taxonomy (14)
protein (104)
source (45)
structure (25)
composition (1)
disease (18)
reference (60)
site (146)
peptide (108)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Desmodus rotundus (Common vampire bat)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mus musculus (House mouse)
- Sus scrofa (Pig)
- Rana pipiens (Northern leopard frog)
- Nicotiana alata (Persian tobacco)
- Nicotiana tabacum (Common tobacco)
- Gallus gallus (Chicken)
- Apis mellifera (Honeybee)
- Drosophila melanogaster (Fruit fly)
- Trypanosoma brucei brucei
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Adipocyte enhancer-binding protein 1 / Homo sapiens Q8IUX7
- Alkaline phosphatase, intestinal / Homo sapiens P09923
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Aminopeptidase n / Homo sapiens P15144
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Calreticulin / Homo sapiens P27797
- Calumenin / Homo sapiens O43852
- Cap-gly domain-containinglinker protein 1 / Homo sapiens P30622
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cathepsin D / Homo sapiens P07339
- Choriogonadotropin - alpha and beta chains / Homo sapiens P0DN86 P01215
- Choriogonadotropin beta chain / Homo sapiens P0DN86
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 / Homo sapiens Q16842
- Coagulation factor V / Homo sapiens P12259
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Complement c3 / Homo sapiens P01024
- Decorin / Homo sapiens P07585
- Endoplasmin / Homo sapiens P14625
- Extracellular calcium-sensing receptor / Homo sapiens P41180
- Extracellular matrix protein 1 / Homo sapiens Q16610
- Fibroleukin / Homo sapiens Q14314
- Fibronectin / Homo sapiens P02751
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens P01215
- Golgin subfamily a member 4 / Homo sapiens Q13439
- Haptoglobin / Homo sapiens P00738
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens Q8TDY8
- Integrin alpha-M / Homo sapiens P11215
- Interferon gamma / Homo sapiens P01579
- Interferon-gamma receptor alpha chain / Homo sapiens P15260
- Lactotransferrin / Homo sapiens P02788
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Matrix-remodeling-associated protein 5 / Homo sapiens Q9NR99
- Periostin / Homo sapiens Q15063
- Plexin-B2 / Homo sapiens O15031
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Protein CREG1 / Homo sapiens O75629
- Putative protein FAM10A5 / Homo sapiens Q8NFI4
- Rhodopsin / Homo sapiens P08100
- Sciellin / Homo sapiens O95171
- Serotransferrin / Homo sapiens P02787
- Serum paraoxonase/arylesterase 1 / Homo sapiens P27169
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Transferrin receptor protein 1 / Homo sapiens P02786
- Translocon-associated protein subunit beta / Homo sapiens P43308
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Uncharacterized protein from Meconium / Homo sapiens
- Vascular endothelial growth factor receptor 1 / Homo sapiens P17948
- Von willebrand factor / Homo sapiens P04275
- Glycophorin / Bos taurus
- Lactotransferrin / Bos taurus P24627
- Rhodopsin / Bos taurus P02699
- Thyrotropin-aplha and beta chains / Bos taurus P01223 P01217
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus Q64676
- Cadherin-13 / Mus musculus Q9WTR5
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Laminin subunit gamma-1 / Mus musculus P02468
- Nectin-1 / Mus musculus Q9JKF6
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neuroplastin / Mus musculus P97300
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Roundabout homolog 2 / Mus musculus Q7TPD3
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Rhodopsin / Rana pipiens P31355
- Ribonuclease s-6 / Nicotiana alata Q40379
- Uncharacterized protein / Nicotiana tabacum
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Uncharacterized protein from Royal Jelly / Apis mellifera
- Uncharacterized protein / Trypanosoma brucei brucei
- Uncharacterized protein / Trypanosoma brucei brucei
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amnion (UBERON_0000305) FL (CVCL_1905)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Cerebellum (UBERON_0002037)
- Colon (UBERON_0001155)
- Embryo (UBERON_0000922)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pituitary Gland (UBERON_0000007)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- Placenta (UBERON_0001987)
