taxonomy (18)
protein (112)
source (87)
structure (18)
composition (1)
disease (35)
reference (129)
site (153)
peptide (25)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis lupus familiaris (Dog)
- Equus caballus (Domestic horse)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Salmo salar (Atlantic salmon)
- Collocalia sp (Glossy swiftlet)
- Human herpes simplex virus 2
- Murine hepatitis virus (strain a59)
- Friend murine leukemia virus (F-mulv)
- Friend spleen focus-forming virus
- Friend spleen focus-forming virus (gm1 mutant)
- Friend spleen focus-forming virus (gm1.2 mutant)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- A disintegrin and metalloproteinase with thrombospondin motifs 5 / Homo sapiens Q9UNA0
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein (a) / Homo sapiens P08519
- Apolipoprotein C-III / Homo sapiens P02656
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- Bile-salt-activated lipase / Homo sapiens P19835
- Chondroitin sulfate proteoglycan / Homo sapiens
- Choriogonadotropin - alpha and beta chains / Homo sapiens P0DN86 P01215
- Choriogonadotropin beta chain / Homo sapiens P0DN86
- Chromogranin a / Homo sapiens P10645
- Coagulation factor IX / Homo sapiens P00740
- Coagulation factor x / Homo sapiens P00742
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- Erythropoietin / Homo sapiens P01588
- Extracellular matrix protein 1 / Homo sapiens Q16610
- Fractalkine / Homo sapiens P78423
- Glycocalicin / Homo sapiens P07359
- Glycophorin a and b / Homo sapiens P06028 P02724
- Glycophorin a, b and c / Homo sapiens P06028 P04921 P02724
- Glycophorin B Miltenberger subtype III / Homo sapiens B8Q179
- Glycophorin-A / Homo sapiens P02724
- Gpl115 / Homo sapiens
- Hepatocyte growth factor / Homo sapiens P14210
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens P01860
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens P01860
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy variable 4-39 / Homo sapiens P01824
- Immunoglobulin lambda-1 light chain / Homo sapiens P0DOX8
- Insulin-like growth factor II / Homo sapiens P01344
- Insulin-like growth factor-binding protein 6 / Homo sapiens P24592
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens P19823
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interferon alpha-2 / Homo sapiens P01563
- Interleukin-2 / Homo sapiens P60568
- Leukosialin (cd43) / Homo sapiens P16150
- Low-density lipoprotein receptor / Homo sapiens P01130
- Matrix metalloproteinase-9 / Homo sapiens P14780
- Membrane protein FAM174A / Homo sapiens Q8TBP5
- Muc1 fusion protein / Homo sapiens
- Mucin-1 / Homo sapiens P15941
- Ovochymase-1 / Homo sapiens Q7RTY7
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens Q96FE7
- Plasminogen / Homo sapiens P00747
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Proheparin-binding EGF-like growth factor / Homo sapiens Q99075
- Protein YIPF3 / Homo sapiens Q9GZM5
- Proteoglycan / Homo sapiens
- Proteoglycan 4 (lubricin) / Homo sapiens Q92954
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Recombinant Mucin-1 Muc1f/5actr / Homo sapiens P15941 P98088
- Recombinant Mucin-1 Muc1f/5btr / Homo sapiens P15941 Q9HC84
- Semenogelin-2 / Homo sapiens Q02383
- Sex hormone-binding globulin / Homo sapiens P04278
- Sparc-like protein 1 / Homo sapiens Q14515
- Thrombopoietin / Homo sapiens P40225
- Transferrin receptor protein 1 / Homo sapiens P02786
- Transmembrane protein C16orf54 / Homo sapiens Q6UWD8
- Tumor necrosis factor receptor superfamily member 16 / Homo sapiens P08138
- Tumor necrosis factor receptor superfamily member 1b (etanercept, enbrel) / Homo sapiens P20333
- Uncharacterized protein / Homo sapiens
- Uncharacterized protein / Homo sapiens
- Uncharacterized protein / Homo sapiens
- Uncharacterized protein from Transudate / Homo sapiens
- Uncharacterized protein from Urine / Homo sapiens
- Uncharacterized protein from Urine / Homo sapiens
- Unspecified mucin / Homo sapiens
- Urine glycopeptide / Homo sapiens
- Versican core protein / Homo sapiens P13611
- Von willebrand factor / Homo sapiens P04275
- Zona pellucida sperm-binding protein 3 / Homo sapiens P21754
- Alpha-2-hs-glycoprotein / Bos taurus P12763
- Chromogranin a / Bos taurus P05059
- Coagulation factor x / Bos taurus P00743
- Glycoprotein hormones alpha chain / Bos taurus P01217
- Gp-3 / Bos taurus
- Kappa casein / Bos taurus P02668
- Plasminogen / Bos taurus P06868
- Uncharacterized protein / Bos taurus
- Glycophorin / Canis lupus familiaris P02727
- Choriogonadotropin beta chain / Equus caballus P08751
- Fetal antigen 1 / Mus musculus Q09163
- Glycophorin / Mus musculus P14220
- Tenascin-r / Mus musculus Q8BYI9
- Uncharacterized protein / Mus musculus
- Uncharacterized protein / Mus musculus
- Uncharacterized protein / Mus musculus
- Zona pellucida sperm-binding protein matrix / Mus musculus P20239 Q62005 P10761
- Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Dystroglycan / Ovis aries W5PVZ9
- Major membrane glycoprotein - MII2 / Rattus norvegicus
- Neuroligin 1 / Rattus norvegicus Q62765
- Sialoglycoprotein (rspg-4) / Rattus norvegicus
- Uncharacterized protein from Brain / Rattus norvegicus
- Uncharacterized proteoglycan / Rattus norvegicus
- Mucin / Sus scrofa
- Plasminogen / Sus scrofa P06867
- Kininogen / Salmo salar
- Salarin / Salmo salar
- Mucin / Collocalia sp
- gG-2 / Human herpes simplex virus 2 P13290
- E1 glycoprotein / Murine hepatitis virus (strain a59) P03415
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus P03393
- Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus (gm1 mutant) P03393
- Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus (gm1.2 mutant) P03393
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Adenohypophysis (UBERON_0002196)
- Amniotic Fluid (UBERON_0000173)
- Aorta (UBERON_0000947)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Bulbo-Urethral Gland (UBERON_0002366)
- Colon (UBERON_0001155) Caco-2 (CVCL_0025)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Colonic Mucosa (UBERON_0000317) HT29-16E (CVCL_C763)
- Colostrum (UBERON_0001914)
- Connective Tissue (UBERON_0002384) LTK (CVCL_R978)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Liver (UBERON_0002107) Zajdela-Hepatoma (CVCL_1D00) Cell Surface (GO_0009986)
- Mammary Gland (UBERON_0001911) HBL-100 (CVCL_4362)
- Mammary Gland (UBERON_0001911) MDA-MB-231 (CVCL_0062)
- Mammary Gland (UBERON_0001911) MTSV1-7 (CVCL_8645)
- Mammary Gland (UBERON_0001911) T-47D (CVCL_0553)
- Mammary Gland (UBERON_0001911) ZR-75-1 (CVCL_0588)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DXB11 (CVCL_1977)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987) BeWo (CVCL_0044) Epithelium (CL_0002577)
- Placenta (UBERON_0001987)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Skin of Body (UBERON_0002097) A-431 (CVCL_0037) Fibroblast (CL_0000057)
- Skin of Body (UBERON_0002097)
- Synovial Fluid (UBERON_0001090)
- Thyroid (UBERON_0002046)
- Transudate (UBERON_0007779)
- Urine (UBERON_0001088)
- Uterine Cervix (UBERON_0000002) HEp-2 (CVCL_1906)
- Zona Pellucida (UBERON_0000086)
- 17cl1 (CVCL_VT75) Fibroblast (CL_0000057)
- C10 (CVCL_5245)
- CCRF-CEM (CVCL_0207) Lymphocyte (CL_0000542)
- CHO (CVCL_0213)
- COLO 205 (CVCL_0218)
- COLO 320 (CVCL_1989)
- Co115 (CVCL_D102)
- DLD-1 (CVCL_0248)
- Eveline (CVCL_A1LI)
- HCT 116 (CVCL_0291)
- HCT 15 (CVCL_0292)
- HCT 8 (CVCL_2478)
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- HT29 (CVCL_A8EZ)
- KM12 (CVCL_1331)
- LOVO (CVCL_0399)
- LS174T (CVCL_1384)
- LS180 (CVCL_0397)
- LS411N (CVCL_1385)
- RKO (CVCL_0504)
- Rat1 (CVCL_0492)
- SW1116 (CVCL_0544)
- SW1398 (CVCL_3885)
- SW1463 (CVCL_1718)
- SW48 (CVCL_1724)
- SW480 (CVCL_0546)
- SW620 (CVCL_0547)
- SW837 (CVCL_1729)
- SW948 (CVCL_0632)
- T84 (CVCL_0555)
- WiDr (CVCL_2760)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Erythrocyte (CL_0000232)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Granulocyte (CL_0000094)
- Leukocyte (CL_0000738)
- Lymphocyte (CL_0000542)
- Neutrophil (CL_0000775)
- Platelet (CL_0000233) Plasma Membrane (GO_0005886)
- T-Lymphocyte (CL_0000084)
- Chromaffin Granules (GO_0042583)
- Plasma Membrane (GO_0005886)
- Very-Low-Density Lipoprotein Particle (GO_0034361)
Source
- N-Linked / No-core / NeuAc(a2-8)NeuAc(a2-3)Gal(b1-4)GlcNAc
- O-Linked / Core 1 / Gal(b1-3)[NeuAc(a2-8)NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc+"+ 2 x NeuAc"
- O-Linked / Core 1 / Neu5Ac(?2-?)Gal(b1-3)[Neu5Ac(?2-?)]GalNAc(a1-
- O-Linked / Core 1 / NeuAc(?2-3)Gal(?1-3)[NeuAc(?2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(?2-3)Gal(b1-3)[NeuAc(?2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(?2-6)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(?2-?)Gal(?1-?)[NeuAc(?2-?)]GalNAc
- O-Linked / Core 1 / NeuAc(?2-?)Gal(b1-3)GalNAc+"+ NeuAc(?2-?)"
- O-Linked / Core 1 / NeuAc(?2-?)Hex(?1-?)[NeuAc(?2-?)]HexNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(a2-?)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / Structure 9332
- O-Linked / Core 1 / Structure 10127
- O-Linked / No-core / NeuAc(?2-?)Gal(?1-3)[NeuAc(?2-6)]GalNAc
- O-Linked / Undefined core / Gal(?1-3)GalNAc+"+ 2 x NeuAc"
- O-Linked / Undefined core / Gal(?1-?)GalNAc+"+ 2 x NeuAc"
- O-Linked / Undefined core / Gal(b1-?)GalNAc+"+ 2 x NeuAc"
Reported structure
- Hex:1 HexNAc:1 NeuAc:2 (avg mass : 965.8685 )
Composition
- Adenocarcinoma (DOID:299)
- Arthritis, Rheumatoid (DOID:7148)
- Aspartylglycosaminuria (DOID:0050461)
- Cancer, breast (DOID:1612)
- Carcinoid Tumor, with multiple liver metastasis
- Carcinoma, Hepatocellular (DOID:684)
- Carcinoma, Squamous cell (DOID:1749)
- Cecum adenocarcinoma (DOID:3039)
- Chondrosarcoma (DOID:3371)
- Choriocarcinoma (DOID:3594)
- Colon adenocarcinoma (DOID:234)
- Colon carcinoma (DOID:1520)
- Colorectal carcinoma (DOID:0080199)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Dyscrasia, Plasma Cell (DOID:6536)
- Erythroleukemia with associated Polycythemia
- Hybridoma
- Hyperlipoproteinemia, Familial Type V (DOID:1171)
- Kidney Failure, Chronic (DOID:784)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Leukemia, Acute myelogenous (DOID:9119)
- Leukemia, Myloid, Chronic (DOID:8552)
- Lysosomal storage disease (DOID:3211)
- Mixed phenotype acute leukemia (DOID:9953)
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Osteoarthritis (DOID:8398)
- Pancreatitis, Chronic (DOID:4989)
- Prostate cancer (DOID:10283)
- Rectal adenocarcinoma (DOID:1996)
- Sialidosis (Mucolipidosis I) (DOID:3343)
- Tn Polyagglutinability Syndrome (DOID:0080520)
- Wiskott-Aldrich Syndrome (DOID:9169)
Disease
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Unreviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Extended Sialylated O-Glycan Repertoire of Human Urinary Glycoproteins Discovered and Characterized Using Electron-Transfer/Higher-Energy Collision Dissociation (2019 - Zsuzsanna Darula, Ádám Pap, Katalin F. Medzihradszky) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Identification of protein O-glycosylation site and corresponding glycans using liquid chromatography-tandem mass spectrometry via mapping accurate mass and retention time shift (2014 - Huang LJ, Lin JH, Tsai JH, Chu YY, Chen YW, Chen SL, Chen SH) / Status : Reviewed
- Site-specific analysis of the O-glycosylation of bovine fetuin by electron-transfer dissociation mass spectrometry (2014 - Windwarder M, Altmann F) / Status : Reviewed
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Glycomic analysis of high density lipoprotein shows a highly sialylated particle (2014 - Huang J1, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- In vivo glycosylation of mucin tandem repeats (2001 - Silverman, Parry, Sutton-Smith, Burdick, McDermott, Reid, Batra, Morris, Hollingsworth, Dell, Harris) / Status : Reviewed
- Structural elucidation of the N- and O-glycans of human apolipoprotein(a): role of O-glycans in conferring protease resistance. (2001 - Garner B, Merry A, Royle L, Harvey D, Rudd P, Thillet J) / Status : Reviewed
- Glycosylation analysis of two cysteine proteinase inhibitors from Atlantic salmon skin: di-O-acetylated sialic acids are the major sialic acid species on N-glycans (2001 - Ylonen, Kalkkinen, Saarinen, Bogwald, Helin) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Impaired galactosylation of core 2 O-glycans in erythrocytes of beta1,4-galactosyltransferase knockout mice. (1999 - Kotani N, Asano M, Iwakura Y, Takasaki S) / Status : Reviewed
- Chromogranin A from bovine adrenal medulla: molecular characterization of glycosylations, phosphorylations, and sequence heterogeneities by mass spectrometry. (1999 - Bauer S, Zhang X, Van Dongen W, Claeys M, Przybylski M) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
- Structural characterisation of N-linked and O-linked oligosaccharides derived from interferon-alpha2b and interferon-alpha14c produced by Sendai-virus-induced human peripheral blood leukocytes (1998 - Nyman, Kalkkinen, Tolo, Helin) / Status : Reviewed
- Glycosylation pattern of human inter-alpha-inhibitor heavy chains. (1998 - Flahaut C, Capon C, Balduyck M, Ricart G, Sautiere P, Mizon J) / Status : Reviewed
- Phosphorylation and O-glycosylation sites of human chromogranin A (CGA79-439) from urine of patients with carcinoid tumors. (1998 - Gadroy P, Stridsberg M, Capon C, Michalski J, Strub J, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- Posttranslational modifications of human inter-alpha-inhibitor: identification of glycans and disulfide bridges in heavy chains 1 and 2. (1998 - Olsen E, Rahbek-Nielsen H, Thogersen I, Roepstorff P, Enghild J) / Status : Reviewed
- The glycosylation and structure of human serum IgA1, Fab, and Fc regions and the role of N-glycosylation on Fc alpha receptor interactions. (1998 - Mattu T, Pleass R, Willis A, Kilian M, Wormald M, Lellouch A, Rudd P, Woof J, Dwek R) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Structural analysis of sequences O-linked to mannose reveals a novel Lewis X structure in cranin (dystroglycan) purified from sheep brain. (1998 - Smalheiser N, Haslam S, Sutton-Smith M, Morris H, Dell A) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
- Structural determination of the O-linked sialyl oligosaccharides liberated from fetuin with endo-alpha-N-acetylgalactosaminidase-S by HPLC analysis and 600-MHz 1H-NMR spectroscopy. (1997 - Ishii-Karakasa I, Iwase H, Hotta K) / Status : Reviewed
- O-linked olgiosaccharide on the 75-kDa neurotrophin receptor (1996 - Chapman, Eckart, Kaufman, Lapointe) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Comparison of O-linked carbohydrate chains in MUC-1 mucin from normal breast epithelial cell lines and breast carcinoma cell lines. Demonstration of simpler and fewer glycan chains in tumor cells. (1996 - Lloyd KO, Burchell J, Kudryashov V, Yin BW, Taylor-Papadimitriou J) / Status : Reviewed
- Characterization of four monosialo and a novel disialo Asn N-glycosides from the urine of a patient with aspartylglycosaminuria. (1995 - Irie F, Murakoshi H, Suzuki T, Suzuki Y, Kon K, Ando S, Yoshida K, Hirabayashi Y) / Status : Reviewed
- Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995 - Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Sialylation and sulfation of the carbohydrate chains in respiratory mucins from a patient with cystic fibrosis. (1994 - Lo-Guidice J, Wieruszeski J, Lemoine J, Verbert A, Roussel P, Lamblin G) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- An improved approach to the analysis of the structure of small oligosaccharides of glycoproteins: application to the O-linked oligosaccharides from human glycophorin A. (1993 - Krotkiewski H, Lisowska E, Nilsson G, Grnberg G, Nilsson B) / Status : Reviewed
- Variation of the glycosylation of human pancreatic bile-salt-dependent lipase. (1993 - Mas E, Abouakil N, Roudani S, Franc J, Montreuil J, Lombardo D) / Status : Reviewed
- Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1993 - Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A) / Status : Reviewed
- Oligosaccharide structures of mucins secreted by the human colonic cancer cell line CL.16E. (1992 - Capon C, Laboisse C, Wieruszeski J, Maoret J, Augeron C, Fournet B) / Status : Reviewed
- Analysis of glycoform of O-glycan from human myeloma immunoglobulin A1 by gas-phase hydrazinolysis following pyridylamination of oligosaccharides. (1992 - Iwase H, Ishii-Karakasa I, Fujii E, Hotta K, Hiki Y, Kobayashi Y) / Status : Reviewed
- Hepatocyte growth factor is linked by O-glycosylated oligosaccharide on the alpha chain. (1992 - Shimizu N, Hara H, Sogabe T, Sakai H, Ihara I, Inoue H, Nakamura T, Shimizu S) / Status : Reviewed
- The carbohydrate chains of the beta subunit of human chorionic gonadotropin produced by the choriocarcinoma cell line BeWo. Novel O-linked and novel bisecting-GlcNAc-containing N-linked carbohydrates. (1992 - Hard K, Damm J, Spruijt M, Bergwerff A, Kamerling J, Van Dedem G, Vliegenthart J) / Status : Reviewed
- Identification of the O-linked glycosylation site of the human transferrin receptor. (1992 - Hayes G, Enns C, Lucas J) / Status : Reviewed
