taxonomy (15)
protein (362)
source (71)
structure (45)
composition (1)
disease (31)
reference (151)
site (598)
peptide (545)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis lupus familiaris (Dog)
- Desmodus rotundus (Common vampire bat)
- Equus caballus (Domestic horse)
- Felis catus (Cat)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Gallus gallus (Chicken)
- Calloselasma rhodostoma (Malayan pit viper)
- Friend murine leukemia virus (F-mulv)
- Human immunodeficiency virus type 1 (HIV-1)
- Human betacoronavirus 2c EMC/2012
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- A disintegrin and metalloproteinase with thrombospondin motifs (13adamts13) / Homo sapiens Q76LX8
- Acid ceramidase / Homo sapiens Q13510
- ADAM DEC1 / Homo sapiens O15204
- ADAMTS-like protein 2 / Homo sapiens Q86TH1
- Adenosine deaminase 2 / Homo sapiens Q9NZK5
- Adhesion G protein-coupled receptor F5 / Homo sapiens Q8IZF2
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Afamin / Homo sapiens P43652
- Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens P05186
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-fetoprotein / Homo sapiens P02771
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Alpha-S1-casein / Homo sapiens P47710
- Angiopoietin-1 receptor / Homo sapiens Q02763
- Angiopoietin-related protein 2 / Homo sapiens Q9UKU9
- Angiopoietin-related protein 4 / Homo sapiens Q9BY76
- Angiopoietin-related protein 6 / Homo sapiens Q8NI99
- Angiotensin-converting enzyme / Homo sapiens P12821
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Antithrombin-III / Homo sapiens P01008
- Apolipoprotein (a) / Homo sapiens P08519
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Apolipoprotein F / Homo sapiens Q13790
- Asialoglycoprotein receptor 2 / Homo sapiens P07307
- Asporin / Homo sapiens Q9BXN1
- Attractin / Homo sapiens O75882
- Basal cell adhesion molecule / Homo sapiens P50895
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Beta-Ala-His dipeptidase / Homo sapiens Q96KN2
- Beta-secretase-fc fusion protein / Homo sapiens P56817
- Biglycan / Homo sapiens P21810
- Bile-salt-activated lipase / Homo sapiens P19835
- Biotinidase / Homo sapiens P43251
- Butyrophilin subfamily 1 member A1 / Homo sapiens Q13410
- C-C motif chemokine 24 / Homo sapiens O00175
- C4b-binding protein alpha chain / Homo sapiens P04003
- C4b-binding protein beta chain / Homo sapiens P20851
- Cadherin-13 / Homo sapiens P55290
- Cadherin-5 / Homo sapiens P33151
- Cadherin-related family member 5 / Homo sapiens Q9HBB8
- Calumenin / Homo sapiens O43852
- Carbonic anhydrase 6 / Homo sapiens P23280
- Carboxypeptidase b2 / Homo sapiens Q96IY4
- Carboxypeptidase Q / Homo sapiens Q9Y646
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens P13688
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Catalase / Homo sapiens P04040
- Cathepsin D / Homo sapiens P07339
- Cathepsin L1 / Homo sapiens P07711
- Cation-independent mannose-6-phosphate receptor / Homo sapiens P11717
- CD109 antigen / Homo sapiens Q6YHK3
- CD27 antigen / Homo sapiens P26842
- CD276 antigen / Homo sapiens Q5ZPR3
- CD44 antigen / Homo sapiens P16070
- CD48 antigen / Homo sapiens P09326
- CD59 glycoprotein / Homo sapiens P13987
- CD97 antigen / Homo sapiens P48960
- Ceruloplasmin / Homo sapiens P00450
- Chimeric plasminogen activator K2-tuPA / Homo sapiens P00749 P00750
- Cholesteryl ester transfer protein / Homo sapiens P11597
- Cholinesterase / Homo sapiens P06276
- Chordin-like protein 2 / Homo sapiens Q6WN34
- Choriogonadotropin beta chain / Homo sapiens P0DN86
- Clusterin / Homo sapiens P10909
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens Q11201
- Coagulation factor V / Homo sapiens P12259
- Coagulation factor VIII / Homo sapiens P00451
- Coagulation factor XI / Homo sapiens P03951
- Coagulation factor XII / Homo sapiens P00748
- Collagen alpha-1(XIV) chain / Homo sapiens Q05707
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Collagen alpha-3(VI) chain / Homo sapiens P12111
- Complement C1q subcomponent subunit A / Homo sapiens P02745
- Complement c1r subcomponent / Homo sapiens P00736
- Complement C1r subcomponent-like protein / Homo sapiens Q9NZP8
- Complement C2 / Homo sapiens P06681
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- Complement component C9 / Homo sapiens P02748
- Complement factor h / Homo sapiens P08603
- Complement factor H-related protein 3 / Homo sapiens Q02985
- Complement factor H-related protein 4 / Homo sapiens Q92496
- Complement factor i / Homo sapiens P05156
- Complement receptor type 1 / Homo sapiens P17927
- Contactin-3 / Homo sapiens Q9P232
- Contactin-4 / Homo sapiens Q8IWV2
- Corticosteroid-binding globulin / Homo sapiens P08185
- Corticotropin-releasing factor-binding protein / Homo sapiens P24387
- Decorin / Homo sapiens P07585
- Desmoglein-2 / Homo sapiens Q14126
- Dickkopf-related protein 3 / Homo sapiens Q9UBP4
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dipeptidyl peptidase 4 / Homo sapiens P27487
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Homo sapiens Q13822
- Endothelial cell-selective adhesion molecule / Homo sapiens Q96AP7
- Ephrin-B2 / Homo sapiens P52799
- Epidermal growth factor receptor / Homo sapiens P00533
- Epididymis-specific alpha-mannosidase / Homo sapiens Q9Y2E5
- Erythropoietin / Homo sapiens P01588
- Extracellular matrix protein 1 / Homo sapiens Q16610
- Extracellular serine/threonine protein kinase FAM20C / Homo sapiens Q8IXL6
- Extracellular superoxide dismutase [Cu-Zn] / Homo sapiens P08294
- Fetuin-B / Homo sapiens Q9UGM5
- Fibrillin-1 / Homo sapiens P35555
- Fibroblast growth factor receptor 1 / Homo sapiens P11362
- Fibroblast growth factor receptor 4 / Homo sapiens P22455
- Fibronectin / Homo sapiens P02751
- Fibronectin type III domain-containing protein 4 / Homo sapiens Q9H6D8
- Ficolin-3 / Homo sapiens O75636
- Follitropin, alpha and beta chains / Homo sapiens P01215 P01225
- Frizzled-4 / Homo sapiens Q9ULV1
- G-protein coupled receptor 126 / Homo sapiens Q86SQ4
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyltranspeptidase 1 / Homo sapiens P19440
- Gliomedin [Cleaved into: Gliomedin shedded ectodomain] / Homo sapiens Q6ZMI3
- Glucosylceramidase / Homo sapiens P04062
- Glutamyl aminopeptidase / Homo sapiens Q07075
- Glyceraldehyde-3-phosphate dehydrogenase / Homo sapiens P04406
- Glycocalicin / Homo sapiens P07359
- Glycodelin-a / Homo sapiens P09466
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens P01215
- Haptoglobin / Homo sapiens P00738
- Helicase POLQ-like / Homo sapiens Q8TDG4
- Hemopexin / Homo sapiens P02790
- Heparin cofactor 2 / Homo sapiens P05546
- Hepatocyte growth factor / Homo sapiens P14210
- Hepatocyte growth factor activator / Homo sapiens Q04756
- High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens P12314-2
- Histidine-rich glycoprotein / Homo sapiens P04196
- HLA class II histocompatibility antigen gamma chain / Homo sapiens P04233
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- IgGFc-binding protein / Homo sapiens Q9Y6R7
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens P01860
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens P01880
- Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens P01854
- Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens P01854
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Immunoglobulin lambda-1 light chain / Homo sapiens P0DOX8
- Inactive tyrosine-protein kinase 7 / Homo sapiens Q13308
- Insulin-like growth factor-binding protein 3 / Homo sapiens P17936
- Integrin alpha-5 / Homo sapiens P08648
- Integrin alpha-5/beta-1 / Homo sapiens P05556 P08648
- Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens P19827
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Intercellular adhesion molecule 2 / Homo sapiens P13598
- Interferon alpha/beta receptor 1 / Homo sapiens P17181
- Interferon beta / Homo sapiens P01574
- Interleukin-1 receptor antagonist protein / Homo sapiens P18510
- Interleukin-1 receptor type 2 / Homo sapiens P27930
- Interleukin-1 receptor-like 1 / Homo sapiens Q01638
- Interleukin-4 receptor subunit alpha / Homo sapiens P24394
- Interleukin-6 receptor subunit beta / Homo sapiens P40189
- Interstitial collagenase / Homo sapiens P03956
- Junction plakoglobin / Homo sapiens P14923
- Keratin, type II cytoskeletal 1 / Homo sapiens P04264
- Kininogen-1 / Homo sapiens P01042
- L-selectin / Homo sapiens P14151
- Lactadherin / Homo sapiens Q08431
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-2 / Homo sapiens P24043
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Laminin subunit beta-1 / Homo sapiens P07942
- Laminin subunit gamma-1 / Homo sapiens P11047
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Leptin receptor / Homo sapiens P48357
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens Q6GTX8
- Lipopolysaccharide-binding protein / Homo sapiens P18428
- Lipoprotein lipase / Homo sapiens P06858
- Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens P12318-1
- Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens P31994-3
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens P08637
- Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens O75015
- Lumican / Homo sapiens P51884
- Lutropin beta chain / Homo sapiens P01229
- Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens Q9Y5Y7
- Lysosome membrane protein 2 / Homo sapiens Q14108
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Macrophage colony-stimulating factor 1 receptor / Homo sapiens P07333
- Macrophage mannose receptor 1 / Homo sapiens P22897
- Macrophage receptor MARCO / Homo sapiens Q9UEW3
- Maltase-glucoamylase, intestinal / Homo sapiens O43451
- Mesothelin / Homo sapiens Q13421
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Microtubule-associated serine/threonine-protein kinase 1 / Homo sapiens Q9Y2H9
- Midasin / Homo sapiens Q9NU22
- Multimerin-1 / Homo sapiens Q13201
- Multimerin-2 / Homo sapiens Q9H8L6
- Multiple epidermal growth factor-like domains protein 8 / Homo sapiens Q7Z7M0
- Myeloperoxidase / Homo sapiens P05164
- N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens Q9NY97
- Neogenin / Homo sapiens Q92859
- Neural cell adhesion molecule 2 / Homo sapiens O15394
- Neural cell adhesion molecule L1-like protein / Homo sapiens O00533
- Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens P41271
- Neuron navigator 2 / Homo sapiens Q8IVL1
- Neuronal cell adhesion molecule / Homo sapiens Q92823
- Noelin / Homo sapiens Q99784
- Noelin-2 / Homo sapiens O95897
- Olfactomedin-4 / Homo sapiens Q6UX06
- Oncoprotein-induced transcript 3 protein / Homo sapiens Q8WWZ8
- Oncostatin-M-specific receptor subunit beta / Homo sapiens Q99650
- P-selectin / Homo sapiens P16109
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Pantetheinase / Homo sapiens O95497
- Peroxidasin homolog / Homo sapiens Q92626
- Phosphatidylcholine-sterol acyltransferase / Homo sapiens P04180
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens P80108
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens Q96FE7
- Phospholipid transfer protein / Homo sapiens P55058
- Plasma kallikrein / Homo sapiens P03952
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Plasminogen / Homo sapiens P00747
- Plasminogen activator inhibitor 1 / Homo sapiens P05121
- Platelet endothelial cell adhesion molecule / Homo sapiens P16284
- Platelet glycoprotein 4 / Homo sapiens P16671
- Plexin-B1 / Homo sapiens O43157
- Plexin-B2 / Homo sapiens O15031
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prenylcysteine oxidase 1 / Homo sapiens Q9UHG3
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prolyl endopeptidase FAP / Homo sapiens Q12884
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Prostatic acid phosphatase / Homo sapiens P15309
- Protein heg homolog 1 / Homo sapiens Q9ULI3
- Protein Z-dependent protease inhibitor / Homo sapiens Q9UK55
- Protein-lysine 6-oxidase / Homo sapiens P28300
- Prothrombin / Homo sapiens P00734
- Protocadherin-9 / Homo sapiens Q9HC56
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Receptor-type tyrosine-protein phosphatase eta / Homo sapiens Q12913
- Receptor-type tyrosine-protein phosphatase F / Homo sapiens P10586
- Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens P23470
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens Q15262
- Receptor-type tyrosine-protein phosphatase mu / Homo sapiens P28827
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens P15941 Q99102
- Reelin / Homo sapiens P78509
- Ribonuclease pancreatic / Homo sapiens P07998
- Roundabout homolog 4 / Homo sapiens Q8WZ75
- Secreted frizzled-related protein 3 / Homo sapiens Q92765
- Seizure 6-like protein 2 / Homo sapiens Q6UXD5
- Selenoprotein P / Homo sapiens P49908
- Semaphorin-4B / Homo sapiens Q9NPR2
- Semaphorin-4D / Homo sapiens Q92854
- Semaphorin-6A / Homo sapiens Q9H2E6
- Serotransferrin / Homo sapiens P02787
- Sex hormone-binding globulin / Homo sapiens P04278
- Sialic acid-binding Ig-like lectin 14 / Homo sapiens Q08ET2
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- Sialic acid-binding Ig-like lectin 8 / Homo sapiens Q9NYZ4
- SLIT-ROBO Rho GTPase-activating protein 1 / Homo sapiens Q7Z6B7
- Sortilin / Homo sapiens Q99523
- Sparc / Homo sapiens P09486
- Sparc-like protein 1 / Homo sapiens Q14515
- Sulfhydryl oxidase 1 / Homo sapiens O00391
- Suppressor of tumorigenicity 14 protein / Homo sapiens Q9Y5Y6
- Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens Q4LDE5
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Tenascin / Homo sapiens P24821
- Tenascin-X / Homo sapiens P22105
- Teneurin-1 / Homo sapiens Q9UKZ4
- TGF-beta receptor type-2 / Homo sapiens P37173
- THAP domain-containing protein 5 / Homo sapiens Q7Z6K1
- Thrombopoietin / Homo sapiens P40225
- Thrombospondin-1 / Homo sapiens P07996
- Thyroxine-binding globulin / Homo sapiens P05543
- Tissue-type plasminogen activator / Homo sapiens P00750
- Toll-like receptor 2 / Homo sapiens O60603
- Trans-Golgi network integral membrane protein 2 / Homo sapiens O43493
- Tryptase alpha/beta-1 / Homo sapiens Q15661
- Tumor necrosis factor ligand superfamily member 13 / Homo sapiens O75888
- Tumor necrosis factor ligand superfamily member 5 / Homo sapiens P29965
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens O00300
