Influenza a virus (strain a/ussr/90/1977 h1n1))
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Adhesion G protein-coupled receptor F5 / Homo sapiens Q8IZF2
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein (a) / Homo sapiens P08519
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Apolipoprotein F / Homo sapiens Q13790
- Attractin / Homo sapiens O75882
- Biglycan / Homo sapiens P21810
- Cadherin-5 / Homo sapiens P33151
- CD44 antigen / Homo sapiens P16070
- CD59 glycoprotein / Homo sapiens P13987
- Ceruloplasmin / Homo sapiens P00450
- Clusterin / Homo sapiens P10909
- Coagulation factor IX / Homo sapiens P00740
- Coagulation factor V / Homo sapiens P12259
- Coagulation factor VIII / Homo sapiens P00451
- Complement c1r subcomponent / Homo sapiens P00736
- Complement factor H-related protein 3 / Homo sapiens Q02985
- Corticosteroid-binding globulin / Homo sapiens P08185
- Ecto-ADP-ribosyltransferase 4 / Homo sapiens Q93070
- Erythropoietin / Homo sapiens P01588
- Fibromodulin / Homo sapiens Q06828
- Galectin-3-binding protein / Homo sapiens Q08380
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- Homeobox protein Hox-B3 / Homo sapiens P14651
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- IgGFc-binding protein / Homo sapiens Q9Y6R7
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens Q8TDY8
- Integrin alpha-5/beta-1 / Homo sapiens P05556 P08648
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Keratin, type I cytoskeletal 9 / Homo sapiens P35527
- Kininogen-1 / Homo sapiens P01042
- Laminin subunit alpha-2 / Homo sapiens P24043
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Leptin receptor / Homo sapiens P48357
- Lumican / Homo sapiens P51884
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Macrophage colony-stimulating factor 1 receptor / Homo sapiens P07333
- Mesothelin / Homo sapiens Q13421
- Multimerin-1 / Homo sapiens Q13201
- Multimerin-2 / Homo sapiens Q9H8L6
- Multiple epidermal growth factor-like domains protein 8 / Homo sapiens Q7Z7M0
- Neuron navigator 2 / Homo sapiens Q8IVL1
- Neuropilin-1 / Homo sapiens O14786
- Pantetheinase / Homo sapiens O95497
- Plexin-B2 / Homo sapiens O15031
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Protein YIPF3 / Homo sapiens Q9GZM5
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens Q15262
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens P05026
- Target of Nesh-SH3 / Homo sapiens Q7Z7G0
- Tenascin / Homo sapiens P24821
- Tenascin-X / Homo sapiens P22105
- Thrombopoietin / Homo sapiens P40225
- Tyrosine-protein kinase receptor UFO / Homo sapiens P30530
- Uromodulin / Homo sapiens P07911
- Von willebrand factor / Homo sapiens P04275
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Glycophorin / Mus musculus P14220
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Neuroligin 1 / Rattus norvegicus Q62765
- Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1) P03453
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- neocortex (UBERON:0001950)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Placenta (UBERON_0001987)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
Source
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x NeuAc(a2-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3) + 2 x NeuAc(a2-6)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3) + 3 x NeuAc(a2-3)"
- N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 3656
- N-Linked / Complex / Structure 10243
- N-Linked / Complex / Structure 10774
- N-Linked / Complex / Structure 10787
- N-Linked / Complex / Structure 11252
- N-Linked / Complex / Structure 11255
- N-Linked / Complex / Structure 11697
Reported structure