- 1H and 13C-NMR assignments for sialylated oligosaccharide-alditols related to mucins. Study of thirteen components from hen ovomucin and swallow nest mucin. (1992 - Strecker G, Wieruszeski J, Cuvillier O, Michalski J, Montreuil J) / Status : Reviewed
- O-linked oligosaccharides of glycophorins A and B in erythrocytes of two individuals with the Tn polyagglutinability syndrome. (1992 - Blumenfeld O, Lalezari P, Khorshidi M, Puglia K, Fukuda M) / Status : Reviewed
- Altered O-glycan synthesis in lymphocytes from patients with Wiskott-Aldrich syndrome. (1991 - Piller F, Le Deist F, Weinberg K, Parkman R, Fukuda M) / Status : Reviewed
- The effect of the carbohydrate moiety upon the size and conformation of human plasma galactoglycoprotein as judged by electron microscopy and circular dichroism. Structural studies of a glycoprotein after stepwise enzymic carbohydrate removal. (1991 - Watzlawick H, Walsh M, Ehrhard I, Slayter H, Haupt H, Schwick H, Jourdian G, Hase S, Schmid K, Brossmer R) / Status : Reviewed
- Natural human interferon-alpha 2 is O-glycosylated. (1991 - Adolf G, Kalsner I, Ahorn H, Maurer-Fogy I, Cantell K) / Status : Reviewed
- Structure determination of the major N- and O-linked carbohydrate chains of the beta subunit from equine chorionic gonadotropin. (1990 - Damm J, Hard K, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Structures of acidic O-linked polylactosaminoglycans on human skim milk mucins. (1990 - Hanisch F, Peter-Katalinic J, Egge H, Dabrowski U, Uhlenbruck G) / Status : Reviewed
- Human transferrin receptor contains O-linked oligosaccharides. (1990 - Do S, Enns C, Cummings R) / Status : Reviewed
- Isolation and structural characterization of sialic-acid-containing glycopeptides of the O-glycosidic type from the urine of two patients with an hereditary deficiency in alpha-N-acetylgalactosaminidase activity. (1989 - Linden H, Klein R, Egge H, Peter-Katalinic J, Dabrowski J, Schindler D) / Status : Reviewed
- Expression of human interleukin-2 in recombinant baby hamster kidney, Ltk-, and Chinese hamster ovary cells. Structure of O-linked carbohydrate chains and their location within the polypeptide. (1989 - Conradt H, Nimtz M, Dittmar K, Lindenmaier W, Hoppe J, Hauser H) / Status : Reviewed
- Structures of O-glycosidically linked oligosaccharides isolated from human meconium glycoproteins. (1989 - Capon C, Leroy Y, Wieruszeski J, Ricart G, Strecker G, Montreuil J, Fournet B) / Status : Reviewed
- Primary structure of the major O-glycosidically linked carbohydrate unit of human von Willebrand factor. (1989 - Samor B, Michalski J, Mazurier C, Goudemand M, De Waard P, Vliegenthart J, Strecker G, Montreuil J) / Status : Reviewed
- O-linked oligosaccharides from human serum immunoglobulin A1. (1989 - Field M, Dwek R, Edge C, Rademacher T) / Status : Reviewed
- Structural studies on oncofetal carbohydrate antigens (Ca 19-9, Ca 50, and Ca 125) carried by O-linked sialyloligosaccharides on human amniotic mucins. (1988 - Hanisch F, Uhlenbruck G, Peter-Katalinic J, Egge H) / Status : Reviewed
- Human T-lymphocyte activation is associated with changes in O-glycan biosynthesis. (1988 - Piller F, Piller V, Fox R, Fukuda M) / Status : Reviewed
- The N- and O-linked carbohydrate chains of human, bovine and porcine plasminogen. Species specificity in relation to sialylation and fucosylation patterns. (1988 - Marti T, Schaller J, Rickli E, Schmid K, Kamerling J, Gerwig G, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structural analysis by fast-atom-bombardment mass spectrometry of the mixture of alditols derived from the O-linked oligosaccharides of murine glycophorins. (1988 - Krotkiewski H, Lisowska E, Angel A, Nilsson B) / Status : Reviewed
- Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women. (1988 - Amano J, Nishimura R, Mochizuki M, Kobata A) / Status : Reviewed
- Identification of a tetrasialylated monofucosylated tetraantennary N-linked carbohydrate chain in human platelet glycocalicin. (1988 - Korrel S, Clemetson K, van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
- Structural analysis of O-glycosidic type of sialyloligosaccharide-alditols derived from urinary glycopeptides of a sialidosis patient. (1988 - van Pelt J, Van Bilsen D, Kamerling J, Vliegenthart J) / Status : Reviewed
- Isolation of sialylcompounds from hemofiltrate of chronic uremic patients and identification by nuclear magnetic resonance. (1987 - Weisshaar G, Brunner H, Friebolin H, Baumann W, Mann H, Opferkuch H, Sieberth H) / Status : Reviewed
- [Sialic acid containing compounds in the hemofiltrate of patients with chronic renal insufficiency. II. Isolation and structure determination of sialoglycopeptides] (1987 - Weisshaar G, Baumann W, Friebolin H, Brunner H, Mann H, Sieberth H, Opferkuch H) / Status : Reviewed
- The structures of N- and O-glycosidic carbohydrate chains of a chondroitin sulfate proteoglycan isolated from the media of the human aorta. (1987 - Akiyama F, Stevens R, Hayashi S, Swann D, Binette J, Caterson B, Schmid K, Van Halbeek H, Mutsaers J, Gerwig G) / Status : Reviewed
- Structures of novel sialylated O-linked oligosaccharides isolated from human erythrocyte glycophorins. (1987 - Fukuda M, Lauffenburger M, Sasaki H, Rogers ME, Dell A) / Status : Reviewed
- Membrane glycophorins of Dantu blood group erythrocytes. (1987 - Blumenfeld O, Smith A, Moulds J) / Status : Reviewed
- The structure of the O-glycosidic oligosaccharide chains of the major Zajdela hepatoma ascites-cell-membrane glycoprotein. (1986 - Nato F, Goulut C, Bourrillon R, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structures of O-linked oligosaccharides isolated from normal granulocytes, chronic myelogenous leukemia cells, and acute myelogenous leukemia cells. (1986 - Fukuda M, Carlsson S, Klock J, Dell A) / Status : Reviewed
- Structural variations of O-linked oligosaccharides present in leukosialin isolated from erythroid, myeloid, and T-lymphoid cell lines. (1986 - Carlsson S, Sasaki H, Fukuda M) / Status : Reviewed
- Membrane glycophorins in Sta blood group erythrocytes. (1986 - Blumenfeld O, Adamany A, Kikuchi M, Sabo B, McCreary J) / Status : Reviewed
- Structures of O-linked oligosaccharides present in the proteoglycans secreted by human mammary epithelial cells. (1986 - Gowda D, Bhavanandan V, Davidson E) / Status : Reviewed
- Characterization of O-glycosidically linked oligosaccharides of rat erythrocyte membrane sialoglycoproteins. (1986 - Edge A, Van Langenhove A, Reinhold V, Weber P) / Status : Reviewed
- Structure determination of oligosaccharides isolated from Cad erythrocyte membranes by permethylation analysis and 500-MHz 1H-NMR spectroscopy. (1985 - Herkt F, Parente J, Leroy Y, Fournet B, Blanchard D, Cartron J, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Comparative study of glycophorin A derived O-glycans from human Cad, Sd(a+) and Sd(a-) erythrocytes. (1985 - Blanchard D, Capon C, Leroy Y, Cartron J, Fournet B) / Status : Reviewed
- Structural studies of O-glycosidic oligosaccharide units of dog erythrocyte glycophorin. (1985 - Yamashita T, Murayama J, Utsumi H, Hamada A) / Status : Reviewed
- Oligosaccharide chains of herpes simplex virus type 2 glycoprotein gG.2. (1985 - Serafini-Cessi F, Malagolini N, Dall'Olio F, Pereira L, Campadelli-Fiume G) / Status : Reviewed
- Structures of the major carbohydrates of natural human interleukin-2. (1985 - Conradt H, Geyer R, Hoppe J, Grotjahn L, Plessing A, Mohr H) / Status : Reviewed
- Structural studies on the O-linked carbohydrate chains of human platelet glycocalicin. (1984 - Korrel S, Clemetson K, Van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
- The structure of sialyl-glycopeptides of the O-glycosidic type, isolated from sialidosis (mucolipidosis I) urine. (1984 - Lecat D, Lemonnier M, Derappe C, Lhermitte M, van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
- The carbohydrates of mouse hepatitis virus (MHV) A59: structures of the O-glycosidically linked oligosaccharides of glycoprotein E1. (1984 - Niemann H, Geyer R, Klenk H, Linder D, Stirm S, Wirth M) / Status : Reviewed
