Hex:4 HexNAc:3

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Sus scrofa (Pig)
• Rana pipiens (Northern leopard frog)
• Nicotiana alata (Persian tobacco)
• Nicotiana tabacum (Common tobacco)
• Gallus gallus (Chicken)
• Apis mellifera (Honeybee)
• Trypanosoma brucei brucei
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Alkaline phosphatase, intestinal / Homo sapiens    P09923
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Aminopeptidase n / Homo sapiens    P15144
• Apolipoprotein b-100 / Homo sapiens    P04114
• Apolipoprotein d / Homo sapiens    P05090
• Calreticulin / Homo sapiens    P27797
• Calumenin / Homo sapiens    O43852
• Cap-gly domain-containinglinker protein 1 / Homo sapiens    P30622
• Cathepsin D / Homo sapiens    P07339
• Choriogonadotropin - alpha and beta chains / Homo sapiens    P01215    P0DN86
• Choriogonadotropin beta chain / Homo sapiens    P0DN86
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 / Homo sapiens    Q16842
• Coagulation factor V / Homo sapiens    P12259
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Complement c3 / Homo sapiens    P01024
• Decorin / Homo sapiens    P07585
• Endoplasmin / Homo sapiens    P14625
• Extracellular calcium-sensing receptor / Homo sapiens    P41180
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Fibroleukin / Homo sapiens    Q14314
• Fibronectin / Homo sapiens    P02751
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Golgin subfamily a member 4 / Homo sapiens    Q13439
• Haptoglobin / Homo sapiens    P00738
• Immunoglobulin alpha (non secretory) / Homo sapiens    P01876    P01877
• Immunoglobulin gamma / Homo sapiens    P01859    P01857    P01860    P01861
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens    Q8TDY8
• Integrin alpha-M / Homo sapiens    P11215
• Interferon gamma / Homo sapiens    P01579
• Interferon-gamma receptor alpha chain / Homo sapiens    P15260
• Lactotransferrin / Homo sapiens    P02788
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Periostin / Homo sapiens    Q15063
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prosaposin / Homo sapiens    P07602
• Protein CREG1 / Homo sapiens    O75629
• Putative protein FAM10A5 / Homo sapiens    Q8NFI4
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Rhodopsin / Homo sapiens    P08100
• Sciellin / Homo sapiens    O95171
• Serotransferrin / Homo sapiens    P02787
• Serum paraoxonase/arylesterase 1 / Homo sapiens    P27169
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Translocon-associated protein subunit beta / Homo sapiens    P43308
• Transmembrane protein 106B / Homo sapiens    Q9NUM4
• Uncharacterized protein from Meconium / Homo sapiens
• Vascular endothelial growth factor receptor 1 / Homo sapiens    P17948
• Von willebrand factor / Homo sapiens    P04275
• Glycophorin / Bos taurus
• Lactotransferrin / Bos taurus    P24627
• Rhodopsin / Bos taurus    P02699
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus    Q64676
• Cadherin-13 / Mus musculus    Q9WTR5
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Laminin subunit gamma-1 / Mus musculus    P02468
• Nectin-1 / Mus musculus    Q9JKF6
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neuroplastin / Mus musculus    P97300
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Roundabout homolog 2 / Mus musculus    Q7TPD3
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Amiloride-sensitive amine oxidase / Sus scrofa    Q9TRC7
• Rhodopsin / Rana pipiens    P31355
• Ribonuclease s-6 / Nicotiana alata    Q40379
• Uncharacterized protein from Undefined tissue / Nicotiana tabacum
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein from Egg Cell / Gallus gallus
• Uncharacterized protein from Royal Jelly / Apis mellifera
• Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
• Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amnion (UBERON_0000305)   FL (CVCL_1905)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Meconium (UBERON_0007109)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   IM4/V/IV-G1 (CVCL_VT68)  
• Ovary (UBERON_0000992)   IM4/V/IV-G2 (CVCL_VT69)  
• Ovary (UBERON_0000992)   IM4/V/IV-G3 (CVCL_VT70)  
• Ovary (UBERON_0000992)   IM4/V/IV-G4 (CVCL_VT71)  
• Ovary (UBERON_0000992)   IM4/V/IV-G5 (CVCL_VT72)  
• Ovary (UBERON_0000992)   Sf9 (CVCL_0549)  
• Pituitary Gland (UBERON_0000007)  
• Placenta (UBERON_0001987)   JEG-3 (CVCL_0363)   Epithelium (CL_0002577)  
• Placenta (UBERON_0001987)  
• Retina (UBERON_0000966)  
• Royal Jelly  
• Spleen (UBERON_0002106)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• BTI-Tn-5B1-4 (CVCL_C190)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• NS0 (CVCL_3940)  
• P3X63Ag8U.1 (CVCL_3412)  
• SPC-Mb-92-C6 (CVCL_VT62)  
• Delipidated Cell  
• Egg Cell  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  
• Style (BTO_0001313)  

Reported structure

• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 1994
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-4)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)Man(b1-4)GlcNAc
• N-Linked / Undefined core / Man(?1-3)Man(?1-3)Man(?1-3)Man(?1-?)GlcNAc(?1-?)GlcNAc(?1-?)GlcNAc
• O-Linked / Undefined core / Gal(?1-3)Gal(?1-4)GlcNAc(b1-3)Gal(?1-4)GlcNAc(b1-3)Gal(?1-3)GalNAc

Composition

• Hex:4 HexNAc:3 (avg mass : 1276.1699 )

Disease

• Cancer, breast (DOID:1612)
• Choriocarcinoma (DOID:3594)
• Choriocarcinoma, with Hyperthyroidism
• COVID-19 (DOID:0080600)
• Diabetes Mellitus (DOID:9351)
• Gangliosidosis GM1 (DOID:3322)
• Gaucher Disease (DOID:1926)
• Heavy Chain Disease (DOID:0060125)
• Hydatidiform Mole (DOID:3590)
• Hydatidiform Mole, Invasive (DOID:3590)
• Myeloma (DOID:0070004)
• Myeloma, Multiple (DOID:9538)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Plasmacytoma (Mouse) (DOID:3721)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
• The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
• N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
• Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
• Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
• Stable expression of human beta1,4-galactosyltransferase in plant cells modifies N-linked glycosylation patterns. (1999 - Palacpac N, Yoshida S, Sakai H, Kimura Y, Fujiyama K, Yoshida T, Seki T) / Status : Reviewed
• Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
• Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
• First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
• Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
• Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
• Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
• Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• Characterization of a novel type of chain-terminator Gal beta 1-6Gal beta 1-4)GlcNAc in an oligosaccharide related to N-glycosylated protein glycans isolated from GM1 the urine of patients with gangliosidosis. (1991 - Michalski J, Lemoine J, Wieruszeski J, Fournet B, Montreuil J, Strecker G) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
• Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
• Isolation and structural studies of the neutral oligosaccharide units from bovine glycophorin. (1981 - Fukuda K, Tomita M, Hamada A) / Status : Reviewed
• Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed
• Investigations on the oligosaccharide units of an A myeloma globulin. (1968 - Dawson G, Clamp JR) / Status : Reviewed

Reported glycosite

• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-922
• Alkaline phosphatase, intestinal / Homo sapiens
  •        Undefined site
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-503
• Aminopeptidase n / Homo sapiens
  •        Asn-128
• Apolipoprotein b-100 / Homo sapiens
  •        Asn-3411
• Apolipoprotein d / Homo sapiens
  •        Asn-65
  •        Asn-98
• Calreticulin / Homo sapiens
  •        Asn-344
• Calumenin / Homo sapiens
  •        Asn-131
• Cap-gly domain-containinglinker protein 1 / Homo sapiens
  •        Asn-971
  •        Asn-1263
• Cathepsin D / Homo sapiens
  •        Asn-263
• Choriogonadotropin - alpha and beta chains / Homo sapiens
  •        Undefined site
• Choriogonadotropin beta chain / Homo sapiens
  •        Undefined site
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 / Homo sapiens
  •        Asn-211
• Coagulation factor V / Homo sapiens
  •        Asn-297
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
• Complement c3 / Homo sapiens
  •        Asn-85
• Decorin / Homo sapiens
  •        Asn-211
• Endoplasmin / Homo sapiens
  •        Asn-62
• Extracellular calcium-sensing receptor / Homo sapiens
  •        Asn-446
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-530
• Fibroleukin / Homo sapiens
  •        Asn-263
• Fibronectin / Homo sapiens
  •        Asn-542
  •        Asn-1236
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Undefined site
• Golgin subfamily a member 4 / Homo sapiens
  •        Asn-585
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-207
• Immunoglobulin alpha (non secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-327
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-378
• Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
  •        Asn-483
• Integrin alpha-M / Homo sapiens
  •        Asn-900
• Interferon gamma / Homo sapiens
  •        Undefined site
• Interferon-gamma receptor alpha chain / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Asn-156
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-378
  •        Asn-1366
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-275
  •        Asn-356
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2007
  •        Asn-2500
• Periostin / Homo sapiens
  •        Asn-599
• Plexin-B2 / Homo sapiens
  •        Asn-528
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-90
• Prosaposin / Homo sapiens
  •        Undefined site
• Protein CREG1 / Homo sapiens
  •        Asn-216
• Putative protein FAM10A5 / Homo sapiens
  •        Asn-344
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
  •        Asn-690
• Rhodopsin / Homo sapiens
  •        Undefined site
• Sciellin / Homo sapiens
  •        Asn-562
• Serotransferrin / Homo sapiens
  •        Undefined site
• Serum paraoxonase/arylesterase 1 / Homo sapiens
  •        Asn-253
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Transferrin receptor protein 1 / Homo sapiens
  •        Undefined site
• Translocon-associated protein subunit beta / Homo sapiens
  •        Asn-104
• Transmembrane protein 106B / Homo sapiens
  •        Asn-256
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Vascular endothelial growth factor receptor 1 / Homo sapiens
  •        Asn-625
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Glycophorin / Bos taurus
  •        Undefined site
• Lactotransferrin / Bos taurus
  •        Asn-564
• Rhodopsin / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-153
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
  •        Asn-442
• Cadherin-13 / Mus musculus
  •        Asn-671
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-258
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
  •        Undefined site
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-580
  •        Asn-968
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
• Nectin-1 / Mus musculus
  •        Asn-202
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Neuroplastin / Mus musculus
  •        Asn-228
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-240
  •        Asn-2128
• Roundabout homolog 2 / Mus musculus
  •        Asn-793
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-92
  •        Asn-168
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-153
  •        Asn-197
• Amiloride-sensitive amine oxidase / Sus scrofa
  •        Undefined site
• Rhodopsin / Rana pipiens
  •        Asn-2
  •        Asn-15
• Ribonuclease s-6 / Nicotiana alata
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Nicotiana tabacum
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Egg Cell / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Royal Jelly / Apis mellifera
  •        Undefined site
• Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
  •        Undefined site
• Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-165
  •        Asn-343
  •        Asn-615
  •        Asn-657
  •        Asn-709
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159
  •        Asn-1174
  •        Asn-1194
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-282
  •        Asn-331
  •        Asn-602
  •        Asn-615
  •        Asn-709
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-331
  •        Asn-615

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• FSNVTW (6aa)
  •    P0DTC2    Asn-61
• TDDEVVQREEEAIQIDGINASQIR (24aa)
  •    P14625    Asn-62
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74
• FHAIHVSGTNGTK (13aa)
  •    P0DTC2    Asn-74
• HAIHVSGTNGTK (12aa)
  •    P0DTC2    Asn-74
• FHAIHVSGTNGTKR (14aa)
  •    P0DTC2    Asn-74
• TVLTPATNHMGNVTFTIPANR (21aa)
  •    P01024    Asn-85
• TNHMGNVTFTIPANR (15aa)
  •    P01024    Asn-85
• TVITPATNHMGNVTFTIPANR (21aa)
  •    P01024    Asn-85
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98
• AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
  •    P43308    Asn-104
• ANATIEVK (8aa)
  •    P97300    Asn-228
• LIVNNATNVVIK (12aa)
  •    P0DTC2    Asn-122
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• KINYTISQGHR (11aa)
  •    P15144    Asn-128
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131
• RACQFNR (7aa)
  •    P14231    Asn-153
• ACQFNR (6aa)
  •    P14231    Asn-153
• SSANNCTF (8aa)
  •    P0DTC2    Asn-165
• SSANNCTFEY (10aa)
  •    P0DTC2    Asn-165
• VYSSANNCTFEYVSQPFLMDLEGK (24aa)
  •    P0DTC2    Asn-165
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• SEFRVYSSANNCTFE (15aa)
  •    P0DTC2    Asn-165
• VNFTCK (6aa)
  •    P97797    Asn-168
• VINFYAGANQSMNVTCVGK (19aa)
  •    P14231    Asn-197
• VINFYAGANQSMNVTCVGKR (20aa)
  •    P14231    Asn-197
• NPNGTVTVISR (11aa)
  •    Q9JKF6    Asn-202
• PANVSFVLVPFK (12aa)
  •    Q16842    Asn-211
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211
• IVTPEEYYNVTV (12aa)
  •    O75629    Asn-216
• QTTAMDFSYANETVCWVHVGDSAAQTQLK (29aa)
  •    Q91ZX7    Asn-240
• HANWTLTPLK (10aa)
  •    P27169    Asn-253
• YQYVDCGRNTT (11aa)
  •    Q9NUM4    Asn-256
• LAYATINDSR (10aa)
  •    Q9Z218    Asn-258
• GSLSYLNVTRK (11aa)
  •    P07339    Asn-263
• IDGSTNFTR (9aa)
  •    Q14314    Asn-263
• LNSSTIK (7aa)
  •    P13473    Asn-275
• KYNENGTIT (9aa)
  •    P0DTC2    Asn-282
• VIYQNHNK (8aa)
  •    P11627    Asn-293
• VSAITLVSATSTTANMTVGPEGK (23aa)
  •    P12259    Asn-297
• MAGKPTHINVSVVMAEADGTCY (22aa)
  •    P01877    Asn-327
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330
• RFPNIT (6aa)
  •    P0DTC2    Asn-331
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• LAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340
• VFNATR (6aa)
  •    P0DTC2    Asn-343
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343
• SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
  •    P27797    Asn-344
• ALAAMQDPEVMVAFQDVAQNPANMSK (26aa)
  •    Q8NFI4    Asn-344
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• STGKPTLYNVSLVMSDTAGTCY (22aa)
  •    P01871    Asn-378
• GNTTTLISENGHAADTLTATNFR (23aa)
  •    Q14766    Asn-378
• LSEIHKDQPGHPVNR (15aa)
  •    Q64676    Asn-442
• FTNGSCADIK (10aa)
  •    P41180    Asn-446
• GMDNVEYQFAVNNDTTELQVR (21aa)
  •    Q8TDY8    Asn-483
• SCVAVTSAQPQNMSR (15aa)
  •    O15031    Asn-528
• GQGEQGSTGGTNISSTSEPKEE (22aa)
  •    Q16610    Asn-530
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• NGSSNTGAK (9aa)
  •    O95171    Asn-562
• YIDKGNR (7aa)
  •    O08532-4    Asn-580
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• GGVSVITPGTNTSNQVAVLY (20aa)
  •    P0DTC2    Asn-602
• VITPGTNTS (9aa)
  •    P0DTC2    Asn-602
• ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
  •    P0DTC2    Asn-615
• DPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (57aa)
  •    P0DTC2    Asn-615
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615
• QDVNCTEVPVAIHADQL (17aa)
  •    P0DTC2    Asn-615
• ANYNLPIMVTDSGKPPMTNITDLR (24aa)
  •    Q9WTR5    Asn-671
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRR (37aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR (39aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• HVNNSYE (7aa)
  •    P0DTC2    Asn-657
• NVSDIIPR (8aa)
  •    Q9BYF1    Asn-690
• YSNNSIA (7aa)
  •    P0DTC2    Asn-709
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-717
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-709
• NFTIS (5aa)
  •    P0DTC2    Asn-717
• FHINK (5aa)
  •    Q7TPD3    Asn-793
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801
• TPPIKDFGGFNFSQILPDPSKPSK (24aa)
  •    P0DTC2    Asn-801
• TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
  •    P0DTC2    Asn-801
• DFGGFNFSQILPDPSKPSK (19aa)
  •    P0DTC2    Asn-801
• DFGGFNFSQILPDPSKPSKR (20aa)
  •    P0DTC2    Asn-801
• NVTAQICIDK (10aa)
  •    P12109    Asn-804
• ANVTSENNMPR (11aa)
  •    P11215    Asn-900
• GVVTDEQGIPIANATISVSGINHGVK (26aa)
  •    Q8IUX7    Asn-922
• QSCITEQTQYFFKNDTK (17aa)
  •    O08532-4    Asn-968
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098
• GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPR (46aa)
  •    P0DTC2    Asn-1074
• KNFTTAPAICHDGK (14aa)
  •    P0DTC2    Asn-1074
• VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (47aa)
  •    P0DTC2    Asn-1074
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074
• GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
  •    P0DTC2    Asn-1074
• HVTYVPAQEKNF (12aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098
• EGVFVSNGTHWF (12aa)
  •    P0DTC2    Asn-1098
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098
• GVFVSNGTHWFVTQR (15aa)
  •    P0DTC2    Asn-1098
• VSNGTHW (7aa)
  •    P0DTC2    Asn-1098
• VSNGTHWF (8aa)
  •    P0DTC2    Asn-1098
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105
• KYFKNHTS (8aa)
  •    P0DTC2    Asn-1159
• ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
  •    P0DTC2    Asn-1174
• ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1174
• VAKNLNE (7aa)
  •    P0DTC2    Asn-1194
• IDRLNEVAKNLNESLIDLQE (20aa)
  •    P0DTC2    Asn-1194
• VAKNLNESLIDLQE (14aa)
  •    P0DTC2    Asn-1194
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236
• CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
  •    Q14766    Asn-1366
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763
• ITLHENR (7aa)
  •    Q9NR99    Asn-2007
• GCKDNATDSVPLR (13aa)
  •    Q91ZX7    Asn-2128
• RGCKDNATDSVPLR (14aa)
  •    Q91ZX7    Asn-2128
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411