Hex:7 HexNAc:6 dHex:1 NeuAc:3

Taxonomy

• Homo sapiens (Human)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Influenza a virus (strain a/ussr/90/1977 h1n1) (Influenza a virus (strain a/ussr/90/1977 h1n1))
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adhesion G protein-coupled receptor F5 / Homo sapiens    Q8IZF2
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Apolipoprotein (a) / Homo sapiens    P08519
• Apolipoprotein b-100 / Homo sapiens    P04114
• Apolipoprotein d / Homo sapiens    P05090
• Apolipoprotein f / Homo sapiens    Q13790
• Attractin / Homo sapiens    O75882
• Biglycan / Homo sapiens    P21810
• Cadherin-5 / Homo sapiens    P33151
• CD44 antigen / Homo sapiens    P16070
• CD59 glycoprotein / Homo sapiens    P13987
• Ceruloplasmin / Homo sapiens    P00450
• Clusterin / Homo sapiens    P10909
• Coagulation factor IX / Homo sapiens    P00740
• Coagulation factor V / Homo sapiens    P12259
• Coagulation factor VIII / Homo sapiens    P00451
• Complement c1r subcomponent / Homo sapiens    P00736
• Complement factor H-related protein 3 / Homo sapiens    Q02985
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens    Q93070
• Erythropoietin / Homo sapiens    P01588
• Fibromodulin / Homo sapiens    Q06828
• Galectin-3-binding protein / Homo sapiens    Q08380
• Golgi membrane protein 1 / Homo sapiens    Q8NBJ4
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Homeobox protein Hox-B3 / Homo sapiens    P14651
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• IgGFc-binding protein / Homo sapiens    Q9Y6R7
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens    Q8TDY8
• Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens    P35858
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Keratin, type I cytoskeletal 9 / Homo sapiens    P35527
• Kininogen-1 / Homo sapiens    P01042
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Leptin receptor / Homo sapiens    P48357
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens    P07333
• Mesothelin / Homo sapiens    Q13421
• Multimerin-1 / Homo sapiens    Q13201
• Multimerin-2 / Homo sapiens    Q9H8L6
• Multiple epidermal growth factor-like domains protein 8 / Homo sapiens    Q7Z7M0
• Neuron navigator 2 / Homo sapiens    Q8IVL1
• Neuropilin-1 / Homo sapiens    O14786
• Pantetheinase / Homo sapiens    O95497
• Plexin-B2 / Homo sapiens    O15031
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein yipf3 / Homo sapiens    Q9GZM5
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens    P05026
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Tenascin / Homo sapiens    P24821
• Tenascin-X / Homo sapiens    P22105
• Thrombopoietin / Homo sapiens    P40225
• Tyrosine-protein kinase receptor UFO / Homo sapiens    P30530
• Uromodulin / Homo sapiens    P07911
• Von willebrand factor / Homo sapiens    P04275
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Glycophorin / Mus musculus    P14220
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus    P08101
• Neuroligin 1 / Rattus norvegicus    Q62765
• Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)    P03453
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Kidney (UBERON_0002113)   6/9CII (CVCL_VT76)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK570 (CVCL_6370)   Fibroblast (CL_0000057)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Placenta (UBERON_0001987)  
• Umbilical Vein (UBERON_0002066)   HUVEC-C (CVCL_2959)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  

Reported structure

• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3) + 2 x NeuAc(a2-6)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3) + 3 x NeuAc(a2-3)"
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 3656
• N-Linked / Undefined core / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc + " + 4x Hex + 4x HexNAc + Fuc + 3x NeuAc "

Composition

• Hex:7 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3392.0988 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Prostate cancer (DOID:10283)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
• Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
• A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
• Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
• Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
• Structural analysis of the N-linked oligosaccharides from murine glycophorin. (1991 - Angel A, Grnberg G, Krotkiewski H, Lisowska E, Nilsson B) / Status : Reviewed