- Glycoprotein E1 of MHV-A59: structure of the O-linked carbohydrates and construction of full length recombinant cDNA clones. (1984 - Niemann H, Heisterberg-Moutsis G, Geyer R, Klenk H, Wirth M) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- The structure of the carbohydrate units of human plasma galactoglycoprotein determined by 500-megahertz 1H NMR spectroscopy. (1984 - Akiyama K, Simons E, Bernasconi P, Schmid K, van Halbeek H, Vliegenthart J, Haupt H, Schwick H) / Status : Reviewed
- Characterization of a human lymphocyte surface sialoglycoprotein that is defective in Wiskott-Aldrich syndrome. (1984 - Remold-O'Donnell E, Kenney D, Parkman R, Cairns L, Savage B, Rosen F) / Status : Reviewed
- Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - Mellis S, Baenziger J) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Study of the carbohydrate moiety of human serum sex hormone-binding globulin. (1983 - Avvakumov G, Matveentseva I, Akhrem L, Strel'chyonok O, Akhrem A) / Status : Reviewed
- Purification of an alternate form of the alpha subunit of the glycoprotein hormones from bovine pituitaries and identification of its O-linked oligosaccharide. (1983 - Parsons T, Bloomfield G, Pierce J) / Status : Reviewed
- Isolation and structural characterization of five major sialyloligosaccharides and a sialylglycopeptide from normal human urine. (1983 - Parkkinen J, Finne J) / Status : Reviewed
- Structures of N-linked and O-linked oligosaccharides on proteoglycan monomer isolated from the Swarm rat chondrosarcoma. (1982 - Nilsson B, De Luca S, Lohmander S, Hascall V) / Status : Reviewed
- Glycoproteins and proteoglycans of the chromaffin granule matrix. (1982 - Kiang W-L, Krusius T, Finne J, Margolis RU, Margolis RK) / Status : Reviewed
- Amino acid and carbohydrate structural variants of glycoprotein products (M-N glycoproteins) of the M-N allelic locus. (1981 - Blumenfeld O, Adamany A, Puglia K) / Status : Reviewed
- The chemical structure of neutral and acidic sugar chains obtained from bovine colostrum kappa-casein. (1981 - Saito T, Itoh T, Adachi S, Suzuki T, Usui T) / Status : Reviewed
- Localization of the carbohydrate units in a human immunoglobulin light chain, protein Sm lambda. (1981 - Garver F, Chang L, Kiefer C, Mendicino J, Chandrasekaran E, Isobe T, Osserman E) / Status : Reviewed
- Structural characterization of a novel acidic oligosaccharide unit derived from cow colostrum kappa-casein. A 500 MHz 1H-NMR study. (1981 - van Halbeek H, Dorland L, Vliegenthart J, Fiat A, Jolls P) / Status : Reviewed
- Structures of sialylated O-glycosidically and N-glycosidically linked oligosaccharides in a monoclonal immunoglobulin light chain. (1981 - Chandrasekaran EV, Mendicino A, Garver FA, Mendicino J) / Status : Reviewed
- A 360-MHz 1H-NMR study of three oligosaccharides isolated from cow kappa-casein. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Fiat A, Jolles P) / Status : Reviewed
- The structures of the carbohydrate moieties of bovine blood coagulation factor X. (1980 - Mizuochi T, Yamashita K, Fujikawa K, Titani K, Kobata A) / Status : Reviewed
- Oligosaccharides on proteoglycans from the swarm rat chondrosarcoma. (1980 - Lohmander L, De Luca S, Nilsson B, Hascall V, Caputo C, Kimura J, Heinegard D) / Status : Reviewed
- Cow kappa-casein: structure of the carbohydrate portion. (1979 - Fournet B, Fiat A, Alais C, Jolls P) / Status : Reviewed
- Structure and location of the O-glycosidic carbohydrate units of human chorionic gonadotropin. (1979 - Kessler M, Mise T, Ghai R, Bahl O) / Status : Reviewed
- Carbohydrate of the human plasminogen variants. III. Structure of the O-glycosidically linked oligosaccharide unit. (1979 - Hayes M, Castellino F) / Status : Reviewed
- Characterization of the oligosaccharide side chain of apolipoprotein C-III from human plasma very low density lipoproteins. (1978 - Vaith P, Assmann G, Uhlenbruck G) / Status : Reviewed
- Structure of the O-glycosidically linked carbohydrate units of rat brain glycoproteins. (1975 - Finne J) / Status : Reviewed
- Structure of the O-glycosidically linked carbohydrate units of fetuin. (1974 - Spiro R, Bhoyroo V) / Status : Reviewed
- Structural studies on human erythrocyte glycoproteins. Alkali-labile oligosaccharides. (1969 - Thomas D, Winzler R) / Status : Reviewed
Reference
- A disintegrin and metalloproteinase with thrombospondin motifs 5 / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Thr-730
-
Apolipoprotein (a) / Homo sapiens
- Undefined site
- Apolipoprotein C-III / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
-
Chondroitin sulfate proteoglycan / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
- Chromogranin a / Homo sapiens
- Coagulation factor IX / Homo sapiens
-
Coagulation factor x / Homo sapiens
- Undefined site
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
- Ser-153
- Extracellular matrix protein 1 / Homo sapiens
- Fractalkine / Homo sapiens
-
Glycocalicin / Homo sapiens
- Undefined site
-
Glycophorin a and b / Homo sapiens
- Undefined site
-
Glycophorin a, b and c / Homo sapiens
- Undefined site
-
Glycophorin B Miltenberger subtype III / Homo sapiens
- Undefined site
-
Glycophorin-A / Homo sapiens
- Undefined site
- Thr-56
-
Gpl115 / Homo sapiens
- Undefined site
- Hepatocyte growth factor / Homo sapiens
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant delta / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy variable 4-39 / Homo sapiens
- Undefined site
- Immunoglobulin lambda-1 light chain / Homo sapiens
- Insulin-like growth factor II / Homo sapiens
- Insulin-like growth factor-binding protein 6 / Homo sapiens
-
Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Interferon alpha-2 / Homo sapiens
- Interleukin-2 / Homo sapiens
-
Leukosialin (cd43) / Homo sapiens
- Undefined site
-
Low-density lipoprotein receptor / Homo sapiens
- Undefined site
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
- Membrane protein FAM174A / Homo sapiens
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Mucin-1 / Homo sapiens
- Undefined site
- Ovochymase-1 / Homo sapiens
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
- Plasminogen / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Proheparin-binding EGF-like growth factor / Homo sapiens
- Protein YIPF3 / Homo sapiens
-
Proteoglycan / Homo sapiens
- Undefined site
- Proteoglycan 4 (lubricin) / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5actr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5btr / Homo sapiens
- Undefined site
- Semenogelin-2 / Homo sapiens
- Sex hormone-binding globulin / Homo sapiens
- Sparc-like protein 1 / Homo sapiens
-
Thrombopoietin / Homo sapiens
- Undefined site
- Transferrin receptor protein 1 / Homo sapiens
- Transmembrane protein C16orf54 / Homo sapiens
-
Tumor necrosis factor receptor superfamily member 16 / Homo sapiens
- Undefined site
- Tumor necrosis factor receptor superfamily member 1b (etanercept, enbrel) / Homo sapiens
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Transudate / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Urine glycopeptide / Homo sapiens
- Undefined site
- Versican core protein / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
- Alpha-2-hs-glycoprotein / Bos taurus
- Chromogranin a / Bos taurus
-
Coagulation factor x / Bos taurus
- Undefined site
- Glycoprotein hormones alpha chain / Bos taurus
-
Gp-3 / Bos taurus
- Undefined site
- Kappa casein / Bos taurus
- Plasminogen / Bos taurus
-
Uncharacterized protein / Bos taurus
- Undefined site
-
Glycophorin / Canis lupus familiaris
- Undefined site
-
Choriogonadotropin beta chain / Equus caballus
- Undefined site
-
Fetal antigen 1 / Mus musculus
- Undefined site
-
Glycophorin / Mus musculus
- Undefined site
-
Tenascin-r / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Dystroglycan / Ovis aries
- Undefined site
-
Major membrane glycoprotein - MII2 / Rattus norvegicus
- Undefined site
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
Sialoglycoprotein (rspg-4) / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Brain / Rattus norvegicus
- Undefined site
-
Uncharacterized proteoglycan / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
- Plasminogen / Sus scrofa
-
Kininogen / Salmo salar
- Undefined site
-
Salarin / Salmo salar
- Undefined site
-
Mucin / Collocalia sp
- Undefined site
-
gG-2 / Human herpes simplex virus 2
- Undefined site
-
E1 glycoprotein / Murine hepatitis virus (strain a59)
