Hex:3 HexNAc:7

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Gallus gallus (Chicken)
• Dirofilaria immitus (Canine heartworm nematode)
• Trichinella spiralis

Protein

• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Anoctamin-6 / Homo sapiens    Q4KMQ2
• Band 4.1-like protein 3 / Homo sapiens    Q9Y2J2
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• Biglycan / Homo sapiens    P21810
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Complement c3 / Homo sapiens    P01024
• Coronin-1C / Homo sapiens    Q9ULV4
• Desmocollin-2 / Homo sapiens    Q02487
• Dynein heavy chain 11, axonemal / Homo sapiens    Q96DT5
• Fibrillin-1 / Homo sapiens    P35555
• Fibronectin / Homo sapiens    P02751
• Hemopexin / Homo sapiens    P02790
• Interleukin-1 receptor accessory protein / Homo sapiens    Q9NPH3
• Junctional adhesion molecule A / Homo sapiens    Q9Y624
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-1 / Homo sapiens    P25391
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Microtubule-associated protein 10 / Homo sapiens    Q9P2G4
• Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens    O60566
• Neural cell adhesion molecule L1 / Homo sapiens    P32004
• Periostin / Homo sapiens    Q15063
• Probable lysosomal cobalamin transporter / Homo sapiens    Q9NUN5
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prothrombin / Homo sapiens    P00734
• Pseudopodium-enriched atypical kinase 1 / Homo sapiens    Q9H792
• Secretogranin-3 / Homo sapiens    Q8WXD2
• Serotransferrin / Homo sapiens    P02787
• Sparc / Homo sapiens    P09486
• Spondin-1 / Homo sapiens    Q9HCB6
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Uromodulin / Homo sapiens    P07911
• Vacuolar protein sorting-associated protein 13A / Homo sapiens    Q96RL7
• Vitronectin / Homo sapiens    P04004
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Hypoxia up-regulated protein 1 / Mus musculus    Q9JKR6
• Neutral cholesterol ester hydrolase 1 / Mus musculus    Q8BLF1
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Sortilin / Mus musculus    Q6PHU5
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein / Gallus gallus    
• Uncharacterized protein / Dirofilaria immitus    
• Tsl-1 antigens / Trichinella spiralis    

Source

• Brain (UBERON_0000955)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Urine (UBERON_0001088)  
• Egg Cell  
• Egg Cell   Egg White  

Reported structure

• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)][GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x HexNAc(b1-?)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GalNAc(b1-4)"
• N-Linked / Complex / Structure 9389
• N-Linked / Complex / Structure 11228

Composition

• Hex:3 HexNAc:7 (avg mass : 1926.8075 )

Disease

• Cancer, breast (DOID:1612)
• Control/Healthy
• Prostate cancer (DOID:10283)

Reference

• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
• Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed

Reported glycosite

• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-271
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-261
• Anoctamin-6 / Homo sapiens
  •        Asn-361
• Band 4.1-like protein 3 / Homo sapiens
  •        Asn-734
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-89
• Biglycan / Homo sapiens
  •        Asn-270
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2528
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
  •        Asn-785
• Collagen alpha-3(VI) chain / Homo sapiens
  •        Asn-2558
• Complement c3 / Homo sapiens
  •        Asn-939
• Coronin-1C / Homo sapiens
  •        Asn-185
• Desmocollin-2 / Homo sapiens
  •        Asn-392
• Dynein heavy chain 11, axonemal / Homo sapiens
  •        Asn-3201
• Fibrillin-1 / Homo sapiens
  •        Asn-1581
• Fibronectin / Homo sapiens
  •        Asn-430
• Hemopexin / Homo sapiens
  •        Asn-64
  •        Asn-453
• Interleukin-1 receptor accessory protein / Homo sapiens
  •        Asn-118
• Junctional adhesion molecule A / Homo sapiens
  •        Asn-185
• Lactotransferrin / Homo sapiens
  •        Asn-156
• Laminin subunit alpha-1 / Homo sapiens
  •        Asn-2098
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-2126
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-215
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-2707
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-650
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-261
• Microtubule-associated protein 10 / Homo sapiens
  •        Asn-694
• Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
  •        Asn-983
• Neural cell adhesion molecule L1 / Homo sapiens
  •        Asn-294
• Periostin / Homo sapiens
  •        Asn-599
• Probable lysosomal cobalamin transporter / Homo sapiens
  •        Asn-78
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-1645
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Prothrombin / Homo sapiens
  •        Asn-416
• Pseudopodium-enriched atypical kinase 1 / Homo sapiens
  •        Asn-589
• Secretogranin-3 / Homo sapiens
  •        Asn-346
• Serotransferrin / Homo sapiens
  •        Asn-432
• Sparc / Homo sapiens
  •        Asn-116
• Spondin-1 / Homo sapiens
  •        Asn-214
• Thrombospondin-1 / Homo sapiens
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-1069
• Uromodulin / Homo sapiens
  •        Asn-513
• Vacuolar protein sorting-associated protein 13A / Homo sapiens
  •        Asn-1071
• Vitronectin / Homo sapiens
  •        Asn-169
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-752
• Hypoxia up-regulated protein 1 / Mus musculus
  •        Asn-596
• Neutral cholesterol ester hydrolase 1 / Mus musculus
  •        Asn-270
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-220
• Sortilin / Mus musculus
  •        Asn-404
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Dirofilaria immitus
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site

Mass spectrometry observed peptide

• CSDGWSFDATTLDDNGTMLFFK (22aa)
  •    P02790    Asn-64     Hemopexin / Homo sapiens
• NQNGTFK (7aa)
  •    Q9NUN5    Asn-78     Probable lysosomal cobalamin transporter / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• AIVNFTR (7aa)
  •    P98160    Asn-89     Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• VCSNDNK (7aa)
  •    P09486    Asn-116     Sparc / Homo sapiens
• NTTYCSK (7aa)
  •    Q9NPH3    Asn-118     Interleukin-1 receptor accessory protein / Homo sapiens
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140     Collagen alpha-2(VI) chain / Homo sapiens
• RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• AFSNSSYVINPTTGEIVFDPISASDTGEYSCEAR (34aa)
  •    Q9Y624    Asn-185     Junctional adhesion molecule A / Homo sapiens
• NGSLICTASK (10aa)
  •    Q9ULV4    Asn-185     Coronin-1C / Homo sapiens
• ITFYGNWSEK (10aa)
  •    Q9HCB6    Asn-214     Spondin-1 / Homo sapiens
• NTTGFK (6aa)
  •    Q16363    Asn-215     Laminin subunit alpha-4 / Homo sapiens
• RDEDAENLGHFVMFPANGSIDLMYFPYYGK (30aa)
  •    P14231    Asn-220     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• FPQVNVTK (8aa)
  •    P54802    Asn-261     Alpha-n-acetylglucosaminidase / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• GNYDFVEAMIVNNHTSLDVER (21aa)
  •    Q8BLF1    Asn-270     Neutral cholesterol ester hydrolase 1 / Mus musculus
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• VTYQNHNK (8aa)
  •    P32004    Asn-294     Neural cell adhesion molecule L1 / Homo sapiens
• MFSQNDTR (8aa)
  •    P02750    Asn-325     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• NATDNISK (8aa)
  •    Q8WXD2    Asn-346     Secretogranin-3 / Homo sapiens
• LNITCESSK (9aa)
  •    Q4KMQ2    Asn-361     Anoctamin-6 / Homo sapiens
• ANYTILK (7aa)
  •    Q02487    Asn-392     Desmocollin-2 / Homo sapiens
• HLYTTTGGETDFTNVTSLR (19aa)
  •    Q6PHU5    Asn-404     Sortilin / Mus musculus
• NFTENDLLVR (10aa)
  •    P00734    Asn-416     Prothrombin / Homo sapiens
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• CGIVPVIAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• AIPQPQNVTSIIGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens
• LGNTISSLFGGGTSSDAKENGTDAVQEEEESPAEGSKDEPAEQGELKEEAEPPAEETSQPPPSEPK (66aa)
  •    Q9JKR6    Asn-596     Hypoxia up-regulated protein 1 / Mus musculus
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• IINNITSIK (9aa)
  •    P11047    Asn-650     Laminin subunit gamma-1 / Homo sapiens
• ANYSLQIYPDESHYFHSVALK (21aa)
  •    Q9Z218    Asn-752     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• VVPEGIRMNK (10aa)
  •    P01024    Asn-939     Complement c3 / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• VVNSTTGTGEHIR (13aa)
  •    P35442    Asn-1069     Thrombospondin-2 / Homo sapiens
• NLSEIK (6aa)
  •    P25391    Asn-2098     Laminin subunit alpha-1 / Homo sapiens
  •    O60566    Asn-983     Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
  •    Q96DT5    Asn-3201     Dynein heavy chain 11, axonemal / Homo sapiens
  •    P24043    Asn-2126     Laminin subunit alpha-2 / Homo sapiens
  •    Q9H792    Asn-589     Pseudopodium-enriched atypical kinase 1 / Homo sapiens
  •    Q9P2G4    Asn-694     Microtubule-associated protein 10 / Homo sapiens
  •    Q9Y2J2    Asn-734     Band 4.1-like protein 3 / Homo sapiens
  •    Q96RL7    Asn-1071     Vacuolar protein sorting-associated protein 13A / Homo sapiens
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581     Fibrillin-1 / Homo sapiens
• AFINGTGVETVVSADIPNAHGIAVDWVSR (29aa)
  •    Q07954    Asn-1645     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• QLINALQINNTAVGH (15aa)
  •    P12111    Asn-2558     Collagen alpha-3(VI) chain / Homo sapiens
• NASLALSASIGR (12aa)
  •    O15230    Asn-2707     Laminin subunit alpha-5 / Homo sapiens