Hex:4 HexNAc:5 dHex:2 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Human immunodeficiency virus type 1 (HIV-1)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Biglycan / Homo sapiens    P21810
• CD59 glycoprotein / Homo sapiens    P13987
• Ceruloplasmin / Homo sapiens    P00450
• Clusterin / Homo sapiens    P10909
• Decorin / Homo sapiens    P07585
• Deoxyribonuclease-1 / Homo sapiens    P24855
• Desmoglein-2 / Homo sapiens    Q14126
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens    Q13444
• Ephrin-A3 / Homo sapiens    P52797
• Fibromodulin / Homo sapiens    Q06828
• Glycodelin-a / Homo sapiens    P09466
• Golgi apparatus protein 1 / Homo sapiens    Q92896
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Histidine-rich glycoprotein / Homo sapiens    P04196
• HLA class I histocompatibility antigen, A-23 alpha chain / Homo sapiens    P30447
• HLA class I histocompatibility antigen, A-24 alpha chain / Homo sapiens    P05534
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interstitial collagenase / Homo sapiens    P03956
• Lactotransferrin / Homo sapiens    P02788
• Lumican / Homo sapiens    P51884
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Nephronectin / Homo sapiens    Q6UXI9
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolargin / Homo sapiens    P51888
• Prominin-1 / Homo sapiens    O43490
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Protein CREG1 / Homo sapiens    O75629
• Serotransferrin / Homo sapiens    P02787
• Thrombospondin-1 / Homo sapiens    P07996
• Uromodulin / Homo sapiens    P07911
• Vitamin k-dependent protein c / Homo sapiens    P04070
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries    Q712V9
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries    Q712V9
• Neuroligin 1 / Rattus norvegicus    Q62765
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Mucin / Sus scrofa    
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Acetabular Part of Hip Bone (UBERON_0001269)   HT-1080 (CVCL_0317)   Fibroblast (CL_0000057)  
• Amniotic Fluid (UBERON_0000173)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Cerebrospinal Fluid (UBERON_0001359)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Prefrontal Cortex (UBERON:0000451)  
• Seminal Fluid (UBERON_0006530)  
• Trachea (UBERON_0003126)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293SF-3F6 (CVCL_4V95)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Fuc(a1-3) + NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Fuc(a1-3) + NeuAc(a2-6)"
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[HexNAc(?1-?)HexNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc + Fuc"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 413
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 9485
• N-Linked / Complex / Structure 9930
• N-Linked / Complex / Structure 10090
• N-Linked / Complex / Structure 10782
• N-Linked / Complex / Structure 10798
• N-Linked / Complex / Structure 10974
• N-Linked / Complex / Structure 11488
• N-Linked / Complex / Structure 11511
• N-Linked / Complex / Structure 11593
• N-Linked / Complex / Structure 11664
• N-Linked / Complex / Structure 11724
• N-Linked / Complex / Structure 11864
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)[NeuAc(a2-6)]Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc

Composition

• Hex:4 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2266.1038 )

Disease

• Alzheimer's disease (DOID:10652)
• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Fibrosarcoma (DOID:3355)
• Prostate cancer (DOID:10283)
• Prostate Disease (DOID:47)
• Scrapie (DOID:5434)

Reference

• Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
• Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
• Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
• Novel Asn-linked oligosaccharides terminating in GalNAc beta (1-->4)[Fuc alpha (1-->3)]GlcNAc beta (1-->.) are present in recombinant human protein C expressed in human kidney 293 cells. (1993 - Yan S, Chao Y, van Halbeek H) / Status : Reviewed
• Structures of the sialylated oligosaccharide chains in swine tracheal mucin glycoproteins. (1987 - Rana SS, Chandrasekaran EV, Mendicino J) / Status : Reviewed