- Prefrontal Cortex (UBERON:0000451)
- Retina (UBERON_0000966)
- Royal Jelly
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Striatum (UBERON_0002345)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- LS174T (CVCL_1384)
- NS0 (CVCL_3940)
- P3X63Ag8U.1 (CVCL_3412)
- SPC-Mb-92-C6 (CVCL_VT62)
- Delipidated Cell
- Egg Cell
- Egg Cell Egg White
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Style (BTO_0001313)
Source
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1994
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9563
- N-Linked / Complex / Structure 9831
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-4)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9536
- N-Linked / Hybrid / Structure 9775
- N-Linked / Hybrid / Structure 9864
- N-Linked / Hybrid / Structure 10027
- N-Linked / Hybrid / Structure 10263
- N-Linked / Hybrid / Structure 11515
- N-Linked / Hybrid / Structure 11657
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)Man(b1-4)GlcNAc
- N-Linked / Undefined core / Man(?1-3)Man(?1-3)Man(?1-3)Man(?1-?)GlcNAc(?1-?)GlcNAc(?1-?)GlcNAc
- O-Linked / Undefined core / Gal(?1-3)Gal(?1-4)GlcNAc(b1-3)Gal(?1-4)GlcNAc(b1-3)Gal(?1-3)GalNAc
Reported structure
- Hex:4 HexNAc:3 (avg mass : 1276.1699 )
Composition
- Cancer, breast (DOID:1612)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Diabetes Mellitus (DOID:9351)
- Gangliosidosis GM1 (DOID:3322)
- Gastritis (DOID:4029)
- Gaucher Disease (DOID:1926)
- Heavy Chain Disease (DOID:0060125)
- Hydatidiform Mole (DOID:3590)
- Hydatidiform Mole, Invasive (DOID:3590)
- Hypersensitivity reaction disease (DOID:0060056)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Plasmacytoma (Mouse) (DOID:3721)
Disease
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Stable expression of human beta1,4-galactosyltransferase in plant cells modifies N-linked glycosylation patterns. (1999 - Palacpac N, Yoshida S, Sakai H, Kimura Y, Fujiyama K, Yoshida T, Seki T) / Status : Reviewed
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
- Characterization of a novel type of chain-terminator Gal beta 1-6Gal beta 1-4)GlcNAc in an oligosaccharide related to N-glycosylated protein glycans isolated from GM1 the urine of patients with gangliosidosis. (1991 - Michalski J, Lemoine J, Wieruszeski J, Fournet B, Montreuil J, Strecker G) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
- Isolation and structural studies of the neutral oligosaccharide units from bovine glycophorin. (1981 - Fukuda K, Tomita M, Hamada A) / Status : Reviewed
- Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed
- Investigations on the oligosaccharide units of an A myeloma globulin. (1968 - Dawson G, Clamp JR) / Status : Reviewed
Reference
- Adipocyte enhancer-binding protein 1 / Homo sapiens
-
Alkaline phosphatase, intestinal / Homo sapiens
- Undefined site
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Calreticulin / Homo sapiens
- Calumenin / Homo sapiens
- Cap-gly domain-containinglinker protein 1 / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cathepsin D / Homo sapiens
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 / Homo sapiens
- Coagulation factor V / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Decorin / Homo sapiens
- Endoplasmin / Homo sapiens
- Extracellular calcium-sensing receptor / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Fibroleukin / Homo sapiens
- Fibronectin / Homo sapiens
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
- Golgin subfamily a member 4 / Homo sapiens
- Haptoglobin / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Asn-340
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
- Integrin alpha-M / Homo sapiens
-
Interferon gamma / Homo sapiens
- Undefined site
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Periostin / Homo sapiens
- Plexin-B2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
- Protein CREG1 / Homo sapiens
- Putative protein FAM10A5 / Homo sapiens
-
Rhodopsin / Homo sapiens
- Undefined site
- Sciellin / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serum paraoxonase/arylesterase 1 / Homo sapiens
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
-
Transferrin receptor protein 1 / Homo sapiens
- Undefined site
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