Reported glycosite

• Adhesion G protein-coupled receptor F5 / Homo sapiens
  •        Asn-718
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-33
  •        Asn-72
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-88
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-106
  •        Asn-271
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Apolipoprotein (a) / Homo sapiens
  •        Asn-4048
• Apolipoprotein b-100 / Homo sapiens
  •        Asn-3411
• Apolipoprotein d / Homo sapiens
  •        Asn-65
  •        Asn-88
  •        Asn-98
• Apolipoprotein f / Homo sapiens
  •        Asn-118
• Attractin / Homo sapiens
  •        Asn-416
• Biglycan / Homo sapiens
  •        Asn-311
• Cadherin-5 / Homo sapiens
  •        Undefined site
  •        Asn-519
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Ceruloplasmin / Homo sapiens
  •        Asn-138
• Clusterin / Homo sapiens
  •        Asn-374
• Coagulation factor IX / Homo sapiens
  •        Undefined site
• Coagulation factor V / Homo sapiens
  •        Asn-2064
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Complement c1r subcomponent / Homo sapiens
  •        Asn-122
• Complement factor H-related protein 3 / Homo sapiens
  •        Asn-307
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-96
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens
  •        Asn-274
• Erythropoietin / Homo sapiens
  •        Undefined site
  •        Asn-110
• Fibromodulin / Homo sapiens
  •        Asn-166
• Galectin-3-binding protein / Homo sapiens
  •        Asn-398
  •        Asn-551
• Golgi membrane protein 1 / Homo sapiens
  •        Asn-108
• Haptoglobin / Homo sapiens
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
• Homeobox protein Hox-B3 / Homo sapiens
  •        Asn-223
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-827
• IgGFc-binding protein / Homo sapiens
  •        Asn-1317
  •        Asn-2138
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-272
• Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
  •        Asn-582
• Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
  •        Asn-554
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-577
• Keratin, type I cytoskeletal 9 / Homo sapiens
  •        Asn-266
• Kininogen-1 / Homo sapiens
  •        Asn-294
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-2558
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-1366
• Leptin receptor / Homo sapiens
  •        Asn-659
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-252
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-275
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens
  •        Asn-153
• Mesothelin / Homo sapiens
  •        Asn-388
• Multimerin-1 / Homo sapiens
  •        Asn-575
• Multimerin-2 / Homo sapiens
  •        Asn-205
• Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
  •        Asn-1271
• Neuron navigator 2 / Homo sapiens
  •        Asn-784
• Neuropilin-1 / Homo sapiens
  •        Asn-150
• Pantetheinase / Homo sapiens
  •        Asn-130
• Plexin-B2 / Homo sapiens
  •        Asn-127
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-729
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Protein yipf3 / Homo sapiens
  •        Asn-337
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-101
  •        Asn-455
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
  •        Asn-158
  •        Asn-265
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-313
• Tenascin / Homo sapiens
  •        Asn-1485
• Tenascin-X / Homo sapiens
  •        Asn-3855
• Thrombopoietin / Homo sapiens
  •        Undefined site
• Tyrosine-protein kinase receptor UFO / Homo sapiens
  •        Asn-677
• Uromodulin / Homo sapiens
  •        Asn-232
  •        Asn-322
  •        Asn-513
• Von willebrand factor / Homo sapiens
  •        Asn-156
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Glycophorin / Mus musculus
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
  •        Undefined site
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)
  •        Asn-286
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-657

Mass spectrometry observed peptide

• MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGK (42aa)
  •    P02763    Asn-33
• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• SVQEIQATFFYFTPNK (16aa)
  •    P19652    Asn-72
• SVQEIQATFFYFTPNK (16aa)
  •    P02763    Asn-72
• YFTPNKTEDTIFLR (14aa)
  •    P19652    Asn-72
• YFTPNKTEDTIFLR (14aa)
  •    P02763    Asn-72
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-88
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-88
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-93
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88
• QDQCIYNTTYINVQR (15aa)
  •    P02763    Asn-93
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93
• AQIIQGIGFNITER (14aa)
  •    P08185    Asn-96
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98
• ENDTHCIDFSYLLYSQK (17aa)
  •    Q15262    Asn-101
• FNLTETSEAEIHQSFQHLLR (20aa)
  •    P01011    Asn-106
• AVLVNNITTGER (12aa)
  •    Q8NBJ4    Asn-108
• QGGVNATQVLIQHLR (15aa)
  •    Q13790    Asn-118
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• MLLTFHTDFSNEENGTIMFYK (21aa)
  •    P00736    Asn-122
• ALSNISLR (8aa)
  •    O15031    Asn-127
• NNSIYVVANIGDK (13aa)
  •    O95497    Asn-130
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138
• FQFCNDPFLGVYYHKNNK (18aa)
  •    P0DTC2    Asn-149
• GPECSQNYTTPSGVIK (16aa)
  •    O14786    Asn-150
• HTNYSFSPWHGFTIHR (16aa)
  •    P07333    Asn-153
• IEWIGNCSGINDETYGYK (18aa)
  •    P05026    Asn-158
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187
• ALPGNLTAAVMEANQTGHEFPDR (23aa)
  •    Q9H8L6    Asn-205
• VEMANLLNLSER (12aa)
  •    P14651    Asn-223
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232
• DLPQGFSALEPLVDLPIGINITR (23aa)
  •    P0DTC2    Asn-234
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241
• ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
  •    P51884    Asn-252
• IININPNK (8aa)
  •    P11279    Asn-261
• YIQPIIAVQFTNITMDTEIR (20aa)
  •    P05026    Asn-265
• QVLDNLTMEK (10aa)
  •    P35527    Asn-266
• YTGNASALFILPDQDK (16aa)
  •    P01011    Asn-271
• THTNISESHPNATFSAVGEASICEDDWNSGER (32aa)
  •    P01871    Asn-272
• STGNLSTYNCQLLK (14aa)
  •    Q93070    Asn-274
• LNSSTIK (7aa)
  •    P13473    Asn-275
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294
• LGYNANTSILSFQAVCR (17aa)
  •    Q02985    Asn-307
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311
• NETLALPAESK (11aa)
  •    Q7Z7G0    Asn-313
• QDFNITDISLLEHR (14aa)
  •    P07911    Asn-322
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• RFPNIT (6aa)
  •    P0DTC2    Asn-331
• LPTTVLNATAK (11aa)
  •    Q9GZM5    Asn-337
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374
• WNVTSLETLK (10aa)
  •    Q13421    Asn-388
• GLNLTEDTYKPR (12aa)
  •    Q08380    Asn-398
• YKGLNLTEDTYKPR (14aa)
  •    Q08380    Asn-398
• IDSTGNVTNELR (12aa)
  •    O75882    Asn-416
• APQHVVNHLPPYTNVSLK (18aa)
  •    Q15262    Asn-455
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513
• FILNTENNFTLTDNHDNTANITVK (24aa)
  •    P33151    Asn-519
• AAIPSALDTNSSK (13aa)
  •    Q08380    Asn-551
• DFALQNPSAVPR (12aa)
  •    P35858    Asn-554
• INNLTVSLEMEK (12aa)
  •    Q13201    Asn-575
• GNETQLMLNSLQPNK (15aa)
  •    Q8TDY8    Asn-582
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• HVNNSYE (7aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• NVTLLWK (7aa)
  •    P48357    Asn-659
• NCMLNENMSVCVADFGLSK (19aa)
  •    P30530    Asn-677
• NDCISAPINSLLQMAK (16aa)
  •    Q8IZF2    Asn-718
• IETILLNGTDR (11aa)
  •    Q07954    Asn-729
• GISSDNESVASCNSVK (16aa)
  •    Q8IVL1    Asn-784
• LSALDNLLNHSSMFLK (16aa)
  •    Q9Y4L1    Asn-827
• ALLTNVSSVALGSR (14aa)
  •    Q7Z7M0    Asn-1271
• VITVQVANFTLR (12aa)
  •    Q9Y6R7    Asn-1317
• KECYYNINDASICDNVIAPNVTK (23aa)
  •    Q14766    Asn-1366
• IIETVEYNISGAER (14aa)
  •    P24821    Asn-1485
• LELQGCEVNGCSTPLGMENGK (21aa)
  •    P12259    Asn-2064
• SVTLQIYNHSLTLSAR (16aa)
  •    Q9Y6R7    Asn-2138
• NESGIILLGSGGTPAPPR (18aa)
  •    P24043    Asn-2558
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411
• ALNLTEGFAVLHWK (14aa)
  •    P22105    Asn-3855
• TPENYPNAGLTENYCR (16aa)
  •    P08519    Asn-4048