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus
- Undefined site
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus (gm1 mutant)
- Undefined site
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus (gm1.2 mutant)
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- PLTPEPPSGR (10aa)
- AGQPPTAAAAAQPR (14aa)
- EDQTSPAPGLR (11aa)
- AYDGLSLPEDIETVTASQMR (20aa)
- GLAAGTSNPDPPTVSTDQLLPLGGGR (26aa)
- PRTLPPLPPGPTPAQQPGR (19aa)
- DTYAATPR (8aa)
- DVSTPPTVLPDNFPR (15aa)
- ESKPQAGTARPQDVNR (16aa)
- SCDTPPPCPR (10aa)
- P01860 Thr-137     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-122     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-122     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-152     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-152     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-137     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-152     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-137     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-122     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- EAISPPDAASAAPLR (15aa)
- AQDGGPVGTELFR (13aa)
- VQPTESIVR (9aa)
- AVAVTLQSH (9aa)
- NHGVDDDGDDDGDDGGTDGPR (21aa)
- SQIQTPNPNQDQWSGQNAK (19aa)
- GQGEQGSTGGTNISSTSEPKEE (22aa)
- AVADTRDQADGSR (13aa)
- DQADGSRASVDSGSSEEQGGSSR (23aa)
- LGIQPTLGPPNQP (13aa)
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
- VLGPKDSK (8aa)
- APVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR (44aa)
- GVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR (38aa)
- GQDSTIAASEQQVAAR (16aa)
Mass spectrometry observed peptide
-
- N-Linked / No-core
(avg mass : 965.8685)
- Urine (UBERON_0001088)
- Aspartylglycosaminuria (DOID:0050461)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Chromaffin Granules (GO_0042583)
-
Uncharacterized protein / Bos taurus
- Undefined site
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Blood Serum (UBERON_0001977)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Pancreas (UBERON_0001264)
- CCRF-CEM (CVCL_0207) Lymphocyte (CL_0000542)
- Rat1 (CVCL_0492)
- Lymphocyte (CL_0000542)
- Erythroleukemia with associated Polycythemia
- Leukemia, Acute lymphoblastic (DOID:9952)
- Pancreatitis, Chronic (DOID:4989)
- O-linked olgiosaccharide on the 75-kDa neurotrophin receptor (1996 - Chapman, Eckart, Kaufman, Lapointe) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
- Variation of the glycosylation of human pancreatic bile-salt-dependent lipase. (1993 - Mas E, Abouakil N, Roudani S, Franc J, Montreuil J, Lombardo D) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- Characterization of a human lymphocyte surface sialoglycoprotein that is defective in Wiskott-Aldrich syndrome. (1984 - Remold-O'Donnell E, Kenney D, Parkman R, Cairns L, Savage B, Rosen F) / Status : Reviewed
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
-
Gpl115 / Homo sapiens
- Undefined site
-
Tumor necrosis factor receptor superfamily member 16 / Homo sapiens
- Undefined site
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus
- Undefined site
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus (gm1 mutant)
- Undefined site
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus (gm1.2 mutant)
- Undefined site
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Blood Plasma (UBERON_0001969)
- Colostrum (UBERON_0001914)
- Urine (UBERON_0001088)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Extended Sialylated O-Glycan Repertoire of Human Urinary Glycoproteins Discovered and Characterized Using Electron-Transfer/Higher-Energy Collision Dissociation (2019 - Zsuzsanna Darula, Ádám Pap, Katalin F. Medzihradszky) / Status : Reviewed
- Glycomic analysis of high density lipoprotein shows a highly sialylated particle (2014 - Huang J1, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Alpha-2-HS-glycoprotein / Homo sapiens
- Angiotensin-converting enzyme 2 / Homo sapiens
- Apolipoprotein C-III / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Membrane protein FAM174A / Homo sapiens
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- PRTLPPLPPGPTPAQQPGR (19aa)
- LGIQPTLGPPNQP (13aa)
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Zona Pellucida (UBERON_0000086)
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Structure of the O-glycosidically linked carbohydrate units of rat brain glycoproteins. (1975 - Finne J) / Status : Reviewed
- Structural studies on human erythrocyte glycoproteins. Alkali-labile oligosaccharides. (1969 - Thomas D, Winzler R) / Status : Reviewed
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Brain / Rattus norvegicus
- Undefined site
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Adenocarcinoma (DOID:299)
-
Mucin-1 / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Blood Serum (UBERON_0001977)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Chromaffin Granules (GO_0042583)
- Identification of protein O-glycosylation site and corresponding glycans using liquid chromatography-tandem mass spectrometry via mapping accurate mass and retention time shift (2014 - Huang LJ, Lin JH, Tsai JH, Chu YY, Chen YW, Chen SL, Chen SH) / Status : Reviewed
- Chromogranin A from bovine adrenal medulla: molecular characterization of glycosylations, phosphorylations, and sequence heterogeneities by mass spectrometry. (1999 - Bauer S, Zhang X, Van Dongen W, Claeys M, Przybylski M) / Status : Reviewed
- Hepatocyte growth factor is linked by O-glycosylated oligosaccharide on the alpha chain. (1992 - Shimizu N, Hara H, Sogabe T, Sakai H, Ihara I, Inoue H, Nakamura T, Shimizu S) / Status : Reviewed
- Coagulation factor IX / Homo sapiens
- Hepatocyte growth factor / Homo sapiens
- Tumor necrosis factor receptor superfamily member 1b (etanercept, enbrel) / Homo sapiens
- Alpha-2-hs-glycoprotein / Bos taurus
- Chromogranin a / Bos taurus
- Kappa casein / Bos taurus
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Blood Plasma (UBERON_0001969)
-
Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 965.8685)
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Amniotic Fluid (UBERON_0000173)
- Aorta (UBERON_0000947)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Bulbo-Urethral Gland (UBERON_0002366)
- Colonic Mucosa (UBERON_0000317) HT29-16E (CVCL_C763)
- Colostrum (UBERON_0001914)
- Connective Tissue (UBERON_0002384) LTK (CVCL_R978)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Liver (UBERON_0002107) Zajdela-Hepatoma (CVCL_1D00) Cell Surface (GO_0009986)
- Mammary Gland (UBERON_0001911) HBL-100 (CVCL_4362)
- Mammary Gland (UBERON_0001911) MDA-MB-231 (CVCL_0062)
- Mammary Gland (UBERON_0001911) MTSV1-7 (CVCL_8645)
- Mammary Gland (UBERON_0001911) T-47D (CVCL_0553)
- Mammary Gland (UBERON_0001911) ZR-75-1 (CVCL_0588)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DXB11 (CVCL_1977)
- Placenta (UBERON_0001987) BeWo (CVCL_0044) Epithelium (CL_0002577)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Skin of Body (UBERON_0002097)
- Synovial Fluid (UBERON_0001090)
- Thyroid (UBERON_0002046)
- Transudate (UBERON_0007779)
- Urine (UBERON_0001088)
- Zona Pellucida (UBERON_0000086)
- 17cl1 (CVCL_VT75) Fibroblast (CL_0000057)
- C10 (CVCL_5245)
- COLO 205 (CVCL_0218)
- COLO 320 (CVCL_1989)
- Co115 (CVCL_D102)
- DLD-1 (CVCL_0248)
- Eveline (CVCL_A1LI)
- HCT 116 (CVCL_0291)
- HCT 15 (CVCL_0292)
- HCT 8 (CVCL_2478)
- HEK293 (CVCL_0045)
- HT29 (CVCL_A8EZ)
- KM12 (CVCL_1331)
- LOVO (CVCL_0399)
- LS174T (CVCL_1384)
- LS180 (CVCL_0397)
- LS411N (CVCL_1385)
- RKO (CVCL_0504)
- SW1116 (CVCL_0544)
- SW1398 (CVCL_3885)
- SW1463 (CVCL_1718)
- SW48 (CVCL_1724)
- SW480 (CVCL_0546)
- SW620 (CVCL_0547)
- SW837 (CVCL_1729)
- SW948 (CVCL_0632)
- T84 (CVCL_0555)
- WiDr (CVCL_2760)
- Erythrocyte (CL_0000232)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Granulocyte (CL_0000094)
- Leukocyte (CL_0000738)
- Lymphocyte (CL_0000542)
- Neutrophil (CL_0000775)
- Platelet (CL_0000233) Plasma Membrane (GO_0005886)
- T-Lymphocyte (CL_0000084)
- Chromaffin Granules (GO_0042583)
- Plasma Membrane (GO_0005886)
- Very-Low-Density Lipoprotein Particle (GO_0034361)
- Adenocarcinoma (DOID:299)
- Arthritis, Rheumatoid (DOID:7148)
- Cancer, breast (DOID:1612)
- Carcinoid Tumor, with multiple liver metastasis
- Carcinoma, Hepatocellular (DOID:684)