- Vascular endothelial growth factor receptor 1 / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Glycophorin / Bos taurus
- Undefined site
- Lactotransferrin / Bos taurus
-
Rhodopsin / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- Cadherin-13 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Nectin-1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neuroplastin / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
- Rhodopsin / Rana pipiens
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Uncharacterized protein / Nicotiana tabacum
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- Asn-293
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- FSNVTWF (7aa)
- FSNVTW (6aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- CIQANYSIMENGK (13aa)
- NK (2aa)
- FHAIHVSGTNGTKRF (15aa)
- FHAIHVSGTNGTK (13aa)
- HAIHVSGTNGTK (12aa)
- FHAIHVSGTNGTKR (14aa)
- TNHMGNVTFTIPANR (15aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- TVITPATNHMGNVTFTIPANR (21aa)
- IRNVSDTTKR (10aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- KINYTISQGHR (11aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- VNFTCK (6aa)
- TKPREEQYNSTYR (13aa)
- VINFYAGANQSMNVTCVGKR (20aa)
- VINFYAGANQSMNVTCVGK (19aa)
- NPNGTVTVISR (11aa)
- PANVSFVLVPFK (12aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- IVTPEEYYNVTV (12aa)
- ANATIEVK (8aa)
- QTTAMDFSYANETVCWVHVGDSAAQTQLK (29aa)
- HANWTLTPLK (10aa)
- YQYVDCGRNTT (11aa)
- LAYATINDSR (10aa)
- GSLSYLNVTRK (11aa)
- IDGSTNFTR (9aa)
- LNSSTIK (7aa)
- SHPNATFSAVGE (12aa)
- KYNENGTIT (9aa)
- YNLT (4aa)
- VIYQNHNK (8aa)
- VSAITLVSATSTTANMTVGPEGK (23aa)
- MAGKPTHINVSVVMAEADGTCY (22aa)
- FFAENETWVVDSCTTCTCK (19aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- GEVFNATR (8aa)
- SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
- ALAAMQDPEVMVAFQDVAQNPANMSK (26aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- GNTTTLISENGHAADTLTATNFR (23aa)
- STGKPTLYNVSLVMSDTAGTCY (22aa)
- LSEIHKDQPGHPVNR (15aa)
- FTNGSCADIK (10aa)
- GMDNVEYQFAVNNDTTELQVR (21aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- SCVAVTSAQPQNMSR (15aa)
- GQGEQGSTGGTNISSTSEPKEE (22aa)
- RHEEGHMINCTCFGQGR (17aa)
- NGSSNTGAK (9aa)
- YIDKGNR (7aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- VITPGTNTS (9aa)
- LYQDVNCT (8aa)
- QDVNCTEVPVAIHADQL (17aa)
- ANYNLPIMVTDSGKPPMTNITDLR (24aa)
- YSNNSIA (7aa)
- NFTIS (5aa)
- FHINK (5aa)
- FGGFNFS (7aa)
- NVTAQICIDK (10aa)
- ANVTSENNMPR (11aa)
- GVVTDEQGIPIANATISVSGINHGVK (26aa)
- QSCITEQTQYFFKNDTK (17aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- NFTTAPAICHDGK (13aa)
- HVTYVPAQEKNF (12aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWF (12aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- VNSSLHSQISR (11aa)
- KYFKNHTS (8aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- NLQVYNATSNSLTVK (15aa)
- ITLHENR (7aa)
- GCKDNATDSVPLR (13aa)
- RGCKDNATDSVPLR (14aa)
- ITVHGNGSLDIR (12aa)
- MIEAYNITEK (10aa)
- FVEGSHNSTVSLTTK (15aa)
- KFVEGSHNSTVSLTTKN (17aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Retina (UBERON_0000966)
- Rhodopsin / Rana pipiens
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Amnion (UBERON_0000305) FL (CVCL_1905)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Liver (UBERON_0002107)
- Meconium (UBERON_0007109)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- NS0 (CVCL_3940)
- P3X63Ag8U.1 (CVCL_3412)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Control/Healthy
- Diabetes Mellitus (DOID:9351)
- Gangliosidosis GM1 (DOID:3322)
- Hydatidiform Mole (DOID:3590)
- Hydatidiform Mole, Invasive (DOID:3590)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Plasmacytoma (Mouse) (DOID:3721)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Stable expression of human beta1,4-galactosyltransferase in plant cells modifies N-linked glycosylation patterns. (1999 - Palacpac N, Yoshida S, Sakai H, Kimura Y, Fujiyama K, Yoshida T, Seki T) / Status : Reviewed
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
-
Alkaline phosphatase, intestinal / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
-
Uncharacterized protein / Nicotiana tabacum
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Liver (UBERON_0002107)
- Spleen (UBERON_0002106)
- Urine (UBERON_0001088)
- P3X63Ag8U.1 (CVCL_3412)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Heavy Chain Disease (DOID:0060125)
- Plasmacytoma (Mouse) (DOID:3721)
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
-
Transferrin receptor protein 1 / Homo sapiens
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Liver (UBERON_0002107)
- Egg Cell
- Gangliosidosis GM1 (DOID:3322)
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Coagulation factor V / Homo sapiens
- Haptoglobin / Homo sapiens
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Colon adenocarcinoma (DOID:234)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Multiple myeloma (DOID:9538)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- Egg Cell
-
Ovomucoid / Gallus gallus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
- Lactotransferrin / Bos taurus
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
- Rhodopsin / Rana pipiens
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Retina (UBERON_0000966)
- Royal Jelly
- Delipidated Cell
- Style (BTO_0001313)
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
-
Rhodopsin / Homo sapiens
- Undefined site
-
Rhodopsin / Bos taurus
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- Retina (UBERON_0000966)
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed
-
Rhodopsin / Homo sapiens
- Undefined site
-
Rhodopsin / Bos taurus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Egg Cell
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
-
Interferon gamma / Homo sapiens
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- Milk (UBERON_0001913)
- Apolipoprotein B-100 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KFVEGSHNSTVSLTTKN (17aa)
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- BTI-Tn-5B1-4 (CVCL_C190)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- NFTTAPAICHDGK (13aa)
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- TKPREEQYNSTYR (13aa)
- SHPNATFSAVGE (12aa)
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
-
- N-Linked / Hybrid
(avg mass : 1276.1699)
- Cerebellum (UBERON_0002037)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Striatum (UBERON_0002345)
-
- N-Linked / No-core
(avg mass : 1276.1699)
- Urine (UBERON_0001088)
- Gangliosidosis GM1 (DOID:3322)
-
- N-Linked / Undefined core
(avg mass : 1276.1699)
- Blood Serum (UBERON_0001977)
- Multiple myeloma (DOID:9538)
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 1276.1699)
-
Glycophorin / Bos taurus
- Undefined site
-
- Hex:4 HexNAc:3 / N-Linked
(avg mass : 1276.1699)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1994
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9563
- N-Linked / Complex / Structure 9831
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-4)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9536
- N-Linked / Hybrid / Structure 9775
- N-Linked / Hybrid / Structure 9864
- N-Linked / Hybrid / Structure 10027
- N-Linked / Hybrid / Structure 10263
- N-Linked / Hybrid / Structure 11515
- N-Linked / Hybrid / Structure 11657
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)Man(b1-4)GlcNAc
- N-Linked / Undefined core / Man(?1-3)Man(?1-3)Man(?1-3)Man(?1-?)GlcNAc(?1-?)GlcNAc(?1-?)GlcNAc
- Ovalbumin / Gallus gallus
- YNLT (4aa)
-
- Hex:4 HexNAc:3 / N-Linked
(avg mass : 1276.1699)
- Ascitic fluid (UBERON_0007795)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- LS174T (CVCL_1384)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1994
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9563
- N-Linked / Complex / Structure 9831
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-4)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9536
- N-Linked / Hybrid / Structure 9775
- N-Linked / Hybrid / Structure 9864
- N-Linked / Hybrid / Structure 10027
- N-Linked / Hybrid / Structure 10263
- N-Linked / Hybrid / Structure 11515
- N-Linked / Hybrid / Structure 11657
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)Man(b1-4)GlcNAc
- N-Linked / Undefined core / Man(?1-3)Man(?1-3)Man(?1-3)Man(?1-?)GlcNAc(?1-?)GlcNAc(?1-?)GlcNAc
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Adipocyte enhancer-binding protein 1 / Homo sapiens
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Calreticulin / Homo sapiens
- Calumenin / Homo sapiens
- Cap-gly domain-containinglinker protein 1 / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cathepsin D / Homo sapiens
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 / Homo sapiens
- Coagulation factor V / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Decorin / Homo sapiens
- Endoplasmin / Homo sapiens
- Extracellular calcium-sensing receptor / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Fibroleukin / Homo sapiens
- Fibronectin / Homo sapiens
- Golgin subfamily a member 4 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Periostin / Homo sapiens
- Plexin-B2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Protein CREG1 / Homo sapiens
- Putative protein FAM10A5 / Homo sapiens
- Sciellin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Vascular endothelial growth factor receptor 1 / Homo sapiens
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- Cadherin-13 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Nectin-1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neuroplastin / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- FSNVTWF (7aa)
- FSNVTW (6aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- CIQANYSIMENGK (13aa)
- FHAIHVSGTNGTKRF (15aa)
- FHAIHVSGTNGTK (13aa)
- HAIHVSGTNGTK (12aa)
- FHAIHVSGTNGTKR (14aa)
- TNHMGNVTFTIPANR (15aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- TVITPATNHMGNVTFTIPANR (21aa)
- IRNVSDTTKR (10aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- KINYTISQGHR (11aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- VNFTCK (6aa)
- VINFYAGANQSMNVTCVGKR (20aa)
- VINFYAGANQSMNVTCVGK (19aa)
- NPNGTVTVISR (11aa)
- PANVSFVLVPFK (12aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- IVTPEEYYNVTV (12aa)
- ANATIEVK (8aa)
- QTTAMDFSYANETVCWVHVGDSAAQTQLK (29aa)
- HANWTLTPLK (10aa)
- YQYVDCGRNTT (11aa)
- LAYATINDSR (10aa)
- GSLSYLNVTRK (11aa)
- IDGSTNFTR (9aa)
- LNSSTIK (7aa)
- KYNENGTIT (9aa)
- VIYQNHNK (8aa)
- VSAITLVSATSTTANMTVGPEGK (23aa)
- MAGKPTHINVSVVMAEADGTCY (22aa)
- FFAENETWVVDSCTTCTCK (19aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- GEVFNATR (8aa)
- SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
- ALAAMQDPEVMVAFQDVAQNPANMSK (26aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- GNTTTLISENGHAADTLTATNFR (23aa)
- STGKPTLYNVSLVMSDTAGTCY (22aa)
- LSEIHKDQPGHPVNR (15aa)
- FTNGSCADIK (10aa)
- GMDNVEYQFAVNNDTTELQVR (21aa)
- SCVAVTSAQPQNMSR (15aa)
- GQGEQGSTGGTNISSTSEPKEE (22aa)
- RHEEGHMINCTCFGQGR (17aa)
- NGSSNTGAK (9aa)
- YIDKGNR (7aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- VITPGTNTS (9aa)
- LYQDVNCT (8aa)
- QDVNCTEVPVAIHADQL (17aa)
- ANYNLPIMVTDSGKPPMTNITDLR (24aa)
- YSNNSIA (7aa)
- NFTIS (5aa)
- FHINK (5aa)
- FGGFNFS (7aa)
- NVTAQICIDK (10aa)
- ANVTSENNMPR (11aa)
- GVVTDEQGIPIANATISVSGINHGVK (26aa)
- QSCITEQTQYFFKNDTK (17aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- NFTTAPAICHDGK (13aa)
- HVTYVPAQEKNF (12aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWF (12aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- VNSSLHSQISR (11aa)
- KYFKNHTS (8aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- NLQVYNATSNSLTVK (15aa)
- ITLHENR (7aa)
- GCKDNATDSVPLR (13aa)
- RGCKDNATDSVPLR (14aa)
- ITVHGNGSLDIR (12aa)
- MIEAYNITEK (10aa)
- FVEGSHNSTVSLTTK (15aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:3 / N-Linked
(avg mass : 1276.1699)
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:3 / N-Linked
(avg mass : 1276.1699)
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1276.1699)
Source
Disease
Reported glycosite
- N-Linked / Undefined core
(avg mass : 1276.1699)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1276.1699)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1276.1699)
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1276.1699)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1276.1699)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1276.1699)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1276.1699)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1276.1699)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1276.1699)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1276.1699)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1276.1699)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1276.1699)
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1276.1699)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1276.1699)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1276.1699)
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)