- Tumor necrosis factor receptor superfamily member 16 / Homo sapiens P08138
- Tumor necrosis factor receptor superfamily member 17 / Homo sapiens Q02223
- Tumor necrosis factor receptor superfamily member 21 / Homo sapiens O75509
- Tyrosine-protein kinase Mer / Homo sapiens Q12866
- Tyrosine-protein kinase receptor TYRO3 / Homo sapiens Q06418
- Uncharacterized protein from Blood Serum / Homo sapiens
- Uncharacterized protein from Pleura / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Vasorin / Homo sapiens Q6EMK4
- Versican core protein / Homo sapiens P13611
- Vitamin k-dependent protein c / Homo sapiens P04070
- Vitronectin / Homo sapiens P04004
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens P54289
- Von willebrand factor / Homo sapiens P04275
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Acetylcholinesterase / Bos taurus P23795
- Plasminogen / Bos taurus P06868
- Uncharacterized protein / Bos taurus
- Immunoglobulin gamma / Canis lupus familiaris
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Choriogonadotropin beta chain / Equus caballus P08751
- Immunoglobulin gamma / Equus caballus
- Immunoglobulin gamma / Felis catus
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Complement C1q subcomponent subunit A / Mus musculus P98086
- Fetal antigen 1 / Mus musculus Q09163
- Glycophorin / Mus musculus P14220
- Limbic system-associated membrane protein / Mus musculus Q8BLK3
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Tetraspanin-2 / Mus musculus Q922J6
- Uncharacterized protein from Lung / Mus musculus
- Zona pellucida sperm-binding protein matrix / Mus musculus P10761 P20239 Q62005
- Neuroligin 1 / Rattus norvegicus Q62765
- Serotransferrin / Rattus norvegicus P12346
- T-kininogen / Rattus norvegicus P01048 P08932
- Uncharacterized protein / Rattus norvegicus
- 32 kDa enamelin / Sus scrofa O97939
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Fibrinogen / Sus scrofa
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Plasminogen / Sus scrofa P06867
- Thyroglobulin / Sus scrofa
- Vitronectin / Sus scrofa P48819
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012 K0BRG7
- Ovotransferrin / Gallus gallus P02789
- Riboflavin-binding protein / Gallus gallus P02752
- Ancrod / Calloselasma rhodostoma P26324
- L-amino acid oxidase / Calloselasma rhodostoma P81382
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amniotic Fluid (UBERON_0000173)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cerebellum (UBERON_0002037)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Colostrum (UBERON_0001914)
- Enamel Organ (UBERON_0005176)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) Hep-G2 (CVCL_0027)
- Liver (UBERON_0002107)
- Lung (UBERON_0002048) LL/2 (LLC1) (CVCL_4358)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911) C127 (CVCL_6550)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Pituitary Gland (UBERON_0000007)
- Placenta (UBERON_0001987)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Prefrontal Cortex (UBERON:0000451)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) Fibroblast (CL_0000057)
- Striatum (UBERON_0002345)
- Thyroid (UBERON_0002046)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- BT-474 (CVCL_0179)
- CHO (CVCL_0213)
- CHO-S (CVCL_7183)
- Detroit 551 (CVCL_2434)
- Eveline (CVCL_A1LI)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293SF-3F6 (CVCL_4V95)
- HT-1080 (CVCL_0317)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Jurkat (CVCL_0065)
- LS174T (CVCL_1384)
- MCF-7 (CVCL_0031)
- NCI-H929 (CVCL_1600)
- SK-BR-3 (CVCL_0033)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- EBV-transformed B-cell (CL_0000236)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Hepatocyte (CL_0000182)
- Neutrophil (CL_0000775)
- Platelet (CL_0000233) Plasma Membrane (GO_0005886)
- Plasma Membrane (GO_0005886)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-6)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)Man(a1-3)[NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Structure 572
- N-Linked / Complex / NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1280
- N-Linked / Complex / Structure 1519
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(a2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Hex(?1-?)HexNAc(?1-?)Hex(?1-?)[NeuAc(a2-?)Hex(?1-?)HexNAc(?1-?)Hex(?1-?)]Hex(?1-?)HexNAc(?1-?)[Fuc(?1-?)]HexNAc
- N-Linked / Complex / Structure 9354
- N-Linked / Complex / Structure 9679
- N-Linked / Complex / Structure 9801
- N-Linked / Complex / Structure 9880
- N-Linked / Complex / Structure 10072
- N-Linked / Complex / Structure 10160
- N-Linked / Complex / Structure 10275
- N-Linked / Complex / Structure 10441
- N-Linked / Complex / Structure 10492
- N-Linked / Complex / Structure 10647
- N-Linked / Complex / Structure 10660
- N-Linked / Complex / Structure 10694
- N-Linked / Complex / Structure 10713
- N-Linked / Complex / Structure 10744
- N-Linked / Complex / Structure 10765
- N-Linked / Complex / Structure 10971
- N-Linked / Complex / Structure 11131
- N-Linked / Complex / Structure 11516
- N-Linked / Complex / Structure 11624
- N-Linked / Complex / Structure 11689
- N-Linked / Complex / Structure 11865
- N-Linked / Undefined core / NeuAc(?2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(?2-?)Gal(b1-?)GlcNAc(b1-?)Man(?1-?)]Man(?1-?)[GlcNAc(?1-?)]Man(?1-?)[Fuc(?1-?)]GlcNAc
Reported structure
- Alzheimer's disease (DOID:10652)
- Amyotrophic lateral sclerosis (DOID:0080917)
- Atopic dermatitis (DOID:3310)
- Cancer, breast (DOID:1612)
- Carcinoma, Hepatocellular (DOID:684)
- Carcinoma, Lewis Lung
- Carcinoma, Squamous cell (DOID:1749)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Dyscrasia, Plasma Cell (DOID:6536)
- Esophageal cancer (DOID:5041)
- Familial hepatic adenoma (DOID:111366)
- Gastritis (DOID:4029)
- Hyper IgE syndrome (DOID:0080545)
- Hyper IgE syndrome (HIES, p.Glu340del) (DOID:0080545)
- Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
- Hyper IgE syndrome (PGM3 mutation, p.Leu83Ser) (DOID:0080545)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- IgE myeloma (DOID:9538)
- Leukemia, Myloid, Chronic (DOID:8552)
- Middle East respiratory syndrome (DOID:0080642)
- Mild Cognitive Impairment (DOID:0080832)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
- Schizophrenia (DOID:5419)
- Systemic lupus erythematosus (DOID:9074)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
Disease
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- N-Glycosylation in isolated rat nerve terminals (2021 - Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR) / Status : Reviewed
- Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