- Cecum adenocarcinoma (DOID:3039)
- Chondrosarcoma (DOID:3371)
- Choriocarcinoma (DOID:3594)
- Colon adenocarcinoma (DOID:234)
- Colon carcinoma (DOID:1520)
- Colorectal carcinoma (DOID:0080199)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Dyscrasia, Plasma Cell (DOID:6536)
- Hybridoma
- Hyperlipoproteinemia, Familial Type V (DOID:1171)
- Kidney Failure, Chronic (DOID:784)
- Leukemia, Acute myelogenous (DOID:9119)
- Leukemia, Myloid, Chronic (DOID:8552)
- Lysosomal storage disease (DOID:3211)
- Mixed phenotype acute leukemia (DOID:9953)
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Osteoarthritis (DOID:8398)
- Rectal adenocarcinoma (DOID:1996)
- Sialidosis (Mucolipidosis I) (DOID:3343)
- Tn Polyagglutinability Syndrome (DOID:0080520)
- Wiskott-Aldrich Syndrome (DOID:9169)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Unreviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Site-specific analysis of the O-glycosylation of bovine fetuin by electron-transfer dissociation mass spectrometry (2014 - Windwarder M, Altmann F) / Status : Reviewed
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- Structural elucidation of the N- and O-glycans of human apolipoprotein(a): role of O-glycans in conferring protease resistance. (2001 - Garner B, Merry A, Royle L, Harvey D, Rudd P, Thillet J) / Status : Reviewed
- Glycosylation analysis of two cysteine proteinase inhibitors from Atlantic salmon skin: di-O-acetylated sialic acids are the major sialic acid species on N-glycans (2001 - Ylonen, Kalkkinen, Saarinen, Bogwald, Helin) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Impaired galactosylation of core 2 O-glycans in erythrocytes of beta1,4-galactosyltransferase knockout mice. (1999 - Kotani N, Asano M, Iwakura Y, Takasaki S) / Status : Reviewed
- The glycosylation and structure of human serum IgA1, Fab, and Fc regions and the role of N-glycosylation on Fc alpha receptor interactions. (1998 - Mattu T, Pleass R, Willis A, Kilian M, Wormald M, Lellouch A, Rudd P, Woof J, Dwek R) / Status : Reviewed
- Structural characterisation of N-linked and O-linked oligosaccharides derived from interferon-alpha2b and interferon-alpha14c produced by Sendai-virus-induced human peripheral blood leukocytes (1998 - Nyman, Kalkkinen, Tolo, Helin) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Phosphorylation and O-glycosylation sites of human chromogranin A (CGA79-439) from urine of patients with carcinoid tumors. (1998 - Gadroy P, Stridsberg M, Capon C, Michalski J, Strub J, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
- Structural determination of the O-linked sialyl oligosaccharides liberated from fetuin with endo-alpha-N-acetylgalactosaminidase-S by HPLC analysis and 600-MHz 1H-NMR spectroscopy. (1997 - Ishii-Karakasa I, Iwase H, Hotta K) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Comparison of O-linked carbohydrate chains in MUC-1 mucin from normal breast epithelial cell lines and breast carcinoma cell lines. Demonstration of simpler and fewer glycan chains in tumor cells. (1996 - Lloyd KO, Burchell J, Kudryashov V, Yin BW, Taylor-Papadimitriou J) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Sialylation and sulfation of the carbohydrate chains in respiratory mucins from a patient with cystic fibrosis. (1994 - Lo-Guidice J, Wieruszeski J, Lemoine J, Verbert A, Roussel P, Lamblin G) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- An improved approach to the analysis of the structure of small oligosaccharides of glycoproteins: application to the O-linked oligosaccharides from human glycophorin A. (1993 - Krotkiewski H, Lisowska E, Nilsson G, Grnberg G, Nilsson B) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1993 - Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A) / Status : Reviewed
- The carbohydrate chains of the beta subunit of human chorionic gonadotropin produced by the choriocarcinoma cell line BeWo. Novel O-linked and novel bisecting-GlcNAc-containing N-linked carbohydrates. (1992 - Hard K, Damm J, Spruijt M, Bergwerff A, Kamerling J, Van Dedem G, Vliegenthart J) / Status : Reviewed
- Oligosaccharide structures of mucins secreted by the human colonic cancer cell line CL.16E. (1992 - Capon C, Laboisse C, Wieruszeski J, Maoret J, Augeron C, Fournet B) / Status : Reviewed
- Analysis of glycoform of O-glycan from human myeloma immunoglobulin A1 by gas-phase hydrazinolysis following pyridylamination of oligosaccharides. (1992 - Iwase H, Ishii-Karakasa I, Fujii E, Hotta K, Hiki Y, Kobayashi Y) / Status : Reviewed
- 1H and 13C-NMR assignments for sialylated oligosaccharide-alditols related to mucins. Study of thirteen components from hen ovomucin and swallow nest mucin. (1992 - Strecker G, Wieruszeski J, Cuvillier O, Michalski J, Montreuil J) / Status : Reviewed
- O-linked oligosaccharides of glycophorins A and B in erythrocytes of two individuals with the Tn polyagglutinability syndrome. (1992 - Blumenfeld O, Lalezari P, Khorshidi M, Puglia K, Fukuda M) / Status : Reviewed
- Altered O-glycan synthesis in lymphocytes from patients with Wiskott-Aldrich syndrome. (1991 - Piller F, Le Deist F, Weinberg K, Parkman R, Fukuda M) / Status : Reviewed
- The effect of the carbohydrate moiety upon the size and conformation of human plasma galactoglycoprotein as judged by electron microscopy and circular dichroism. Structural studies of a glycoprotein after stepwise enzymic carbohydrate removal. (1991 - Watzlawick H, Walsh M, Ehrhard I, Slayter H, Haupt H, Schwick H, Jourdian G, Hase S, Schmid K, Brossmer R) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Structures of acidic O-linked polylactosaminoglycans on human skim milk mucins. (1990 - Hanisch F, Peter-Katalinic J, Egge H, Dabrowski U, Uhlenbruck G) / Status : Reviewed
- Structure determination of the major N- and O-linked carbohydrate chains of the beta subunit from equine chorionic gonadotropin. (1990 - Damm J, Hard K, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
- Isolation and structural characterization of sialic-acid-containing glycopeptides of the O-glycosidic type from the urine of two patients with an hereditary deficiency in alpha-N-acetylgalactosaminidase activity. (1989 - Linden H, Klein R, Egge H, Peter-Katalinic J, Dabrowski J, Schindler D) / Status : Reviewed
- O-linked oligosaccharides from human serum immunoglobulin A1. (1989 - Field M, Dwek R, Edge C, Rademacher T) / Status : Reviewed
- Expression of human interleukin-2 in recombinant baby hamster kidney, Ltk-, and Chinese hamster ovary cells. Structure of O-linked carbohydrate chains and their location within the polypeptide. (1989 - Conradt H, Nimtz M, Dittmar K, Lindenmaier W, Hoppe J, Hauser H) / Status : Reviewed
- Structures of O-glycosidically linked oligosaccharides isolated from human meconium glycoproteins. (1989 - Capon C, Leroy Y, Wieruszeski J, Ricart G, Strecker G, Montreuil J, Fournet B) / Status : Reviewed
- Primary structure of the major O-glycosidically linked carbohydrate unit of human von Willebrand factor. (1989 - Samor B, Michalski J, Mazurier C, Goudemand M, De Waard P, Vliegenthart J, Strecker G, Montreuil J) / Status : Reviewed
- Structural studies on oncofetal carbohydrate antigens (Ca 19-9, Ca 50, and Ca 125) carried by O-linked sialyloligosaccharides on human amniotic mucins. (1988 - Hanisch F, Uhlenbruck G, Peter-Katalinic J, Egge H) / Status : Reviewed
- Structural analysis by fast-atom-bombardment mass spectrometry of the mixture of alditols derived from the O-linked oligosaccharides of murine glycophorins. (1988 - Krotkiewski H, Lisowska E, Angel A, Nilsson B) / Status : Reviewed
- Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women. (1988 - Amano J, Nishimura R, Mochizuki M, Kobata A) / Status : Reviewed
- Human T-lymphocyte activation is associated with changes in O-glycan biosynthesis. (1988 - Piller F, Piller V, Fox R, Fukuda M) / Status : Reviewed
- The N- and O-linked carbohydrate chains of human, bovine and porcine plasminogen. Species specificity in relation to sialylation and fucosylation patterns. (1988 - Marti T, Schaller J, Rickli E, Schmid K, Kamerling J, Gerwig G, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Identification of a tetrasialylated monofucosylated tetraantennary N-linked carbohydrate chain in human platelet glycocalicin. (1988 - Korrel S, Clemetson K, van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