- Cancer, breast (DOID:1612)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Familial hepatic adenoma (DOID:111366)
- Maturity-onset diabetes of the young type 3 (DOID:0111102)
- Prostate cancer (DOID:10283)
Disease
- Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
- Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
- Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
- Structural analysis of the N-linked oligosaccharides from murine glycophorin. (1991 - Angel A, Grnberg G, Krotkiewski H, Lisowska E, Nilsson B) / Status : Reviewed
Reference
- Adhesion G protein-coupled receptor F5 / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
-
Alpha-1-antitrypsin / Homo sapiens
- Undefined site
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein (a) / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Apolipoprotein F / Homo sapiens
- Attractin / Homo sapiens
- Biglycan / Homo sapiens
-
Cadherin-5 / Homo sapiens
- Undefined site
- Asn-535
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Clusterin / Homo sapiens
-
Coagulation factor IX / Homo sapiens
- Undefined site
- Coagulation factor V / Homo sapiens
-
Coagulation factor VIII / Homo sapiens
- Undefined site
- Complement c1r subcomponent / Homo sapiens
- Complement factor H-related protein 3 / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Ecto-ADP-ribosyltransferase 4 / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibromodulin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Homeobox protein Hox-B3 / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- IgGFc-binding protein / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Keratin, type I cytoskeletal 9 / Homo sapiens
- Kininogen-1 / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Leptin receptor / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Macrophage colony-stimulating factor 1 receptor / Homo sapiens
- Mesothelin / Homo sapiens
- Multimerin-1 / Homo sapiens
- Multimerin-2 / Homo sapiens
- Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
- Neuron navigator 2 / Homo sapiens
- Neuropilin-1 / Homo sapiens
- Pantetheinase / Homo sapiens
- Plexin-B2 / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Protein YIPF3 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
- Target of Nesh-SH3 / Homo sapiens
- Tenascin / Homo sapiens
- Tenascin-X / Homo sapiens
-
Thrombopoietin / Homo sapiens
- Undefined site
- Tyrosine-protein kinase receptor UFO / Homo sapiens
- Uromodulin / Homo sapiens
- Von willebrand factor / Homo sapiens
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Glycophorin / Mus musculus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
- Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGK (42aa)
- LVPVPITNATLDR (13aa)
- LVPVPITNATLDQITGK (17aa)
- TAVNCSSDFDACLITK (16aa)
- EAENITTGC (9aa)
- AFNSTLPTMAQMEK (14aa)
- CIQANYSIMENGK (13aa)
- SLNENITVPDTK (12aa)
- SVQEIQATFFYFTPNK (16aa)
- YFTPNKTEDTIFLR (14aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- QNQCFYNSSYLNVQR (15aa)
- QDQCIYNTTYINVQR (15aa)
- QDQCIYNTTYLNVQR (15aa)
- AQIIQGIGFNITER (14aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- ENDTHCIDFSYLLYSQK (17aa)
- FNLTETSEAEIHQSFQHLLR (20aa)
- AVLVNNITTGER (12aa)
- GQALLVNSSQPWEPLQLHVDK (21aa)
- QGGVNATQVLIQHLR (15aa)
- MLLTFHTDFSNEENGTIMFYK (21aa)
- ALSNISLR (8aa)
- NNSIYVVANIGDK (13aa)
- EHEGAIYPDNTTDFQR (16aa)
- GPECSQNYTTPSGVIK (16aa)
- HTNYSFSPWHGFTIHR (16aa)
- IEWIGNCSGINDETYGYK (18aa)
- IYIDHNNITR (10aa)
- SWPAVGNCSSALR (13aa)
- ALPGNLTAAVMEANQTGHEFPDR (23aa)
- VEMANLLNLSER (12aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- VVLHPNYSQVDIGLIK (16aa)
- ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
- IININPNK (8aa)
- YIQPIIAVQFTNITMDTEIR (20aa)
- QVLDNLTMEK (10aa)
- KYTGNASALFILPDQDKM (18aa)