- Malignant tissues produce divergent antibody glycosylation of relevance for cancer gene therapy effectiveness. (2020 - Brücher D, Franc V, Smith SN, Heck AJR, Plückthun A) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Exploring Cerebrospinal Fluid IgG N-Glycosylation as Potential Biomarker for Amyotrophic Lateral Sclerosis (2019 - Costa J, Streich L, Pinto S, Pronto-Laborinho A, Nimtz M, Conradt HS, de Carvalho M) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- CSF N-glycoproteomics for early diagnosis in Alzheimer's disease (2016 - Palmigiano A, Barone R, Sturiale L, Sanfilippo C, Bua RO, Romeo DA, Messina A, Capuana ML, Maci T, Le Pira F, Zappia M, Garozzo D) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Quantitative analysis of site-specific N-glycans on sera haptoglobin β chain in liver diseases. (2013 - Zhang S, Jiang K, Sun C, Lu H, Liu Y.) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- B-cell maturation antigen is modified by a single N-glycan chain that modulates ligand binding and surface retention. (2013 - Huang HW, Chen CH, Lin CH, Wong CH, Lin KI) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Structure and characterization of the glycan moiety of L-amino-acid oxidase from the Malayan pit viper Calloselasma rhodostoma. (2001 - Geyer A, Fitzpatrick T, Pawelek P, Kitzing K, Vrielink A, Ghisla S, Macheroux P) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
- Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
- Carbohydrate release from picomole quantities of glycoprotein and characterisation of glycans by high-performance liquid chromatography and mass spectrometry. (1999 - Charlwood J, Birrell H, Camilleri P) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
- Posttranslational modifications of human inter-alpha-inhibitor: identification of glycans and disulfide bridges in heavy chains 1 and 2. (1998 - Olsen E, Rahbek-Nielsen H, Thogersen I, Roepstorff P, Enghild J) / Status : Reviewed
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
- Human alpha-fetoprotein produced from Hep G2 cell line: structure and heterogeneity of the oligosaccharide moiety. (1995 - Ferranti P, Pucci P, Marino G, Fiume I, Terrana B, Ceccarini C, Malorni A) / Status : Reviewed
- Carbohydrate moieties of porcine 32 kDa enamelin. (1995 - Yamakoshi Y) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural differences between complex-type Asn-linked glycan chains of glycoproteins in rat hepatocytes and Zajdela hepatoma cells. (1995 - Goulut-Chassaing C, Bourrillon R) / Status : Reviewed
- Three-dimensional elution mapping of pyridylaminated N-linked neutral and sialyl oligosaccharides. (1995 - Takahashi N, Nakagawa H, Fujikawa K, Kawamura Y, Tomiya N) / Status : Reviewed
- Structural determination of two N-linked glycans isolated from recombinant human lactoferrin expressed in BHK cells. (1995 - Legrand D, Salmon V, Coddeville B, Benaissa M, Plancke Y, Spik G) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Structures of the N-linked oligosaccharides on human plasma vitronectin. (1995 - Ogawa H, Yoneda A, Seno N, Hayashi M, Ishizuka I, Hase S, Matsumoto I) / Status : Reviewed
- Primary structure of the major glycan from human seminal transferrin. (1994 - D'Andrea G, D'Alessandro A, Salucci M, Oratore A) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- The carbohydrate structure of the asparagine-linked oligosaccharides of rat plasma thiostatin. (1994 - Rusiniak M, Bedi G, Back N) / Status : Reviewed
- Tyrosine derivatization and preparative purification of the sialyl and asialy-N-linked oligosaccharides from porcine fibrinogen. (1994 - Da Silva M, Tamura T, McBroom T, Rice K) / Status : Reviewed
- Change in glycosylation of chicken transferrin glycans biosynthesized during embryogenesis and primary culture of embryo hepatocytes. (1994 - Jacquinot P, Leger D, Wieruszeski J, Coddeville B, Montreuil J, Spik G) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- Structures of sugar chains of hen egg yolk riboflavin-binding protein. (1993 - Tarutani M, Norioka N, Mega T, Hase S, Ikenaka T) / Status : Reviewed
- Novel Asn-linked oligosaccharides terminating in GalNAc beta (1-->4)[Fuc alpha (1-->3)]GlcNAc beta (1-->.) are present in recombinant human protein C expressed in human kidney 293 cells. (1993 - Yan S, Chao Y, van Halbeek H) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural study of the N-linked oligosaccharides of hepatocyte growth factor by two-dimensional sugar mapping. (1993 - Hara H, Nakae Y, Sogabe T, Ihara I, Ueno S, Sakai H, Inoue H, Shimizu S, Nakamura T, Shimizu N) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Sugar chains of human cord serum alpha-fetoprotein: characteristics of N-linked sugar chains of glycoproteins produced in human liver and hepatocellular carcinomas. (1993 - Yamashita K, Taketa K, Nishi S, Fukushima K, Ohkura T) / Status : Reviewed
- The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
- Structures of the N-linked oligosaccharides on porcine plasma vitronectin. (1993 - Yoneda A, Ogawa H, Matsumoto I, Ishizuka I, Hase S, Seno N) / Status : Reviewed
- Characterization of the glycosylation on recombinant human low-affinity nerve growth factor receptor (1992 - Settineri, Leung, Cousens, Chapman, Masiarz, Burlingame) / Status : Reviewed
- Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
- Carbohydrate structure of a thrombin-like serine protease from Agkistrodon rhodostoma. Structure elucidation of oligosaccharides by methylation analysis, liquid secondary-ion mass spectrometry and proton magnetic resonance. (1992 - Pfeiffer G, Dabrowski U, Dabrowski J, Stirm S, Strube K, Geyer R) / Status : Reviewed
- Separation and characterization of the two Asn-linked glycosylation sites of chicken serum riboflavin-binding protein. Glycosylation differences despite similarity of primary structure. (1992 - Rohrer J, White H) / Status : Reviewed
- The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
- Structural analysis of the N-linked oligosaccharides from murine glycophorin. (1991 - Angel A, Grnberg G, Krotkiewski H, Lisowska E, Nilsson B) / Status : Reviewed
- Structure determination by 1H NMR spectroscopy of (sulfated) sialylated N-linked carbohydrate chains released from porcine thyroglobulin by peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase-F. (1991 - de Waard P, Koorevaar A, Kamerling J, Vliegenthart J) / Status : Reviewed
- Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Carbohydrate microheterogeneity of rat serotransferrin. Determination of glycan primary structures and characterization of a new type of trisialylated diantennary glycan. (1991 - Spik G, Coddeville B, Strecker G, Montreuil J, Regoeczi E, Chindemi P, Rudolph J) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Structures of the alpha(1-3)-galactose-containing asparagine-linked glycans of a Lewis lung carcinoma cell subline resistant to Aleuria aurantia agglutinin: elucidation by 1H-NMR spectroscopy. (1991 - Debray H, Dus D, Wieruszeski J, Strecker G, Montreuil J) / Status : Reviewed
- Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy. (1991 - Weisshaar G, Hiyama J, Renwick A) / Status : Reviewed
- NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. (1991 - Weisshaar G, Hiyama J, Renwick A, Nimtz M) / Status : Reviewed
- Structure determination of the major N- and O-linked carbohydrate chains of the beta subunit from equine chorionic gonadotropin. (1990 - Damm J, Hard K, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
- Carbohydrate structures of a human tissue plasminogen activator variant expressed in recombinant Chinese hamster ovary cells. (1990 - Nimtz M, Noll G, Pques E, Conradt H) / Status : Reviewed
- Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
- Unique structure of glycopeptide from alpha-fetoprotein produced in human hepatoma cell line, as determined by 1H-nuclear magnetic resonance spectroscopy. (1990 - Terrana B, Tecce M, Manetti R, Ceccarini C, Lamba D, Segre A) / Status : Reviewed
- Sialylated carbohydrate chains of recombinant human glycoproteins expressed in Chinese hamster ovary cells contain traces of N-glycolylneuraminic acid. (1990 - Hokke C, Bergwerff A, van Dedem G, van Oostrum J, Kamerling J, Vliegenthart J) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Analysis of N- and O-glycosidically bound sialooligosaccharides in glycoproteins by high-performance liquid chromatography with pulsed amperometric detection. (1990 - Honda S, Suzuki S, Zaiki S, Kakehi K) / Status : Reviewed
- Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
- Protein and carbohydrate structural analysis of a recombinant soluble CD4 receptor by mass spectrometry. (1989 - Carr SA, Hemling ME, Folena-Wasserman G, Sweet RW, Anumula K, Barr JR, Huddleston MJ, Taylor P) / Status : Reviewed
- The N- and O-linked carbohydrate chains of human, bovine and porcine plasminogen. Species specificity in relation to sialylation and fucosylation patterns. (1988 - Marti T, Schaller J, Rickli E, Schmid K, Kamerling J, Gerwig G, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Identification of a tetrasialylated monofucosylated tetraantennary N-linked carbohydrate chain in human platelet glycocalicin. (1988 - Korrel S, Clemetson K, van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
- The carbohydrate moiety of human platelet glycocalicin: the structures of the major Asn-linked sugar chains. (1987 - Tsuji T, Osawa T) / Status : Reviewed
- Structure of the carbohydrate moiety of human interferon-beta secreted by a recombinant Chinese hamster ovary cell line. (1987 - Conradt HS, Egge H, Peter-Katalinic J, Reiser W, Siklosi T, Schaper K) / Status : Reviewed
- Study of the carbohydrate moiety of human serum sex hormone-binding globulin. (1983 - Avvakumov G, Matveentseva I, Akhrem L, Strel'chyonok O, Akhrem A) / Status : Reviewed
- Primary structure of the N-glycosidically linked sialoglycans of secretory immunoglobulins A from human milk. (1982 - Pierce-Cretel A, Pamblanco M, Strecker G, Montreuil J, Spik G, Dorland L, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Primary structure of the glycans from human lactotransferrin. (1982 - Spik G, Strecker G, Fournet B, Bouquelet S, Montreuil J, Dorland L, van Halbeek H, Vliegenthart J) / Status : Reviewed
- The structures and microheterogeneity of the carbohydrate chains of human plasma ceruloplasmin. A study employing 500-MHz 1H-NMR spectroscopy. (1982 - Endo M, Suzuki K, Schmid K, Fournet B, Karamanos Y, Montreuil J, Dorland L, van Halbeek H, Vliegenthart J) / Status : Reviewed
- The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of human lactoferrin: finding of four novel complex-type asparagine-linked sugar chains. (1982 - Matsumoto A, Yoshima H, Takasaki S, Kobata A) / Status : Reviewed
- Localization of the carbohydrate units in a human immunoglobulin light chain, protein Sm lambda. (1981 - Garver F, Chang L, Kiefer C, Mendicino J, Chandrasekaran E, Isobe T, Osserman E) / Status : Reviewed
- Structures of sialylated O-glycosidically and N-glycosidically linked oligosaccharides in a monoclonal immunoglobulin light chain. (1981 - Chandrasekaran EV, Mendicino A, Garver FA, Mendicino J) / Status : Reviewed
- The asparagine-linked sugar chains of the glycoproteins in calf thymocyte plasma membrane. Structural studies of acidic oligosaccharides. (1980 - Yoshima H, Takasaki S, Kobata A) / Status : Reviewed
- Structure of the carbohydrate units of IgE immunoglobulin. II. Sequence of the sialic acid-containing glycopeptides. (1974 - Baenziger J, Kornfeld S, Kochwa S) / Status : Reviewed
- Structure of the carbohydrate units of IgA1 immunoglobulin. I. Composition, glycopeptide isolation, and structure of the asparagine-linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed
- Investigations on the oligosaccharide units of an A myeloma globulin. (1968 - Dawson G, Clamp JR) / Status : Reviewed
Reference
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- A disintegrin and metalloproteinase with thrombospondin motifs (13adamts13) / Homo sapiens
- Acid ceramidase / Homo sapiens
- ADAM DEC1 / Homo sapiens
- ADAMTS-like protein 2 / Homo sapiens
- Adenosine deaminase 2 / Homo sapiens
- Adhesion G protein-coupled receptor F5 / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Afamin / Homo sapiens
- Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens
-
Alpha-1-acid glycoprotein 1 / Homo sapiens
- Undefined site
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
-
Alpha-fetoprotein / Homo sapiens
- Undefined site
- Asn-251
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Alpha-S1-casein / Homo sapiens
- Angiopoietin-1 receptor / Homo sapiens
- Angiopoietin-related protein 2 / Homo sapiens
- Angiopoietin-related protein 4 / Homo sapiens
- Angiopoietin-related protein 6 / Homo sapiens
- Angiotensin-converting enzyme / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Antithrombin-III / Homo sapiens
- Apolipoprotein (a) / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Apolipoprotein F / Homo sapiens
- Asialoglycoprotein receptor 2 / Homo sapiens
- Asporin / Homo sapiens
- Attractin / Homo sapiens
- Basal cell adhesion molecule / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Beta-Ala-His dipeptidase / Homo sapiens
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
- Biglycan / Homo sapiens
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
- Biotinidase / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- C-C motif chemokine 24 / Homo sapiens
- C4b-binding protein alpha chain / Homo sapiens
- C4b-binding protein beta chain / Homo sapiens
- Cadherin-13 / Homo sapiens
-
Cadherin-5 / Homo sapiens
- Undefined site
- Asn-61
- Cadherin-related family member 5 / Homo sapiens
- Calumenin / Homo sapiens
- Carbonic anhydrase 6 / Homo sapiens
- Carboxypeptidase b2 / Homo sapiens
- Carboxypeptidase Q / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Catalase / Homo sapiens
- Cathepsin D / Homo sapiens
- Cathepsin L1 / Homo sapiens
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- CD109 antigen / Homo sapiens
- CD27 antigen / Homo sapiens
- CD276 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD48 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- CD97 antigen / Homo sapiens
- Ceruloplasmin / Homo sapiens
-
Chimeric plasminogen activator K2-tuPA / Homo sapiens
- Undefined site
- Asn-219
- Cholesteryl ester transfer protein / Homo sapiens
- Cholinesterase / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
- Choriogonadotropin beta chain / Homo sapiens
- Clusterin / Homo sapiens
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
- Coagulation factor V / Homo sapiens
- Coagulation factor VIII / Homo sapiens
- Coagulation factor XI / Homo sapiens
- Coagulation factor XII / Homo sapiens
- Collagen alpha-1(XIV) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement C1q subcomponent subunit A / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement C1r subcomponent-like protein / Homo sapiens
- Complement C2 / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Complement component C9 / Homo sapiens
- Complement factor h / Homo sapiens
- Complement factor H-related protein 3 / Homo sapiens
- Complement factor H-related protein 4 / Homo sapiens
- Complement factor i / Homo sapiens
- Complement receptor type 1 / Homo sapiens
- Contactin-3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Corticotropin-releasing factor-binding protein / Homo sapiens
- Decorin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dickkopf-related protein 3 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 4 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Homo sapiens
- Endothelial cell-selective adhesion molecule / Homo sapiens
- Ephrin-B2 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Epididymis-specific alpha-mannosidase / Homo sapiens
- Erythropoietin / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
- Extracellular superoxide dismutase [Cu-Zn] / Homo sapiens
- Fetuin-B / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibroblast growth factor receptor 1 / Homo sapiens
- Fibroblast growth factor receptor 4 / Homo sapiens
- Fibronectin / Homo sapiens
- Fibronectin type III domain-containing protein 4 / Homo sapiens
- Ficolin-3 / Homo sapiens
-
Follitropin, alpha and beta chains / Homo sapiens
- Undefined site
- Frizzled-4 / Homo sapiens
- G-protein coupled receptor 126 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyltranspeptidase 1 / Homo sapiens
- Gliomedin [Cleaved into: Gliomedin shedded ectodomain] / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Glutamyl aminopeptidase / Homo sapiens
- Glyceraldehyde-3-phosphate dehydrogenase / Homo sapiens
-
Glycocalicin / Homo sapiens
- Undefined site
- Glycodelin-a / Homo sapiens
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Haptoglobin / Homo sapiens
- Helicase POLQ-like / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Hepatocyte growth factor / Homo sapiens
- Hepatocyte growth factor activator / Homo sapiens
-
High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens
- Undefined site
- Histidine-rich glycoprotein / Homo sapiens
- HLA class II histocompatibility antigen gamma chain / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- IgGFc-binding protein / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-367
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Immunoglobulin lambda-1 light chain / Homo sapiens
- Inactive tyrosine-protein kinase 7 / Homo sapiens
- Insulin-like growth factor-binding protein 3 / Homo sapiens
- Integrin alpha-5 / Homo sapiens
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Intercellular adhesion molecule 2 / Homo sapiens
- Interferon alpha/beta receptor 1 / Homo sapiens
-
Interferon beta / Homo sapiens
- Undefined site
- Interleukin-1 receptor antagonist protein / Homo sapiens
- Interleukin-1 receptor type 2 / Homo sapiens
- Interleukin-1 receptor-like 1 / Homo sapiens
- Interleukin-4 receptor subunit alpha / Homo sapiens
- Interleukin-6 receptor subunit beta / Homo sapiens
-
Interstitial collagenase / Homo sapiens
- Undefined site
- Asn-143
- Junction plakoglobin / Homo sapiens
- Keratin, type II cytoskeletal 1 / Homo sapiens
- Kininogen-1 / Homo sapiens
-
L-selectin / Homo sapiens
- Undefined site
- Lactadherin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Leptin receptor / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
- Lipopolysaccharide-binding protein / Homo sapiens
- Lipoprotein lipase / Homo sapiens
-
Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
- Undefined site
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
-
Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
- Undefined site
- Lumican / Homo sapiens
- Lutropin beta chain / Homo sapiens
- Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Macrophage colony-stimulating factor 1 receptor / Homo sapiens
- Macrophage mannose receptor 1 / Homo sapiens
- Macrophage receptor MARCO / Homo sapiens
- Maltase-glucoamylase, intestinal / Homo sapiens
- Mesothelin / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Microtubule-associated serine/threonine-protein kinase 1 / Homo sapiens
- Midasin / Homo sapiens
- Multimerin-1 / Homo sapiens
- Multimerin-2 / Homo sapiens
- Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens
- Neogenin / Homo sapiens
- Neural cell adhesion molecule 2 / Homo sapiens
- Neural cell adhesion molecule L1-like protein / Homo sapiens
- Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens
- Neuron navigator 2 / Homo sapiens
- Neuronal cell adhesion molecule / Homo sapiens
- Noelin / Homo sapiens
- Noelin-2 / Homo sapiens
- Olfactomedin-4 / Homo sapiens
- Oncoprotein-induced transcript 3 protein / Homo sapiens
- Oncostatin-M-specific receptor subunit beta / Homo sapiens
- P-selectin / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Pantetheinase / Homo sapiens
- Peroxidasin homolog / Homo sapiens
- Phosphatidylcholine-sterol acyltransferase / Homo sapiens
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
- Phospholipid transfer protein / Homo sapiens
- Plasma kallikrein / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Asn-308
- Plasminogen activator inhibitor 1 / Homo sapiens
- Platelet endothelial cell adhesion molecule / Homo sapiens
- Platelet glycoprotein 4 / Homo sapiens
- Plexin-B1 / Homo sapiens
- Plexin-B2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prolyl endopeptidase FAP / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Prostatic acid phosphatase / Homo sapiens
- Protein heg homolog 1 / Homo sapiens
- Protein Z-dependent protease inhibitor / Homo sapiens
- Protein-lysine 6-oxidase / Homo sapiens
- Prothrombin / Homo sapiens
- Protocadherin-9 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Receptor-type tyrosine-protein phosphatase eta / Homo sapiens
- Receptor-type tyrosine-protein phosphatase F / Homo sapiens
- Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Reelin / Homo sapiens
- Ribonuclease pancreatic / Homo sapiens
- Roundabout homolog 4 / Homo sapiens
- Secreted frizzled-related protein 3 / Homo sapiens
- Seizure 6-like protein 2 / Homo sapiens
- Selenoprotein P / Homo sapiens
- Semaphorin-4B / Homo sapiens
- Semaphorin-4D / Homo sapiens
- Semaphorin-6A / Homo sapiens
- Serotransferrin / Homo sapiens
-
Sex hormone-binding globulin / Homo sapiens
- Undefined site
- Sialic acid-binding Ig-like lectin 14 / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
- SLIT-ROBO Rho GTPase-activating protein 1 / Homo sapiens
- Sortilin / Homo sapiens
- Sparc / Homo sapiens
- Sparc-like protein 1 / Homo sapiens
- Sulfhydryl oxidase 1 / Homo sapiens
- Suppressor of tumorigenicity 14 protein / Homo sapiens
- Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
- T-cell surface glycoprotein cd4 / Homo sapiens
- Tenascin / Homo sapiens
- Tenascin-X / Homo sapiens
- Teneurin-1 / Homo sapiens
- TGF-beta receptor type-2 / Homo sapiens
- THAP domain-containing protein 5 / Homo sapiens
-
Thrombopoietin / Homo sapiens
- Undefined site
- Thrombospondin-1 / Homo sapiens
- Thyroxine-binding globulin / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- Toll-like receptor 2 / Homo sapiens
- Trans-Golgi network integral membrane protein 2 / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tumor necrosis factor ligand superfamily member 13 / Homo sapiens
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
- Tumor necrosis factor receptor superfamily member 16 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 17 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
- Tyrosine-protein kinase Mer / Homo sapiens
- Tyrosine-protein kinase receptor TYRO3 / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Uncharacterized protein from Pleura / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
- Vasorin / Homo sapiens
- Versican core protein / Homo sapiens
-
Vitamin k-dependent protein c / Homo sapiens
- Undefined site
- Vitronectin / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
- Von willebrand factor / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Acetylcholinesterase / Bos taurus
- Undefined site
- Plasminogen / Bos taurus
-
Uncharacterized protein / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Choriogonadotropin beta chain / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
- BDNF/NT-3 growth factors receptor / Mus musculus
- Complement C1q subcomponent subunit A / Mus musculus
- Fetal antigen 1 / Mus musculus
-
Glycophorin / Mus musculus
- Undefined site
- Limbic system-associated membrane protein / Mus musculus
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
- Tetraspanin-2 / Mus musculus
-
Uncharacterized protein from Lung / Mus musculus
- Undefined site
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
Serotransferrin / Rattus norvegicus
- Undefined site
-
T-kininogen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
32 kDa enamelin / Sus scrofa
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Fibrinogen / Sus scrofa
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Plasminogen / Sus scrofa
-
Thyroglobulin / Sus scrofa
- Undefined site
-
Vitronectin / Sus scrofa
- Undefined site
-
Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012
- Undefined site
-
Ovotransferrin / Gallus gallus
- Undefined site
- Riboflavin-binding protein / Gallus gallus
-
Ancrod / Calloselasma rhodostoma
- Undefined site
-
L-amino acid oxidase / Calloselasma rhodostoma
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- SNFSMPSFPGGSMFR (15aa)
- QCVNLTTR (8aa)
- NPNATSSSSQDPESLQDR (18aa)
- WCPQNSSCVNATACR (15aa)
- SIVLEPIYWNSSNSK (15aa)
- VTACHSSQPNATLYK (15aa)
- GCNDSDVLAVAGFALR (16aa)
- NGNGTACIMANFSAAFSVNYDTK (23aa)
- KQEEAGVRPSAGNVSTHPSLSQRPGGSTKS (30aa)
- NITQIVGHSGCEAK (14aa)
- GTDNITVR (8aa)
- YCNASVTNSVK (11aa)
- VSTNSTR (7aa)
- TAVNCSSDFDACIITK (16aa)
- TAVNCSSDFDACLITK (16aa)
- NNSDISSTR (9aa)
- YKNNSDISSTR (11aa)
- VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTAR (44aa)
- SVTWSESGQNVTAR (14aa)
- LVQGFFPQEPLSVTWSESGQNVTAR (25aa)
- YNSQNQSNNQFVLYR (15aa)
- SLPWNMTK (8aa)
- NLSMPLLPADFHK (13aa)
- GGETAQSADPQWEQLNNKNLSMPLLPADFHK (31aa)
- WFSAGLASNSSWLR (14aa)
- EAENITTGC (9aa)
- ANQQLNFTEAK (11aa)
- KFVGTPEVNQTTLYQRY (17aa)
- FVGTPEVNQTTLYQR (15aa)
- GCVLLSYLNETVTVSASLESVR (22aa)
- RLSPNASAEHLELRW (15aa)
- NWCPYPMSK (9aa)
- AFNSTLPTMAQMEK (14aa)
- ATPEAANASELAALR (15aa)
- YNPSLK (6aa)
- NTSLPHHVGK (10aa)
- NMTFDLPSDATVVLNR (16aa)
- IADAHIDRVENTTVYYIVIDVQESDCSVISR (31aa)
- FHNESLISSQASSY (14aa)
- LNCSVEGMEEPDIQWVK (17aa)
- EGHFYYNISEVK (12aa)
- CSDGWSFDATTLDDNGTMLFFK (22aa)
- GKEGHFYYNISEVK (14aa)
- LDIQMIMIMNGTLYIAAR (18aa)
- SLNENITVPDTK (12aa)
- CLNWLDAQSGLASAPVSGAGNHSYCR (26aa)
- KGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRM (34aa)
- TASNLTVSVLEAEGVFEK (18aa)
- RNESTQNCVVAEPEKM (16aa)
- RALGFENATQALGRA (15aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- FEAEHISNYTALLLSR (16aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
- STYNDTEDVSQASPSESEAR (20aa)
- NK (2aa)
- QLAHQSNSTNIFFSPVSIATAFAMLSLGTK (30aa)
- NGTAVCATNR (10aa)
- RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT (32aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- IIVPLNNRENISDPTSPLR (19aa)
- EWDNTTTECR (10aa)
- ENISDPTSPLR (11aa)
- FNSSGTHFSNLSK (13aa)
- QVHFFVNASDVDNVK (15aa)
- VQNVSQSMEVLELR (14aa)
- TTENYPNAGLIMNYCR (16aa)
- EAVFAVNALNISEK (14aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- QYNPILSMLTNQTGEAGR (18aa)
- DPGAAVPGAANASAQQPR (18aa)
- CPAGTYVSEHCTNTSLR (17aa)
- EGYSNISYIVVNHQGISSR (19aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- DDVLFYNISSMK (12aa)
- WSDIWNATK (9aa)
- NNATVHEQVGGPSLTSDLQAQSK (23aa)
- KNNATVHEQVGGPSLTSDLQAQSKG (25aa)
- KKKEDALNETRE (12aa)
- KKKEDALNETRESETKL (17aa)
- KEDALNETRESETKL (15aa)
- KKEDALNETRESETKL (16aa)
- KKEDALNETRE (11aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- QNQCFYNSSYLNVQR (15aa)
- KAFENVTD (8aa)
- ICNQNSSNPNQR (12aa)
- QIVHSFAEGQDQGSAYANR (19aa)
- VTVRPGESVMVNISAK (16aa)
- HYTNSSQDVTVPCR (14aa)
- AIIQGLMPDQNYTVQIIAYNK (21aa)
- NDENITLETVCHDPK (15aa)
- FLNESYK (7aa)
- NCTITANAECACR (13aa)
- AQIIQGIGFNITER (14aa)
- RADGTVNQIEGEATPVNLTEPAKL (24aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- SVNASNYGLSPDR (13aa)
- IAVQFGPGFSWIANFTK (17aa)
- KTCDWLPKPNMSASCKE (17aa)
- RSHNRSEEFLIAGKL (15aa)
- TGYANVTIYK (10aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- VQNMSQSIEVLDR (13aa)
- EDNSTYIMR (9aa)
- SNSSMHITDCR (11aa)
- TALFPDLLAQGNASLR (16aa)
- KNDTLLGIKG (10aa)
- SIDVSIQNVSVVFK (14aa)
- KFNLTETSEAEIHQSFQHLLRT (22aa)
- VGNNTIHVHR (10aa)
- ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
- LDAFFALEGFPTEPNSSSR (19aa)
- AKLDAFFALEGFPTEPNSSSR (21aa)
- LQLEAVNITDLSENR (15aa)
- HNFSHCCSK (9aa)
- DIVEYYNDSNGSHVLQGR (18aa)
- GQALLVNSSQPWEPLQLHVDK (21aa)
- DTGELNVTSILDR (13aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- SLLEFNTTVSCDQQGTNHR (19aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- YPGNQTTC (8aa)
- GLCVNASAVSR (11aa)
- LHEITNETFR (10aa)
- QGGVNATQVLIQHLR (15aa)
- KVSEHIPVYQQEENQTDVWTLLNGSKD (27aa)
- LAFATMFNSSEQSQK (15aa)
- TQSLLIVNNATNVVIK (16aa)
- KQHSVLHLVPINATSKD (17aa)
- AKSEESFVLNETKK (14aa)
- MLLTFHTDFSNEENGTIMFYK (21aa)
- GINYNSSVAK (10aa)
- NYSLLIDQPDK (11aa)
- KLHINHNNLTESVGPLPK (18aa)
- KKLHINHNNLTESVGPLPKS (20aa)
- TLNQSSDELQLSMGNAMFVK (20aa)
- KLHINHNNLTESVGPLPKS (19aa)
- TINQSSDEIQISMGNAMFVK (20aa)
- LHINHNNLTESVGPLPK (17aa)
- NVTYRPHCHICFTPR (15aa)
- FGCEIENNR (9aa)
- LGACNDTLQQLMEVFK (16aa)
- NGSGAVFPVAGADVQTLR (18aa)
- KNGSGAVFPVAGADVQTLRE (20aa)
- MATPIIMQAIPMGAIPQGPMQNATK (25aa)
- VMVDLCNSTK (10aa)
- VNNGPLGNPIWNISGDPTR (19aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- IIVHPQFYIIQTGADIALLELEEPVNISSR (30aa)
- NHSYHVEGNLVNTNAGFTAR (20aa)
- RGLSFDVSLEVSQGPGLLNDTKV (23aa)
- VLYLAAYNCTLRPVSK (16aa)
- VDNFTQNPGMFR (12aa)
- KEHEGAIYPDNTTDFQRA (18aa)
- KEHEGAIYPDNTTDFQRADDKV (22aa)
- YKEHEGAIYPDNTTDFQR (18aa)
- EHEGAIYPDNTTDFQR (16aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- VNSTVIPETQLQAEDR (16aa)
- YPHKPEINSTTHPGADLQENFCR (23aa)
- SRYPHKPEINSTTHPGADLQENFCR (25aa)
- HKPEINSTTHPGADLQENFCR (21aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- EFGFAWPESLNCSK (14aa)
- RNPPMGGNVVIFDTVITNQEEPYQNHSGR (29aa)
- VLTNQESPYQNHTGR (15aa)
- LPSNSSSPGDITVEGLDGER (20aa)
- IPNNTQWVTWSPVGHK (16aa)
- GNETLHYETFGK (12aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- KVCQDCPLLAPLNDTR (16aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- VCQDCPIIAPINDTR (15aa)
- VCQDCPLLAPLNDTR (15aa)
- NGSFIHSVPR (10aa)
- SHAASDAPENLTLLAETADAR (21aa)
- AGPNGTLFVADAYK (14aa)
- VYKPSAGNNSLYR (13aa)
- RVYKPSAGNNSLYRD (15aa)
- PSAGNNSLYR (10aa)
- ILNQTADMLQLASK (14aa)
- NNCLLK (6aa)
- TLYETEVFSTDFSNISAAK (19aa)
- VYSSANNCTFE (11aa)
- LQGVPHVGANVTLSCQSPR (19aa)
- FVACQMELLHSNGSQR (16aa)
- NSSGVEER (8aa)
- DGTPLSDGQSNHTVSSK (17aa)
- AALAAFNAQNNGSNFQLEEISR (22aa)
- NAQNNGSNFQLEEISR (16aa)
- KREENQEQPRNYSHHQLNRS (20aa)
- AAFNAQNNGSNFQLEEISR (19aa)
- IYNVTYLEPSLR (12aa)
- NIQNNVSCYLEGK (13aa)
- EEQFNSTFR (9aa)
- CPAAGNPTPTIR (12aa)
- LSDLSINSTECLHVHCR (17aa)
- LPEMAQPVDPAHNVSR (16aa)
- PREEQFNSTYR (11aa)
- TKPREEQFNSTYR (13aa)
- EEQFNSTYR (9aa)
- ELQNSVLETTLMPHNYSR (18aa)
- IVVYNQPYINYSR (13aa)
- CRGLVGSKNVSSE (13aa)
- GSKNVSSE (8aa)
- ETFFNLSK (8aa)
- TNPCLHGGR (9aa)
- KGPNCSEPECPGNCHLRG (18aa)
- EHAVFTSNQEEQDPANHTCGVK (22aa)
- KEHAVFTSNQEEQDPANHTCGVKS (24aa)
- KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
- MVSHHNLTTGATLINEQWLLTTAK (24aa)
- QTCFDENECEQNNGGCSEICVNLK (24aa)
- NFTLVTQHPEVIYTNQNVVWSK (22aa)
- KLPPGLLANFTLLRT (15aa)
- RSWPAVGNCSSALRW (15aa)
- SWPAVGNCSSALR (13aa)
- SLTFNETYQDISELVYGAK (19aa)
- NFSCLAVLDLMSR (13aa)
- TVNITITQGL (10aa)
- TVNITITQGLA (11aa)
- VELEDFNGNR (10aa)
- KSIQNVSHLILHMKQ (15aa)
- YKVDYESQSTDTQNFSSESK (20aa)
- VDYESQSTDTQNFSSESK (18aa)
- EIGDNVSMIIVPFK (14aa)
- NCSFSIIYPVVIK (13aa)
- ITYSIVQTNCSK (12aa)
- TPLTANITK (9aa)
- LNDTLLMCLK (10aa)
- NLFLNHSENATAK (13aa)
- QNSSNDLGDHSMKER (15aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- GLTFQQNASSM(SO)CVPDQDTAIR (25aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- GLTFQQNASSM (11aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- LPSGMLVISNATEGDGGLYR (20aa)
- SSELTLTPRPEDHGTNLTCQVK (22aa)
- LGDVEVNAGQNATFQCIATGR (21aa)
- KNLFLNHSENATAKD (15aa)
- CTTSILHNLSHHR (13aa)
- TNSTFVQAIVEHVKEECDR (19aa)
- VVLGANGTYSCLVR (14aa)
- DTFFNLSLK (9aa)
- CVLTFAHEGQQYNITR (16aa)
- YSVANDTGFVDIPK (14aa)
- ASISCTVENETIGVWRPSPPTCEK (24aa)
- AALSWSNGNGTASCR (15aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- FINDSIVDPVDSEWFGFYR (19aa)
- SALEPLVDLPIGINITR (17aa)
- DLPQGFSALEPLVDLPIGINITR (23aa)
- VPTANVSVVDLTCR (14aa)
- VVLHPNYSQVDIGLIK (16aa)
- KVVLHPNYSQVDIGLIKL (18aa)
- NISDGFDGIPDNVDAALALPAHSYSGR (27aa)
- FEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR (39aa)
- NWSLPNR (7aa)
- IQLENVTLLNPDPAEGPKPR (20aa)
- LLANSSMLGEGQVLR (15aa)
- GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
- VLSNNSDANLELINTWVAK (19aa)
- LGNWSAMPSCK (11aa)
- IGNWSAMPSCK (11aa)
- GTQFLAAVLWQLNGTK (16aa)
- ANEQVVQSLNQTYK (14aa)
- KLENSLLDHRNKT (13aa)
- HQDFNSAVQLVENFCR (16aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- GLSFNSISAVDNGSLANTPHLR (22aa)
- GSLSYLNVTR (10aa)
- MIENGSISFIPTIR (14aa)
- YLGNATAIFFLPDEGK (16aa)
- KYTGNASALFILPDQDKM (18aa)
- KYLGNATAIFFLPDEGKL (18aa)
- YIGNATAIFFIPDEGK (16aa)
- THTNISE (7aa)
- WGSDNTIFFTTYANGSCK (18aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- NASVSISHNSCTAPDK (16aa)
- ITDIENGSIANIPR (14aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- NGTITDAVDCALDPLSE (17aa)
- ENETEIIK (8aa)
- ICDLLVANNHFAHFFAPQNLTNMNK (25aa)
- IIAPAYFIIGGNQSGEGCVITR (22aa)
- INGSANFSFNDEEMK (15aa)
- SMVDFMNTDNFTSHR (15aa)
- RHIGHANLTFEQLRS (15aa)
- CFLGNGTGYR (10aa)
- REIRHNSTGCLRM (13aa)
- LNAENNATFYFK (12aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- LPYQGNATMLVVLMEK (16aa)
- MAWPEDHVFISTPSFNYTGR (20aa)
- NQSVNVFLGHTAIDEMLK (18aa)
- VSAITLVSATSTTANMTVGPEGK (23aa)
- EVLSSNVSWR (10aa)
- YIQVVYLHNNNISVVGSSDFCPPGHNTK (28aa)
- NLTTSLTESVDR (12aa)
- RDLGPTLANSTHHNVRL (17aa)
- LGYNANTSILSFQAVCR (17aa)
- IIQVVYIHSNNITK (14aa)
- TADINSSEVEVLYLR (15aa)
- LWNFTMNAK (9aa)
- DNFSPGQEVFYSCEPGYDLR (20aa)
- HVNEINATIYLLK (13aa)
- TAGVNTTDK (9aa)
- KNCTSYGVLDISKC (14aa)
- KMFSQNDTRC (10aa)
- KVAYSNDSANWTEYQDPRT (19aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- FPNITNLCPFGE (12aa)
- NIETFTCDTQNITYR (15aa)
- IHVTNHTEYHGCLQLDNPTHMNNGDYTLMAK (31aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- RLAGKPTHVNVSVVMAEVDGTCY (23aa)
- LAGKPTHVNVSVVM (14aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- GEVFNATR (8aa)
- VFNATR (6aa)
- IDNISLTVNDVR (12aa)
- KKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKI (36aa)
- NPVGLIGAENATGETDPSHSK (21aa)
- GELNTSIFSSRPIDK (15aa)
- LANATTK (7aa)
- AGIQAFFQVQECNK (14aa)
- AGLQAFFQVQECNK (14aa)
- KVSCPIMPCSNATVPDGECCPRC (23aa)
- KVSCPIMPCSNATVPDGECCPR (22aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- DASSFLAEWQNITK (14aa)
- NNICSYVDLMLVHSR (15aa)
- LSWVQDNGTQDELTVEGTR (19aa)
- TLLNASR (7aa)
- DNNSIITR (8aa)
- LANLTQGEDQYYLR (14aa)
- IANITQGEDQYYIR (14aa)
- RLANLTQGEDQYYLRV (16aa)
- LSQGNTTLSINPVK (14aa)
- TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- SHLQNYTVNATK (12aa)
- ANLTGWDPQK (10aa)
- MMQYNVSIK (9aa)
- LVPHMNVSAVEK (12aa)
- LSVATNVSATLTFNTSK (17aa)
- GNEANYYSNATTDEHGLVQF (20aa)
- ENLTAPGSDSAVFFEQGTTR (20aa)
- KENLTAPGSDSAVFFEQGTTRI (22aa)
- YKGLNLTEDTYKPR (14aa)
- YAEDKFNETTEK (12aa)
- QDVNITVATVPSWLK (15aa)
- WEPFGYNVTR (10aa)
- AFQYDTNCSFR (11aa)
- AIIANLTCK (9aa)
- LNDTTLQVLNTWYTK (15aa)
- TMVFPVMYLNESVHIDK (17aa)
- AVNITSENLIDDVVSLIR (18aa)
- NFTENDLLVR (10aa)
- INYTVPQSGTFK (12aa)
- RLSLLEEPGNGTFTVILNQLTSRD (24aa)
- SFHNFTLCYIK (11aa)
- ENVSMVDYAHNNYQAQSAVPLR (22aa)
- CGLVPVLAENYNK (13aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- NHSCEPCQTLAVR (13aa)
- DIYQFLCNASER (12aa)
- FNTANDDNVTQVR (13aa)
- TQNFTLLVQGSPELK (15aa)
- ELLEEVGQNGSR (12aa)
- HIPGLIHNMTAR (12aa)
- SDFSQTMLFQANTTR (15aa)
- VTNDTESDINYLLK (14aa)
- FNSTEYQVVTR (11aa)
- TVNYTCDPHPDR (12aa)
- AIPQPQNVTSIIGCTH (16aa)
- ALPQPQNVTSLLGCTH (16aa)
- ISVQVHNATCTVR (13aa)
- APQHVVNHLPPYTNVSLK (18aa)
- LHNETR (6aa)
- NNTMIR (6aa)
- VPGNVTAVIGETIK (14aa)
- KVPGNVTAVLGETLKV (16aa)
- FGNETFIIHLDNGR (14aa)
- DFTLNETVNSIFAQGAPR (18aa)
- NFTEVHPDYGSHIQALLDK (19aa)
- SYNDSVDPR (9aa)
- CDGWADCTDHSDEINCSCDAGHQFTCK (27aa)
- DWASNASSGLTAQAR (15aa)
- ANGTTHLVVTEPTR (14aa)
- LISNCSK (7aa)
- LQAPLNYTEFQKPICLPSK (19aa)
- LAFQNMNGSEYFVK (14aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- KYWCKWNNTGCQALPSQDEGPSKA (24aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- WNNTGCQALPSQDEGPSK (18aa)
- MSGECAPNVSVSVSTSHTTISGGGSR (26aa)
- DNASDK (6aa)
- YGNPNETQNNSTSWPVFK (18aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- VFGSQNLTTVK (11aa)
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
- SCSLEGNPVACINLSFCLNASGK (23aa)
- RPSLQMNTSIWYNR (14aa)
- DQCIVDDITYNVNDTFHK (18aa)
- EWNGTYHCIFR (11aa)
- CQIAGWGHLDENVSGYSSSLR (21aa)
- AAIPSALDTNSSK (13aa)
- KAAIPSALDTNSSKS (15aa)
- LGYNANTSVLSFQAVCR (17aa)
- SHGVQTMVVLNNLEPNTTYEIR (22aa)
- NSTLDPGKPEMMK (13aa)
- ANLSSQALQM (10aa)
- WTEDNITSSVLFNR (14aa)
- SPTNTTPHVPAEGPEASRPPK (21aa)
- MAEVIGSKLNISR (13aa)
- TCPAGVMGENNTLVWK (16aa)
- LYQDVNCT (8aa)
- SVSEINPTTQMK (12aa)
- HNFNASSVSWCSK (13aa)
- QQQHLFGSNVTDCSGNF (17aa)