Hex:4 HexNAc:3

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Sus scrofa (Pig)
• Rana pipiens (Northern leopard frog)
• Nicotiana alata (Persian tobacco)
• Nicotiana tabacum (Common tobacco)
• Gallus gallus (Chicken)
• Apis mellifera (Honeybee)
• Drosophila melanogaster (Fruit fly)
• Trypanosoma brucei brucei
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Alkaline phosphatase, intestinal / Homo sapiens    P09923
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Aminopeptidase n / Homo sapiens    P15144
• Apolipoprotein B-100 / Homo sapiens    P04114
• Apolipoprotein D / Homo sapiens    P05090
• Calreticulin / Homo sapiens    P27797
• Calumenin / Homo sapiens    O43852
• Cap-gly domain-containinglinker protein 1 / Homo sapiens    P30622
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Cathepsin D / Homo sapiens    P07339
• Choriogonadotropin - alpha and beta chains / Homo sapiens    P01215    P0DN86
• Choriogonadotropin beta chain / Homo sapiens    P0DN86
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 / Homo sapiens    Q16842
• Coagulation factor V / Homo sapiens    P12259
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Complement c3 / Homo sapiens    P01024
• Decorin / Homo sapiens    P07585
• Endoplasmin / Homo sapiens    P14625
• Extracellular calcium-sensing receptor / Homo sapiens    P41180
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Fibroleukin / Homo sapiens    Q14314
• Fibronectin / Homo sapiens    P02751
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Golgin subfamily a member 4 / Homo sapiens    Q13439
• Haptoglobin / Homo sapiens    P00738
• Immunoglobulin alpha (non secretory) / Homo sapiens    P01877    P01876
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin gamma-1 heavy chain / Homo sapiens    P0DOX5
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens    Q8TDY8
• Integrin alpha-M / Homo sapiens    P11215
• Interferon gamma / Homo sapiens    P01579
• Interferon-gamma receptor alpha chain / Homo sapiens    P15260
• Lactotransferrin / Homo sapiens    P02788
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Periostin / Homo sapiens    Q15063
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Protein CREG1 / Homo sapiens    O75629
• Putative protein FAM10A5 / Homo sapiens    Q8NFI4
• Rhodopsin / Homo sapiens    P08100
• Sciellin / Homo sapiens    O95171
• Serotransferrin / Homo sapiens    P02787
• Serum paraoxonase/arylesterase 1 / Homo sapiens    P27169
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Translocon-associated protein subunit beta / Homo sapiens    P43308
• Transmembrane protein 106B / Homo sapiens    Q9NUM4
• Uncharacterized protein from Meconium / Homo sapiens    
• Vascular endothelial growth factor receptor 1 / Homo sapiens    P17948
• Von willebrand factor / Homo sapiens    P04275
• Glycophorin / Bos taurus    
• Lactotransferrin / Bos taurus    P24627
• Rhodopsin / Bos taurus    P02699
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus    
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus    Q64676
• Cadherin-13 / Mus musculus    Q9WTR5
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus    
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Laminin subunit gamma-1 / Mus musculus    P02468
• Nectin-1 / Mus musculus    Q9JKF6
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neuroplastin / Mus musculus    P97300
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Roundabout homolog 2 / Mus musculus    Q7TPD3
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Amiloride-sensitive amine oxidase / Sus scrofa    Q9TRC7
• Rhodopsin / Rana pipiens    P31355
• Ribonuclease s-6 / Nicotiana alata    Q40379
• Uncharacterized protein / Nicotiana tabacum    
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein / Gallus gallus    
• Uncharacterized protein from Royal Jelly / Apis mellifera    
• Uncharacterized protein / Trypanosoma brucei brucei    
• Uncharacterized protein / Trypanosoma brucei brucei    
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amnion (UBERON_0000305)   FL (CVCL_1905)  
• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Embryo (UBERON_0000922)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Meconium (UBERON_0007109)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   IM4/V/IV-G1 (CVCL_VT68)  
• Ovary (UBERON_0000992)   IM4/V/IV-G2 (CVCL_VT69)  
• Ovary (UBERON_0000992)   IM4/V/IV-G3 (CVCL_VT70)  
• Ovary (UBERON_0000992)   IM4/V/IV-G4 (CVCL_VT71)  
• Ovary (UBERON_0000992)   IM4/V/IV-G5 (CVCL_VT72)  
• Ovary (UBERON_0000992)   Sf9 (CVCL_0549)  
• Pituitary Gland (UBERON_0000007)  
• Placenta (UBERON_0001987)   JEG-3 (CVCL_0363)   Epithelium (CL_0002577)  
• Placenta (UBERON_0001987)  
• Retina (UBERON_0000966)  
• Royal Jelly  
• Seminal Fluid (UBERON_0006530)  
• Spleen (UBERON_0002106)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• BTI-Tn-5B1-4 (CVCL_C190)  
• FreeStyle 293-F (CVCL_D603)  
• LS174T (CVCL_1384)  
• NS0 (CVCL_3940)  
• P3X63Ag8U.1 (CVCL_3412)  
• SPC-Mb-92-C6 (CVCL_VT62)  
• Delipidated Cell  
• Egg Cell  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  
• Style (BTO_0001313)  

