Hex:7 HexNAc:6 dHex:1 NeuAc:3

Taxonomy

• Homo sapiens (Human)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Influenza a virus (strain a/ussr/90/1977 h1n1) (Influenza a virus (strain a/ussr/90/1977 h1n1))
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adhesion G protein-coupled receptor F5 / Homo sapiens    Q8IZF2
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein (a) / Homo sapiens    P08519
• Apolipoprotein B-100 / Homo sapiens    P04114
• Apolipoprotein D / Homo sapiens    P05090
• Apolipoprotein F / Homo sapiens    Q13790
• Attractin / Homo sapiens    O75882
• Biglycan / Homo sapiens    P21810
• Cadherin-5 / Homo sapiens    P33151
• CD44 antigen / Homo sapiens    P16070
• CD59 glycoprotein / Homo sapiens    P13987
• Ceruloplasmin / Homo sapiens    P00450
• Clusterin / Homo sapiens    P10909
• Coagulation factor IX / Homo sapiens    P00740
• Coagulation factor V / Homo sapiens    P12259
• Coagulation factor VIII / Homo sapiens    P00451
• Complement c1r subcomponent / Homo sapiens    P00736
• Complement factor H-related protein 3 / Homo sapiens    Q02985
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens    Q93070
• Erythropoietin / Homo sapiens    P01588
• Fibromodulin / Homo sapiens    Q06828
• Galectin-3-binding protein / Homo sapiens    Q08380
• Golgi membrane protein 1 / Homo sapiens    Q8NBJ4
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Homeobox protein Hox-B3 / Homo sapiens    P14651
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• IgGFc-binding protein / Homo sapiens    Q9Y6R7
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens    Q8TDY8
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Keratin, type I cytoskeletal 9 / Homo sapiens    P35527
• Kininogen-1 / Homo sapiens    P01042
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Leptin receptor / Homo sapiens    P48357
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens    P07333
• Mesothelin / Homo sapiens    Q13421
• Multimerin-1 / Homo sapiens    Q13201
• Multimerin-2 / Homo sapiens    Q9H8L6
• Multiple epidermal growth factor-like domains protein 8 / Homo sapiens    Q7Z7M0
• Neuron navigator 2 / Homo sapiens    Q8IVL1
• Neuropilin-1 / Homo sapiens    O14786
• Pantetheinase / Homo sapiens    O95497
• Plexin-B2 / Homo sapiens    O15031
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein YIPF3 / Homo sapiens    Q9GZM5
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens    P05026
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Tenascin / Homo sapiens    P24821
• Tenascin-X / Homo sapiens    P22105
• Thrombopoietin / Homo sapiens    P40225
• Tyrosine-protein kinase receptor UFO / Homo sapiens    P30530
• Uromodulin / Homo sapiens    P07911
• Von willebrand factor / Homo sapiens    P04275
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Glycophorin / Mus musculus    P14220
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus    P08101
• Neuroligin 1 / Rattus norvegicus    Q62765
• Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)    P03453
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Kidney (UBERON_0002113)   6/9CII (CVCL_VT76)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK570 (CVCL_6370)   Fibroblast (CL_0000057)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Placenta (UBERON_0001987)  
• Umbilical Vein (UBERON_0002066)   HUVEC-C (CVCL_2959)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293T (CVCL_0063)  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  

Reported structure

• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3) + 2 x NeuAc(a2-6)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3) + 3 x NeuAc(a2-3)"
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 3656
• N-Linked / Complex / Structure 10243
• N-Linked / Complex / Structure 10774
• N-Linked / Complex / Structure 10787

Composition

• Hex:7 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3392.0988 )

Disease

• Cancer, breast (DOID:1612)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Familial hepatic adenoma (DOID:111366)
• Maturity-onset diabetes of the young type 3 (DOID:0111102)
• Prostate cancer (DOID:10283)

Reference

• Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
• Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
• A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
• Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
• Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
• Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
• Structural analysis of the N-linked oligosaccharides from murine glycophorin. (1991 - Angel A, Grnberg G, Krotkiewski H, Lisowska E, Nilsson B) / Status : Reviewed

Reported glycosite

• Adhesion G protein-coupled receptor F5 / Homo sapiens
  •        Asn-718
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-88
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-106
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Undefined site
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein (a) / Homo sapiens
  •        Asn-4057
• Apolipoprotein B-100 / Homo sapiens
  •        Asn-3411
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Apolipoprotein F / Homo sapiens
  •        Asn-118
• Attractin / Homo sapiens
  •        Asn-416
• Biglycan / Homo sapiens
  •        Asn-311
• Cadherin-5 / Homo sapiens
  •        Undefined site
  •        Asn-535
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Ceruloplasmin / Homo sapiens
  •        Asn-138
• Clusterin / Homo sapiens
  •        Asn-374
• Coagulation factor IX / Homo sapiens
  •        Undefined site
• Coagulation factor V / Homo sapiens
  •        Asn-2064
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Complement c1r subcomponent / Homo sapiens
  •        Asn-125
• Complement factor H-related protein 3 / Homo sapiens
  •        Asn-309
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-96
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens
  •        Asn-274
• Erythropoietin / Homo sapiens
  •        Undefined site
  •        Asn-51
  •        Asn-65
  •        Asn-110
• Fibromodulin / Homo sapiens
  •        Asn-166
• Galectin-3-binding protein / Homo sapiens
  •        Asn-398
  •        Asn-551
• Golgi membrane protein 1 / Homo sapiens
  •        Asn-109
• Haptoglobin / Homo sapiens
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
• Homeobox protein Hox-B3 / Homo sapiens
  •        Asn-226
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-830
• IgGFc-binding protein / Homo sapiens
  •        Asn-1317
  •        Asn-2138
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-99
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-272
• Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
  •        Asn-582
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-577
• Keratin, type I cytoskeletal 9 / Homo sapiens
  •        Asn-266
• Kininogen-1 / Homo sapiens
  •        Asn-294
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-2558
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-1366
• Leptin receptor / Homo sapiens
  •        Asn-659
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-252
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-275
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens
  •        Asn-153
• Mesothelin / Homo sapiens
  •        Asn-388
• Multimerin-1 / Homo sapiens
  •        Asn-576
• Multimerin-2 / Homo sapiens
  •        Asn-205
• Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
  •        Asn-1271
• Neuron navigator 2 / Homo sapiens
  •        Asn-784
• Neuropilin-1 / Homo sapiens
  •        Asn-150
• Pantetheinase / Homo sapiens
  •        Asn-130
• Plexin-B2 / Homo sapiens
  •        Asn-127
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-729
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Protein YIPF3 / Homo sapiens
  •        Asn-337
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-101
  •        Asn-462
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
  •        Asn-158
  •        Asn-265
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-313
• Tenascin / Homo sapiens
  •        Asn-1485
• Tenascin-X / Homo sapiens
  •        Asn-3855
• Thrombopoietin / Homo sapiens
  •        Undefined site
• Tyrosine-protein kinase receptor UFO / Homo sapiens
  •        Asn-682
• Uromodulin / Homo sapiens
  •        Asn-232
  •        Asn-322
  •        Asn-513
• Von willebrand factor / Homo sapiens
  •        Asn-156
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Glycophorin / Mus musculus
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
  •        Undefined site
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)
  •        Asn-286
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-282
  •        Asn-657

Mass spectrometry observed peptide

• MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGK (42aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• EAENITTGC (9aa)
  •    P01588    Asn-51     Erythropoietin / Homo sapiens
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57     CD44 antigen / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• SVQEIQATFFYFTPNK (16aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• YFTPNKTEDTIFLR (14aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P19652    Asn-88     Alpha-1-acid glycoprotein 2 / Homo sapiens
• QDQCIYNTTYINVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• AQIIQGIGFNITER (14aa)
  •    P08185    Asn-96     Corticosteroid-binding globulin / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ENDTHCIDFSYLLYSQK (17aa)
  •    Q15262    Asn-101     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• FNLTETSEAEIHQSFQHLLR (20aa)
  •    P01011    Asn-106     Alpha-1-antichymotrypsin / Homo sapiens
• AVLVNNITTGER (12aa)
  •    Q8NBJ4    Asn-109     Golgi membrane protein 1 / Homo sapiens
• GQALLVNSSQPWEPLQLHVDK (21aa)
  •    P01588    Asn-110     Erythropoietin / Homo sapiens
• QGGVNATQVLIQHLR (15aa)
  •    Q13790    Asn-118     Apolipoprotein F / Homo sapiens
• MLLTFHTDFSNEENGTIMFYK (21aa)
  •    P00736    Asn-125     Complement c1r subcomponent / Homo sapiens
• ALSNISLR (8aa)
  •    O15031    Asn-127     Plexin-B2 / Homo sapiens
• NNSIYVVANIGDK (13aa)
  •    O95497    Asn-130     Pantetheinase / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• GPECSQNYTTPSGVIK (16aa)
  •    O14786    Asn-150     Neuropilin-1 / Homo sapiens
• HTNYSFSPWHGFTIHR (16aa)
  •    P07333    Asn-153     Macrophage colony-stimulating factor 1 receptor / Homo sapiens
• IEWIGNCSGINDETYGYK (18aa)
  •    P05026    Asn-158     Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• ALPGNLTAAVMEANQTGHEFPDR (23aa)
  •    Q9H8L6    Asn-205     Multimerin-2 / Homo sapiens
• VEMANLLNLSER (12aa)
  •    P14651    Asn-226     Homeobox protein Hox-B3 / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
  •    P51884    Asn-252     Lumican / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• YIQPIIAVQFTNITMDTEIR (20aa)
  •    P05026    Asn-265     Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
• QVLDNLTMEK (10aa)
  •    P35527    Asn-266     Keratin, type I cytoskeletal 9 / Homo sapiens
• KYTGNASALFILPDQDKM (18aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• YTGNASALFILPDQDK (16aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• THTNISESHPNATFSAVGEASICEDDWNSGER (32aa)
  •    P01871    Asn-272     Immunoglobulin heavy constant mu / Homo sapiens
• STGNLSTYNCQLLK (14aa)
  •    Q93070    Asn-274     Ecto-ADP-ribosyltransferase 4 / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• LGYNANTSILSFQAVCR (17aa)
  •    Q02985    Asn-309     Complement factor H-related protein 3 / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• NETLALPAESK (11aa)
  •    Q7Z7G0    Asn-313     Target of Nesh-SH3 / Homo sapiens
• QDFNITDISLLEHR (14aa)
  •    P07911    Asn-322     Uromodulin / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LPTTVLNATAK (11aa)
  •    Q9GZM5    Asn-337     Protein YIPF3 / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• WNVTSLETLK (10aa)
  •    Q13421    Asn-388     Mesothelin / Homo sapiens
• GLNLTEDTYKPR (12aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• YKGLNLTEDTYKPR (14aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• IDSTGNVTNELR (12aa)
  •    O75882    Asn-416     Attractin / Homo sapiens
• APQHVVNHLPPYTNVSLK (18aa)
  •    Q15262    Asn-462     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens
• FILNTENNFTLTDNHDNTANITVK (24aa)
  •    P33151    Asn-535     Cadherin-5 / Homo sapiens
• AAIPSALDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• INNLTVSLEMEK (12aa)
  •    Q13201    Asn-576     Multimerin-1 / Homo sapiens
• GNETQLMLNSLQPNK (15aa)
  •    Q8TDY8    Asn-582     Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NVTLLWK (7aa)
  •    P48357    Asn-659     Leptin receptor / Homo sapiens
• NCMLNENMSVCVADFGLSK (19aa)
  •    P30530    Asn-682     Tyrosine-protein kinase receptor UFO / Homo sapiens
• NDCISAPINSLLQMAK (16aa)
  •    Q8IZF2    Asn-718     Adhesion G protein-coupled receptor F5 / Homo sapiens
• IETILLNGTDR (11aa)
  •    Q07954    Asn-729     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• LSALDNLLNHSSMFLK (16aa)
  •    Q9Y4L1    Asn-830     Hypoxia up-regulated protein 1 / Homo sapiens
• ALLTNVSSVALGSR (14aa)
  •    Q7Z7M0    Asn-1271     Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
• VITVQVANFTLR (12aa)
  •    Q9Y6R7    Asn-1317     IgGFc-binding protein / Homo sapiens
• KECYYNINDASICDNVIAPNVTK (23aa)
  •    Q14766    Asn-1366     Latent transforming growth factor beta binding protein 1 / Homo sapiens
• IIETVEYNISGAER (14aa)
  •    P24821    Asn-1485     Tenascin / Homo sapiens
• LELQGCEVNGCSTPLGMENGK (21aa)
  •    P12259    Asn-2064     Coagulation factor V / Homo sapiens
• SVTLQIYNHSLTLSAR (16aa)
  •    Q9Y6R7    Asn-2138     IgGFc-binding protein / Homo sapiens
• NESGIILLGSGGTPAPPR (18aa)
  •    P24043    Asn-2558     Laminin subunit alpha-2 / Homo sapiens
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens
• ALNLTEGFAVLHWK (14aa)
  •    P22105    Asn-3855     Tenascin-X / Homo sapiens
• TPENYPNAGLTENYCR (16aa)
  •    P08519    Asn-4057     Apolipoprotein (a) / Homo sapiens