- Structural analysis of O-glycosidic type of sialyloligosaccharide-alditols derived from urinary glycopeptides of a sialidosis patient. (1988 - van Pelt J, Van Bilsen D, Kamerling J, Vliegenthart J) / Status : Reviewed
- Isolation of sialylcompounds from hemofiltrate of chronic uremic patients and identification by nuclear magnetic resonance. (1987 - Weisshaar G, Brunner H, Friebolin H, Baumann W, Mann H, Opferkuch H, Sieberth H) / Status : Reviewed
- [Sialic acid containing compounds in the hemofiltrate of patients with chronic renal insufficiency. II. Isolation and structure determination of sialoglycopeptides] (1987 - Weisshaar G, Baumann W, Friebolin H, Brunner H, Mann H, Sieberth H, Opferkuch H) / Status : Reviewed
- The structures of N- and O-glycosidic carbohydrate chains of a chondroitin sulfate proteoglycan isolated from the media of the human aorta. (1987 - Akiyama F, Stevens R, Hayashi S, Swann D, Binette J, Caterson B, Schmid K, Van Halbeek H, Mutsaers J, Gerwig G) / Status : Reviewed
- Structures of novel sialylated O-linked oligosaccharides isolated from human erythrocyte glycophorins. (1987 - Fukuda M, Lauffenburger M, Sasaki H, Rogers ME, Dell A) / Status : Reviewed
- Membrane glycophorins of Dantu blood group erythrocytes. (1987 - Blumenfeld O, Smith A, Moulds J) / Status : Reviewed
- Membrane glycophorins in Sta blood group erythrocytes. (1986 - Blumenfeld O, Adamany A, Kikuchi M, Sabo B, McCreary J) / Status : Reviewed
- Structures of O-linked oligosaccharides present in the proteoglycans secreted by human mammary epithelial cells. (1986 - Gowda D, Bhavanandan V, Davidson E) / Status : Reviewed
- The structure of the O-glycosidic oligosaccharide chains of the major Zajdela hepatoma ascites-cell-membrane glycoprotein. (1986 - Nato F, Goulut C, Bourrillon R, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Characterization of O-glycosidically linked oligosaccharides of rat erythrocyte membrane sialoglycoproteins. (1986 - Edge A, Van Langenhove A, Reinhold V, Weber P) / Status : Reviewed
- Structures of O-linked oligosaccharides isolated from normal granulocytes, chronic myelogenous leukemia cells, and acute myelogenous leukemia cells. (1986 - Fukuda M, Carlsson S, Klock J, Dell A) / Status : Reviewed
- Structural variations of O-linked oligosaccharides present in leukosialin isolated from erythroid, myeloid, and T-lymphoid cell lines. (1986 - Carlsson S, Sasaki H, Fukuda M) / Status : Reviewed
- Structure determination of oligosaccharides isolated from Cad erythrocyte membranes by permethylation analysis and 500-MHz 1H-NMR spectroscopy. (1985 - Herkt F, Parente J, Leroy Y, Fournet B, Blanchard D, Cartron J, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structures of the major carbohydrates of natural human interleukin-2. (1985 - Conradt H, Geyer R, Hoppe J, Grotjahn L, Plessing A, Mohr H) / Status : Reviewed
- Comparative study of glycophorin A derived O-glycans from human Cad, Sd(a+) and Sd(a-) erythrocytes. (1985 - Blanchard D, Capon C, Leroy Y, Cartron J, Fournet B) / Status : Reviewed
- Structural studies of O-glycosidic oligosaccharide units of dog erythrocyte glycophorin. (1985 - Yamashita T, Murayama J, Utsumi H, Hamada A) / Status : Reviewed
- Glycoprotein E1 of MHV-A59: structure of the O-linked carbohydrates and construction of full length recombinant cDNA clones. (1984 - Niemann H, Heisterberg-Moutsis G, Geyer R, Klenk H, Wirth M) / Status : Reviewed
- Structural studies on the O-linked carbohydrate chains of human platelet glycocalicin. (1984 - Korrel S, Clemetson K, Van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- The structure of the carbohydrate units of human plasma galactoglycoprotein determined by 500-megahertz 1H NMR spectroscopy. (1984 - Akiyama K, Simons E, Bernasconi P, Schmid K, van Halbeek H, Vliegenthart J, Haupt H, Schwick H) / Status : Reviewed
- The structure of sialyl-glycopeptides of the O-glycosidic type, isolated from sialidosis (mucolipidosis I) urine. (1984 - Lecat D, Lemonnier M, Derappe C, Lhermitte M, van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
- The carbohydrates of mouse hepatitis virus (MHV) A59: structures of the O-glycosidically linked oligosaccharides of glycoprotein E1. (1984 - Niemann H, Geyer R, Klenk H, Linder D, Stirm S, Wirth M) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Study of the carbohydrate moiety of human serum sex hormone-binding globulin. (1983 - Avvakumov G, Matveentseva I, Akhrem L, Strel'chyonok O, Akhrem A) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - Mellis S, Baenziger J) / Status : Reviewed
- Isolation and structural characterization of five major sialyloligosaccharides and a sialylglycopeptide from normal human urine. (1983 - Parkkinen J, Finne J) / Status : Reviewed
- Glycoproteins and proteoglycans of the chromaffin granule matrix. (1982 - Kiang W-L, Krusius T, Finne J, Margolis RU, Margolis RK) / Status : Reviewed
- Structures of N-linked and O-linked oligosaccharides on proteoglycan monomer isolated from the Swarm rat chondrosarcoma. (1982 - Nilsson B, De Luca S, Lohmander S, Hascall V) / Status : Reviewed
- Amino acid and carbohydrate structural variants of glycoprotein products (M-N glycoproteins) of the M-N allelic locus. (1981 - Blumenfeld O, Adamany A, Puglia K) / Status : Reviewed
- The chemical structure of neutral and acidic sugar chains obtained from bovine colostrum kappa-casein. (1981 - Saito T, Itoh T, Adachi S, Suzuki T, Usui T) / Status : Reviewed
- Structural characterization of a novel acidic oligosaccharide unit derived from cow colostrum kappa-casein. A 500 MHz 1H-NMR study. (1981 - van Halbeek H, Dorland L, Vliegenthart J, Fiat A, Jolls P) / Status : Reviewed
- Structures of sialylated O-glycosidically and N-glycosidically linked oligosaccharides in a monoclonal immunoglobulin light chain. (1981 - Chandrasekaran EV, Mendicino A, Garver FA, Mendicino J) / Status : Reviewed
- Localization of the carbohydrate units in a human immunoglobulin light chain, protein Sm lambda. (1981 - Garver F, Chang L, Kiefer C, Mendicino J, Chandrasekaran E, Isobe T, Osserman E) / Status : Reviewed
- The structures of the carbohydrate moieties of bovine blood coagulation factor X. (1980 - Mizuochi T, Yamashita K, Fujikawa K, Titani K, Kobata A) / Status : Reviewed
- A 360-MHz 1H-NMR study of three oligosaccharides isolated from cow kappa-casein. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Fiat A, Jolles P) / Status : Reviewed
- Oligosaccharides on proteoglycans from the swarm rat chondrosarcoma. (1980 - Lohmander L, De Luca S, Nilsson B, Hascall V, Caputo C, Kimura J, Heinegard D) / Status : Reviewed
- Cow kappa-casein: structure of the carbohydrate portion. (1979 - Fournet B, Fiat A, Alais C, Jolls P) / Status : Reviewed
- Structure and location of the O-glycosidic carbohydrate units of human chorionic gonadotropin. (1979 - Kessler M, Mise T, Ghai R, Bahl O) / Status : Reviewed
- Carbohydrate of the human plasminogen variants. III. Structure of the O-glycosidically linked oligosaccharide unit. (1979 - Hayes M, Castellino F) / Status : Reviewed
- Characterization of the oligosaccharide side chain of apolipoprotein C-III from human plasma very low density lipoproteins. (1978 - Vaith P, Assmann G, Uhlenbruck G) / Status : Reviewed
- Structure of the O-glycosidically linked carbohydrate units of fetuin. (1974 - Spiro R, Bhoyroo V) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Apolipoprotein (a) / Homo sapiens
- Undefined site
- Apolipoprotein C-III / Homo sapiens
-
Chondroitin sulfate proteoglycan / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
- Chromogranin a / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
-
Glycocalicin / Homo sapiens
- Undefined site
-
Glycophorin a and b / Homo sapiens
- Undefined site
-
Glycophorin a, b and c / Homo sapiens
- Undefined site
-
Glycophorin B Miltenberger subtype III / Homo sapiens
- Undefined site
-
Glycophorin-A / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant delta / Homo sapiens
-
Immunoglobulin heavy variable 4-39 / Homo sapiens
- Undefined site
- Immunoglobulin lambda-1 light chain / Homo sapiens
- Interferon alpha-2 / Homo sapiens
- Interleukin-2 / Homo sapiens