Reported structure

• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 1994
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 9563
• N-Linked / Complex / Structure 9831
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-4)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Structure 9536
• N-Linked / Hybrid / Structure 9775
• N-Linked / Hybrid / Structure 9864
• N-Linked / Hybrid / Structure 10027
• N-Linked / Hybrid / Structure 10263
• N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)Man(b1-4)GlcNAc
• N-Linked / Undefined core / Man(?1-3)Man(?1-3)Man(?1-3)Man(?1-?)GlcNAc(?1-?)GlcNAc(?1-?)GlcNAc
• O-Linked / Undefined core / Gal(?1-3)Gal(?1-4)GlcNAc(b1-3)Gal(?1-4)GlcNAc(b1-3)Gal(?1-3)GalNAc

Composition

• Hex:4 HexNAc:3 (avg mass : 1276.1699 )

Disease

• Cancer, breast (DOID:1612)
• Choriocarcinoma (DOID:3594)
• Choriocarcinoma, with Hyperthyroidism
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Diabetes Mellitus (DOID:9351)
• Gangliosidosis GM1 (DOID:3322)
• Gastritis (DOID:4029)
• Gaucher Disease (DOID:1926)
• Heavy Chain Disease (DOID:0060125)
• Hydatidiform Mole (DOID:3590)
• Hydatidiform Mole, Invasive (DOID:3590)
• Hypersensitivity reaction disease (DOID:0060056)
• Myeloma (DOID:0070004)
• Myeloma, Multiple (DOID:9538)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Plasmacytoma (Mouse) (DOID:3721)

Reference

• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
• Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
• The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
• Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
• Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
• N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
• Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
• N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
• Stable expression of human beta1,4-galactosyltransferase in plant cells modifies N-linked glycosylation patterns. (1999 - Palacpac N, Yoshida S, Sakai H, Kimura Y, Fujiyama K, Yoshida T, Seki T) / Status : Reviewed
• Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
• Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
• First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
• Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
• Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
• Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
• Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
• Characterization of a novel type of chain-terminator Gal beta 1-6Gal beta 1-4)GlcNAc in an oligosaccharide related to N-glycosylated protein glycans isolated from GM1 the urine of patients with gangliosidosis. (1991 - Michalski J, Lemoine J, Wieruszeski J, Fournet B, Montreuil J, Strecker G) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
• Isolation and structural studies of the neutral oligosaccharide units from bovine glycophorin. (1981 - Fukuda K, Tomita M, Hamada A) / Status : Reviewed
• Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed
• Investigations on the oligosaccharide units of an A myeloma globulin. (1968 - Dawson G, Clamp JR) / Status : Reviewed