- YTGNASALFILPDQDK (16aa)
- THTNISESHPNATFSAVGEASICEDDWNSGER (32aa)
- STGNLSTYNCQLLK (14aa)
- LNSSTIK (7aa)
- NGTITDAVDCALDPLSE (17aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- LNAENNATFYFK (12aa)
- LGYNANTSILSFQAVCR (17aa)
- IIQVVYIHSNNITK (14aa)
- NETLALPAESK (11aa)
- QDFNITDISLLEHR (14aa)
- RFPNIT (6aa)
- LPTTVLNATAK (11aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- LANLTQGEDQYYLR (14aa)
- WNVTSLETLK (10aa)
- GLNLTEDTYKPR (12aa)
- YKGLNLTEDTYKPR (14aa)
- IDSTGNVTNELR (12aa)
- APQHVVNHLPPYTNVSLK (18aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- FILNTENNFTLTDNHDNTANITVK (24aa)
- AAIPSALDTNSSK (13aa)
- INNLTVSLEMEK (12aa)
- GNETQLMLNSLQPNK (15aa)
- AGCLIGAEHVNNSYE (15aa)
- NVTLLWK (7aa)
- NCMLNENMSVCVADFGLSK (19aa)
- NDCISAPINSLLQMAK (16aa)
- IETILLNGTDR (11aa)
- LSALDNLLNHSSMFLK (16aa)
- ALLTNVSSVALGSR (14aa)
- VITVQVANFTLR (12aa)
- KECYYNINDASICDNVIAPNVTK (23aa)
- IIETVEYNISGAER (14aa)
- LELQGCEVNGCSTPLGMENGK (21aa)
- SVTLQIYNHSLTLSAR (16aa)
- NESGIILLGSGGTPAPPR (18aa)
- FVEGSHNSTVSLTTK (15aa)
- ALNLTEGFAVLHWK (14aa)
- TPENYPNAGLTENYCR (16aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Blood Plasma (UBERON_0001969)
-
Coagulation factor IX / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
-
Cadherin-5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Coagulation factor VIII / Homo sapiens
- Undefined site
-
Erythropoietin / Homo sapiens
- Undefined site
-
Thrombopoietin / Homo sapiens
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
-
Coagulation factor IX / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
-
Cadherin-5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
- N-Linked / Complex
(avg mass : 3392.0988)
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Placenta (UBERON_0001987)
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
-
Erythropoietin / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Placenta (UBERON_0001987)
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
-
Erythropoietin / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Placenta (UBERON_0001987)
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
-
Erythropoietin / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Placenta (UBERON_0001987)
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
-
Erythropoietin / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
-
Glycophorin / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Alpha-1-antichymotrypsin / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Erythropoietin / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- EAENITTGC (9aa)
- SLNENITVPDTK (12aa)
- GQALLVNSSQPWEPLQLHVDK (21aa)
- KYTGNASALFILPDQDKM (18aa)
- NGTITDAVDCALDPLSE (17aa)
- AGCLIGAEHVNNSYE (15aa)
-
- N-Linked / Complex
(avg mass : 3392.0988)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- Familial hepatic adenoma (DOID:111366)
- Maturity-onset diabetes of the young type 3 (DOID:0111102)
-
Alpha-1-acid glycoprotein 1 / Homo sapiens
- Undefined site
-
Alpha-1-antitrypsin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 3392.0988)
- neocortex (UBERON:0001950)
-
- Hex:7 HexNAc:6 dHex:1 NeuAc:3 / N-Linked
(avg mass : 3392.0988)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x NeuAc(a2-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3) + 2 x NeuAc(a2-6)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3) + 3 x NeuAc(a2-3)"
- N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 3656
- N-Linked / Complex / Structure 10243
- N-Linked / Complex / Structure 10774
- N-Linked / Complex / Structure 10787
- N-Linked / Complex / Structure 11252
- N-Linked / Complex / Structure 11255
- N-Linked / Complex / Structure 11697
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Adhesion G protein-coupled receptor F5 / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Apolipoprotein (a) / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Apolipoprotein F / Homo sapiens
- Attractin / Homo sapiens
- Biglycan / Homo sapiens
- Cadherin-5 / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement factor H-related protein 3 / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Ecto-ADP-ribosyltransferase 4 / Homo sapiens
- Fibromodulin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Homeobox protein Hox-B3 / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- IgGFc-binding protein / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
- Keratin, type I cytoskeletal 9 / Homo sapiens
- Kininogen-1 / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Leptin receptor / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Macrophage colony-stimulating factor 1 receptor / Homo sapiens
- Mesothelin / Homo sapiens
- Multimerin-1 / Homo sapiens
- Multimerin-2 / Homo sapiens
- Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
- Neuron navigator 2 / Homo sapiens
- Neuropilin-1 / Homo sapiens
- Pantetheinase / Homo sapiens
- Plexin-B2 / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Protein YIPF3 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
- Target of Nesh-SH3 / Homo sapiens
- Tenascin / Homo sapiens
- Tenascin-X / Homo sapiens
- Tyrosine-protein kinase receptor UFO / Homo sapiens
- Uromodulin / Homo sapiens
- Von willebrand factor / Homo sapiens
- Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGK (42aa)
- LVPVPITNATLDR (13aa)
- LVPVPITNATLDQITGK (17aa)
- TAVNCSSDFDACLITK (16aa)
- AFNSTLPTMAQMEK (14aa)
- CIQANYSIMENGK (13aa)
- SVQEIQATFFYFTPNK (16aa)
- YFTPNKTEDTIFLR (14aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- QNQCFYNSSYLNVQR (15aa)
- QDQCIYNTTYINVQR (15aa)
- QDQCIYNTTYLNVQR (15aa)
- AQIIQGIGFNITER (14aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- ENDTHCIDFSYLLYSQK (17aa)
- FNLTETSEAEIHQSFQHLLR (20aa)
- AVLVNNITTGER (12aa)
- QGGVNATQVLIQHLR (15aa)
- MLLTFHTDFSNEENGTIMFYK (21aa)
- ALSNISLR (8aa)
- NNSIYVVANIGDK (13aa)
- EHEGAIYPDNTTDFQR (16aa)
- GPECSQNYTTPSGVIK (16aa)
- HTNYSFSPWHGFTIHR (16aa)
- IEWIGNCSGINDETYGYK (18aa)
- IYIDHNNITR (10aa)
- SWPAVGNCSSALR (13aa)
- ALPGNLTAAVMEANQTGHEFPDR (23aa)
- VEMANLLNLSER (12aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- VVLHPNYSQVDIGLIK (16aa)
- ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
- IININPNK (8aa)
- YIQPIIAVQFTNITMDTEIR (20aa)
- QVLDNLTMEK (10aa)
- YTGNASALFILPDQDK (16aa)
- THTNISESHPNATFSAVGEASICEDDWNSGER (32aa)
- STGNLSTYNCQLLK (14aa)
- LNSSTIK (7aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- LNAENNATFYFK (12aa)
- LGYNANTSILSFQAVCR (17aa)
- IIQVVYIHSNNITK (14aa)
- NETLALPAESK (11aa)
- QDFNITDISLLEHR (14aa)
- RFPNIT (6aa)
- LPTTVLNATAK (11aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- LANLTQGEDQYYLR (14aa)
- WNVTSLETLK (10aa)
- GLNLTEDTYKPR (12aa)
- YKGLNLTEDTYKPR (14aa)
- IDSTGNVTNELR (12aa)
- APQHVVNHLPPYTNVSLK (18aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- FILNTENNFTLTDNHDNTANITVK (24aa)
- AAIPSALDTNSSK (13aa)
- INNLTVSLEMEK (12aa)
- GNETQLMLNSLQPNK (15aa)
- NVTLLWK (7aa)
- NCMLNENMSVCVADFGLSK (19aa)
- NDCISAPINSLLQMAK (16aa)
- IETILLNGTDR (11aa)
- LSALDNLLNHSSMFLK (16aa)
- ALLTNVSSVALGSR (14aa)
- VITVQVANFTLR (12aa)
- KECYYNINDASICDNVIAPNVTK (23aa)
- IIETVEYNISGAER (14aa)
- LELQGCEVNGCSTPLGMENGK (21aa)
- SVTLQIYNHSLTLSAR (16aa)
- NESGIILLGSGGTPAPPR (18aa)
- FVEGSHNSTVSLTTK (15aa)
- ALNLTEGFAVLHWK (14aa)
- TPENYPNAGLTENYCR (16aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:7 HexNAc:6 dHex:1 NeuAc:3 / N-Linked
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3392.0988)