-
Leukosialin (cd43) / Homo sapiens
- Undefined site
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Mucin-1 / Homo sapiens
- Undefined site
- Plasminogen / Homo sapiens
-
Proteoglycan / Homo sapiens
- Undefined site
- Proteoglycan 4 (lubricin) / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Sex hormone-binding globulin / Homo sapiens
-
Thrombopoietin / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Transudate / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Urine glycopeptide / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
- Alpha-2-hs-glycoprotein / Bos taurus
-
Coagulation factor x / Bos taurus
- Undefined site
-
Gp-3 / Bos taurus
- Undefined site
-
Kappa casein / Bos taurus
- Undefined site
- Plasminogen / Bos taurus
-
Uncharacterized protein / Bos taurus
- Undefined site
-
Glycophorin / Canis lupus familiaris
- Undefined site
-
Choriogonadotropin beta chain / Equus caballus
- Undefined site
-
Fetal antigen 1 / Mus musculus
- Undefined site
-
Glycophorin / Mus musculus
- Undefined site
-
Tenascin-r / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Major membrane glycoprotein - MII2 / Rattus norvegicus
- Undefined site
-
Sialoglycoprotein (rspg-4) / Rattus norvegicus
- Undefined site
-
Uncharacterized proteoglycan / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
- Plasminogen / Sus scrofa
-
Kininogen / Salmo salar
- Undefined site
-
Salarin / Salmo salar
- Undefined site
-
Mucin / Collocalia sp
- Undefined site
-
E1 glycoprotein / Murine hepatitis virus (strain a59)
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Blood Plasma (UBERON_0001969)
- Colon (UBERON_0001155) Caco-2 (CVCL_0025)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Adenocarcinoma (DOID:299)
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- In vivo glycosylation of mucin tandem repeats (2001 - Silverman, Parry, Sutton-Smith, Burdick, McDermott, Reid, Batra, Morris, Hollingsworth, Dell, Harris) / Status : Reviewed
- Posttranslational modifications of human inter-alpha-inhibitor: identification of glycans and disulfide bridges in heavy chains 1 and 2. (1998 - Olsen E, Rahbek-Nielsen H, Thogersen I, Roepstorff P, Enghild J) / Status : Reviewed
-
Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5actr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5btr / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Erythropoietin / Homo sapiens
- EAISPPDAASAAPLR (15aa)
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- SCDTPPPCPR (10aa)
- P01860 Thr-137     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-122     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-122     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-152     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-152     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-137     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-152     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-137     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-122     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
-
- O-Linked / No-core
(avg mass : 965.8685)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Adenocarcinoma (DOID:299)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 965.8685)
- Brain (UBERON_0000955)
-
Dystroglycan / Ovis aries
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 965.8685)
- Adenohypophysis (UBERON_0002196)
- Blood Plasma (UBERON_0001969)
- Placenta (UBERON_0001987)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Skin of Body (UBERON_0002097) A-431 (CVCL_0037) Fibroblast (CL_0000057)
- Leukocyte (CL_0000738)
- Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995 - Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K) / Status : Reviewed
- Identification of the O-linked glycosylation site of the human transferrin receptor. (1992 - Hayes G, Enns C, Lucas J) / Status : Reviewed
- Natural human interferon-alpha 2 is O-glycosylated. (1991 - Adolf G, Kalsner I, Ahorn H, Maurer-Fogy I, Cantell K) / Status : Reviewed
- Human transferrin receptor contains O-linked oligosaccharides. (1990 - Do S, Enns C, Cummings R) / Status : Reviewed
- Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
- Purification of an alternate form of the alpha subunit of the glycoprotein hormones from bovine pituitaries and identification of its O-linked oligosaccharide. (1983 - Parsons T, Bloomfield G, Pierce J) / Status : Reviewed
-
Coagulation factor x / Homo sapiens
- Undefined site
- Interferon alpha-2 / Homo sapiens
-
Low-density lipoprotein receptor / Homo sapiens
- Undefined site
- Transferrin receptor protein 1 / Homo sapiens
- Glycoprotein hormones alpha chain / Bos taurus
-
- O-Linked / Undefined core
(avg mass : 965.8685)
- Adenocarcinoma (DOID:299)
-
gG-2 / Human herpes simplex virus 2
- Undefined site
-
- Hex:1 HexNAc:1 NeuAc:2 / O-Linked
(avg mass : 965.8685)
- Blood (UBERON_0000178)
- Blood Serum (UBERON_0001977)
- Milk (UBERON_0001913)
- Urine (UBERON_0001088)
- HEK293 (CVCL_0045)
- O-Linked / Core 1 / Gal(b1-3)[NeuAc(a2-8)NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc+"+ 2 x NeuAc"
- O-Linked / Core 1 / Neu5Ac(?2-?)Gal(b1-3)[Neu5Ac(?2-?)]GalNAc(a1-
- O-Linked / Core 1 / NeuAc(?2-3)Gal(?1-3)[NeuAc(?2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(?2-3)Gal(b1-3)[NeuAc(?2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(?2-6)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(?2-?)Gal(?1-?)[NeuAc(?2-?)]GalNAc
- O-Linked / Core 1 / NeuAc(?2-?)Gal(b1-3)GalNAc+"+ NeuAc(?2-?)"
- O-Linked / Core 1 / NeuAc(?2-?)Hex(?1-?)[NeuAc(?2-?)]HexNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(a2-?)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / Structure 9332
- O-Linked / Core 1 / Structure 10127
- O-Linked / No-core / NeuAc(?2-?)Gal(?1-3)[NeuAc(?2-6)]GalNAc
- O-Linked / Undefined core / Gal(?1-3)GalNAc+"+ 2 x NeuAc"
- O-Linked / Undefined core / Gal(?1-?)GalNAc+"+ 2 x NeuAc"
- O-Linked / Undefined core / Gal(b1-?)GalNAc+"+ 2 x NeuAc"
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- A disintegrin and metalloproteinase with thrombospondin motifs 5 / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Fractalkine / Homo sapiens
- Glycophorin-A / Homo sapiens
- Insulin-like growth factor II / Homo sapiens
- Insulin-like growth factor-binding protein 6 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Ovochymase-1 / Homo sapiens
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Proheparin-binding EGF-like growth factor / Homo sapiens
- Protein YIPF3 / Homo sapiens
- Semenogelin-2 / Homo sapiens
- Sparc-like protein 1 / Homo sapiens
- Transmembrane protein C16orf54 / Homo sapiens
- Versican core protein / Homo sapiens
- Alpha-2-hs-glycoprotein / Bos taurus
- Kappa casein / Bos taurus
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- PLTPEPPSGR (10aa)
- AGQPPTAAAAAQPR (14aa)
- EDQTSPAPGLR (11aa)
- AYDGLSLPEDIETVTASQMR (20aa)
- GLAAGTSNPDPPTVSTDQLLPLGGGR (26aa)
- DTYAATPR (8aa)
- DVSTPPTVLPDNFPR (15aa)
- ESKPQAGTARPQDVNR (16aa)
- AQDGGPVGTELFR (13aa)
- VQPTESIVR (9aa)
- AVAVTLQSH (9aa)
- NHGVDDDGDDDGDDGGTDGPR (21aa)
- SQIQTPNPNQDQWSGQNAK (19aa)
- GQGEQGSTGGTNISSTSEPKEE (22aa)
- AVADTRDQADGSR (13aa)
- DQADGSRASVDSGSSEEQGGSSR (23aa)
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
- VLGPKDSK (8aa)
- APVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR (44aa)
- GVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR (38aa)
- GQDSTIAASEQQVAAR (16aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:1 HexNAc:1 NeuAc:2 / O-Linked
(avg mass : 965.8685)
Disease
Reported glycosite
- O-Linked / Undefined core
(avg mass : 965.8685)
Source
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 965.8685)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 965.8685)
Source
Disease
Reported glycosite
- O-Linked / No-core
(avg mass : 965.8685)
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / Core 1
(avg mass : 965.8685)
Source
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / Core 1
(avg mass : 965.8685)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Reported glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Source
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / Core 1
(avg mass : 965.8685)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 965.8685)