Reported glycosite

• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-922
• Alkaline phosphatase, intestinal / Homo sapiens
  •        Undefined site
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-503
• Aminopeptidase n / Homo sapiens
  •        Asn-128
• Apolipoprotein B-100 / Homo sapiens
  •        Asn-3411
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Calreticulin / Homo sapiens
  •        Asn-344
• Calumenin / Homo sapiens
  •        Asn-131
• Cap-gly domain-containinglinker protein 1 / Homo sapiens
  •        Asn-971
  •        Asn-1263
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Cathepsin D / Homo sapiens
  •        Asn-263
• Choriogonadotropin - alpha and beta chains / Homo sapiens
  •        Undefined site
• Choriogonadotropin beta chain / Homo sapiens
  •        Undefined site
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 / Homo sapiens
  •        Asn-211
• Coagulation factor V / Homo sapiens
  •        Asn-297
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
• Complement c3 / Homo sapiens
  •        Asn-85
• Decorin / Homo sapiens
  •        Asn-211
• Endoplasmin / Homo sapiens
  •        Asn-62
• Extracellular calcium-sensing receptor / Homo sapiens
  •        Asn-446
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-530
• Fibroleukin / Homo sapiens
  •        Asn-263
• Fibronectin / Homo sapiens
  •        Asn-542
  •        Asn-1236
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Undefined site
• Golgin subfamily a member 4 / Homo sapiens
  •        Asn-585
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-207
• Immunoglobulin alpha (non secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-1 heavy chain / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-327
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Undefined site
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-279
  •        Asn-440
• Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
  •        Asn-483
• Integrin alpha-M / Homo sapiens
  •        Asn-900
• Interferon gamma / Homo sapiens
  •        Undefined site
• Interferon-gamma receptor alpha chain / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-378
  •        Asn-1366
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-275
  •        Asn-356
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2007
  •        Asn-2500
• Periostin / Homo sapiens
  •        Asn-599
• Plexin-B2 / Homo sapiens
  •        Asn-528
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-90
  •        Asn-499
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Protein CREG1 / Homo sapiens
  •        Asn-216
• Putative protein FAM10A5 / Homo sapiens
  •        Asn-344
• Rhodopsin / Homo sapiens
  •        Undefined site
• Sciellin / Homo sapiens
  •        Asn-562
• Serotransferrin / Homo sapiens
  •        Undefined site
• Serum paraoxonase/arylesterase 1 / Homo sapiens
  •        Asn-253
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Transferrin receptor protein 1 / Homo sapiens
  •        Undefined site
• Translocon-associated protein subunit beta / Homo sapiens
  •        Asn-104
• Transmembrane protein 106B / Homo sapiens
  •        Asn-256
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Vascular endothelial growth factor receptor 1 / Homo sapiens
  •        Asn-625
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Glycophorin / Bos taurus
  •        Undefined site
• Lactotransferrin / Bos taurus
  •        Asn-564
• Rhodopsin / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-153
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
  •        Asn-442
• Cadherin-13 / Mus musculus
  •        Asn-671
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-258
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
  •        Undefined site
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-580
  •        Asn-968
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
• Nectin-1 / Mus musculus
  •        Asn-202
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Neuroplastin / Mus musculus
  •        Asn-228
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-240
  •        Asn-2128
• Roundabout homolog 2 / Mus musculus
  •        Asn-793
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-92
  •        Asn-168
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-153
  •        Asn-197
• Amiloride-sensitive amine oxidase / Sus scrofa
  •        Undefined site
• Rhodopsin / Rana pipiens
  •        Asn-2
  •        Asn-15
• Ribonuclease s-6 / Nicotiana alata
  •        Undefined site
• Uncharacterized protein / Nicotiana tabacum
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Royal Jelly / Apis mellifera
  •        Undefined site
• Uncharacterized protein / Trypanosoma brucei brucei
  •        Undefined site
• Uncharacterized protein / Trypanosoma brucei brucei
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-165
  •        Asn-343
  •        Asn-615
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-282
  •        Asn-331
  •        Asn-602
  •        Asn-615
  •        Asn-709
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FSNVTW (6aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TDDEVVQREEEAIQIDGINASQIR (24aa)
  •    P14625    Asn-62     Endoplasmin / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTK (13aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HAIHVSGTNGTK (12aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTKR (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TNHMGNVTFTIPANR (15aa)
  •    P01024    Asn-85     Complement c3 / Homo sapiens
• TVLTPATNHMGNVTFTIPANR (21aa)
  •    P01024    Asn-85     Complement c3 / Homo sapiens
• TVITPATNHMGNVTFTIPANR (21aa)
  •    P01024    Asn-85     Complement c3 / Homo sapiens
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92     Signal-regulatory protein alpha / Mus musculus
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