Reported glycosite

• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-72
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Asn-72
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-127
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-271
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
  •        Asn-176
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-1424
• Biglycan / Homo sapiens
  •        Asn-311
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Ceruloplasmin / Homo sapiens
  •        Asn-397
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-374
• Decorin / Homo sapiens
  •        Asn-211
• Deoxyribonuclease-1 / Homo sapiens
  •        Asn-40
• Desmoglein-2 / Homo sapiens
  •        Asn-182
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-276
• Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
  •        Asn-389
• Ephrin-A3 / Homo sapiens
  •        Asn-100
• Fibromodulin / Homo sapiens
  •        Asn-166
• Glycodelin-a / Homo sapiens
  •        Asn-81
• Golgi apparatus protein 1 / Homo sapiens
  •        Asn-210
  •        Asn-786
• Haptoglobin / Homo sapiens
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-64
• Histidine-rich glycoprotein / Homo sapiens
  •        Asn-125
• HLA class I histocompatibility antigen, A-23 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-24 alpha chain / Homo sapiens
  •        Asn-110
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-205
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-207
• Interstitial collagenase / Homo sapiens
  •        Asn-120
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
• Lumican / Homo sapiens
  •        Asn-127
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
• Nephronectin / Homo sapiens
  •        Asn-273
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-248
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-90
  •        Asn-421
  •        Asn-469
• Prolargin / Homo sapiens
  •        Asn-327
• Prominin-1 / Homo sapiens
  •        Asn-274
• Prosaposin / Homo sapiens
  •        Asn-101
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Protein CREG1 / Homo sapiens
  •        Asn-216
• Serotransferrin / Homo sapiens
  •        Asn-432
  •        Asn-630
• Thrombospondin-1 / Homo sapiens
  •        Asn-248
• Uromodulin / Homo sapiens
  •        Asn-232
• Vitamin k-dependent protein c / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •        Asn-184
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •        Asn-184
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Mucin / Sus scrofa
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-149
  •        Asn-331
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Undefined site
  •        Asn-343

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MSNATLVSYIVQILSR (16aa)
  •    P24855    Asn-40     Deoxyribonuclease-1 / Homo sapiens
• TAVNCSSDFDACIITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• FVGTPEVNQTTIYQR (15aa)
  •    P01033    Asn-53     Metalloproteinase inhibitor 1 / Homo sapiens
• CSDGWSFDATTLDDNGTMLFFK (22aa)
  •    P02790    Asn-64     Hemopexin / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• SVQEIQATFFYFTPNKTEDTIFLR (24aa)
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• KEDALNETR (9aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-90     Polymeric immunoglobulin receptor / Homo sapiens
• TCNASQGFK (9aa)
  •    P52797    Asn-100     Ephrin-A3 / Homo sapiens
• TCDWIPKPNMSASCK (15aa)
  •    P07602    Asn-101     Prosaposin / Homo sapiens
• YYNQSEAGSHTIQMMFGCDVGSDGR (25aa)
  •    P05534    Asn-110     HLA class I histocompatibility antigen, A-24 alpha chain / Homo sapiens
  •    P30447    Asn-110     HLA class I histocompatibility antigen, A-23 alpha chain / Homo sapiens
• VIDFNCTTSSVSSAIANTK (19aa)
  •    P04196    Asn-125     Histidine-rich glycoprotein / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• TLNQSSDELQLSMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• TINQSSDEIQISMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• AALAAFNAQNNGSNFQLEEISR (22aa)
  •    P02765    Asn-176     Alpha-2-HS-glycoprotein / Homo sapiens
• INATDADEPNTINSK (15aa)
  •    Q14126    Asn-182     Desmoglein-2 / Homo sapiens
• YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• GNITEYQCHQYITK (14aa)
  •    Q92896    Asn-210     Golgi apparatus protein 1 / Homo sapiens
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• IVTPEEYYNVT (11aa)
  •    O75629    Asn-216     Protein CREG1 / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• VVIHPNYSQVDIGIIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
  •    P07996    Asn-248     Thrombospondin-1 / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• GNGTILK (7aa)
  •    Q6UXI9    Asn-273     Nephronectin / Homo sapiens
• EALENMNSTLK (11aa)
  •    O43490    Asn-274     Prominin-1 / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• INGTQICPNDIVAFHDFSSDIENVPHIR (28aa)
  •    P51888    Asn-327     Prolargin / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• TCIMEASTDFLPGLNFSNCSR (21aa)
  •    Q13444    Asn-389     Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
• ENITAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397     Ceruloplasmin / Homo sapiens
• LSLLEEPGNGTFTVILNQLTSR (22aa)
  •    P01833    Asn-421     Polymeric immunoglobulin receptor / Homo sapiens
• CGIVPVIAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• QQQHIFGSNVTDCSGNFCIFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• NDTLQEAK (8aa)
  •    Q92896    Asn-786     Golgi apparatus protein 1 / Homo sapiens
• NQTLSLFFTVLQDVPVR (17aa)
  •    P01023    Asn-1424     Alpha-2-macroglobulin / Homo sapiens