  •    P43308    Asn-104     Translocon-associated protein subunit beta / Homo sapiens
• LIVNNATNVVIK (12aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KINYTISQGHR (11aa)
  •    P15144    Asn-128     Aminopeptidase n / Homo sapiens
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• RACQFNR (7aa)
  •    P14231    Asn-153     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• ACQFNR (6aa)
  •    P14231    Asn-153     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• SSANNCTF (8aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SSANNCTFEY (10aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VNFTCK (6aa)
  •    P97797    Asn-168     Signal-regulatory protein alpha / Mus musculus
• VINFYAGANQSMNVTCVGKR (20aa)
  •    P14231    Asn-197     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• VINFYAGANQSMNVTCVGK (19aa)
  •    P14231    Asn-197     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• NPNGTVTVISR (11aa)
  •    Q9JKF6    Asn-202     Nectin-1 / Mus musculus
• PANVSFVLVPFK (12aa)
  •    Q16842    Asn-211     CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 / Homo sapiens
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• IVTPEEYYNVTV (12aa)
  •    O75629    Asn-216     Protein CREG1 / Homo sapiens
• ANATIEVK (8aa)
  •    P97300    Asn-228     Neuroplastin / Mus musculus
• QTTAMDFSYANETVCWVHVGDSAAQTQLK (29aa)
  •    Q91ZX7    Asn-240     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• HANWTLTPLK (10aa)
  •    P27169    Asn-253     Serum paraoxonase/arylesterase 1 / Homo sapiens
• YQYVDCGRNTT (11aa)
  •    Q9NUM4    Asn-256     Transmembrane protein 106B / Homo sapiens
• LAYATINDSR (10aa)
  •    Q9Z218    Asn-258     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• GSLSYLNVTRK (11aa)
  •    P07339    Asn-263     Cathepsin D / Homo sapiens
• IDGSTNFTR (9aa)
  •    Q14314    Asn-263     Fibroleukin / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• SHPNATFSAVGE (12aa)
  •    P01871    Asn-279     Immunoglobulin heavy constant mu / Homo sapiens
• KYNENGTIT (9aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VIYQNHNK (8aa)
  •    P11627    Asn-293     Neural cell adhesion molecule L1 / Mus musculus
• VSAITLVSATSTTANMTVGPEGK (23aa)
  •    P12259    Asn-297     Coagulation factor V / Homo sapiens
• MAGKPTHINVSVVMAEADGTCY (22aa)
  •    P01877    Asn-327     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330     Thrombospondin-2 / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
  •    P27797    Asn-344     Calreticulin / Homo sapiens
• ALAAMQDPEVMVAFQDVAQNPANMSK (26aa)
  •    Q8NFI4    Asn-344     Putative protein FAM10A5 / Homo sapiens
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• GNTTTLISENGHAADTLTATNFR (23aa)
  •    Q14766    Asn-378     Latent transforming growth factor beta binding protein 1 / Homo sapiens
• STGKPTLYNVSLVMSDTAGTCY (22aa)
  •    P01871    Asn-440     Immunoglobulin heavy constant mu / Homo sapiens
• LSEIHKDQPGHPVNR (15aa)
  •    Q64676    Asn-442     2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
• FTNGSCADIK (10aa)
  •    P41180    Asn-446     Extracellular calcium-sensing receptor / Homo sapiens
• GMDNVEYQFAVNNDTTELQVR (21aa)
  •    Q8TDY8    Asn-483     Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• SCVAVTSAQPQNMSR (15aa)
  •    O15031    Asn-528     Plexin-B2 / Homo sapiens
• GQGEQGSTGGTNISSTSEPKEE (22aa)
  •    Q16610    Asn-530     Extracellular matrix protein 1 / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• NGSSNTGAK (9aa)
  •    O95171    Asn-562     Sciellin / Homo sapiens
• YIDKGNR (7aa)
  •    O08532-4    Asn-580     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• GGVSVITPGTNTSNQVAVLY (20aa)
  •    P0DTC2    Asn-602     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VITPGTNTS (9aa)
  •    P0DTC2    Asn-602     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QDVNCTEVPVAIHADQL (17aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ANYNLPIMVTDSGKPPMTNITDLR (24aa)
  •    Q9WTR5    Asn-671     Cadherin-13 / Mus musculus
• YSNNSIA (7aa)
  •    P0DTC2    Asn-709     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTIS (5aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHINK (5aa)
  •    Q7TPD3    Asn-793     Roundabout homolog 2 / Mus musculus
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NVTAQICIDK (10aa)
  •    P12109    Asn-804     Collagen alpha-1(VI) chain / Homo sapiens
• ANVTSENNMPR (11aa)
  •    P11215    Asn-900     Integrin alpha-M / Homo sapiens
• GVVTDEQGIPIANATISVSGINHGVK (26aa)
  •    Q8IUX7    Asn-922     Adipocyte enhancer-binding protein 1 / Homo sapiens
• QSCITEQTQYFFKNDTK (17aa)
  •    O08532-4    Asn-968     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HVTYVPAQEKNF (12aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWF (12aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VSNGTHW (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VSNGTHWF (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105     Laminin subunit gamma-1 / Mus musculus
• KYFKNHTS (8aa)
  •    P0DTC2    Asn-1159     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1159     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236     Fibronectin / Homo sapiens
• CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
  •    Q14766    Asn-1366     Latent transforming growth factor beta binding protein 1 / Homo sapiens
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763     Collagen alpha-1(XII) chain / Homo sapiens
• ITLHENR (7aa)
  •    Q9NR99    Asn-2007     Matrix-remodeling-associated protein 5 / Homo sapiens
• GCKDNATDSVPLR (13aa)
  •    Q91ZX7    Asn-2128     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• RGCKDNATDSVPLR (14aa)
  •    Q91ZX7    Asn-2128     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500     Matrix-remodeling-associated protein 5 / Homo sapiens
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens
• KFVEGSHNSTVSLTTKN (17aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens