taxonomy (5)
protein (56)
source (6)
structure (8)
composition (1)
disease (3)
reference (10)
site (58)
peptide (45)
- Homo sapiens (Human)
- Mus musculus (House mouse)
- Gallus gallus (Chicken)
- Dirofilaria immitus (Canine heartworm nematode)
- Trichinella spiralis
Taxonomy
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Anoctamin-6 / Homo sapiens Q4KMQ2
- Band 4.1-like protein 3 / Homo sapiens Q9Y2J2
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- Biglycan / Homo sapiens P21810
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Collagen alpha-3(VI) chain / Homo sapiens P12111
- Complement c3 / Homo sapiens P01024
- Coronin-1C / Homo sapiens Q9ULV4
- Desmocollin-2 / Homo sapiens Q02487
- Dynein heavy chain 11, axonemal / Homo sapiens Q96DT5
- Fibrillin-1 / Homo sapiens P35555
- Fibronectin / Homo sapiens P02751
- Hemopexin / Homo sapiens P02790
- Interleukin-1 receptor accessory protein / Homo sapiens Q9NPH3
- Junctional adhesion molecule A / Homo sapiens Q9Y624
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-1 / Homo sapiens P25391
- Laminin subunit alpha-2 / Homo sapiens P24043
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Laminin subunit alpha-5 / Homo sapiens O15230
- Laminin subunit gamma-1 / Homo sapiens P11047
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Microtubule-associated protein 10 / Homo sapiens Q9P2G4
- Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens O60566
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Periostin / Homo sapiens Q15063
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Prolactin-inducible protein / Homo sapiens P12273
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prothrombin / Homo sapiens P00734
- Pseudopodium-enriched atypical kinase 1 / Homo sapiens Q9H792
- Secretogranin-3 / Homo sapiens Q8WXD2
- Serotransferrin / Homo sapiens P02787
- Sparc / Homo sapiens P09486
- Spondin-1 / Homo sapiens Q9HCB6
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Uromodulin / Homo sapiens P07911
- Vacuolar protein sorting-associated protein 13A / Homo sapiens Q96RL7
- Vitronectin / Homo sapiens P04004
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Neutral cholesterol ester hydrolase 1 / Mus musculus Q8BLF1
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Sortilin / Mus musculus Q6PHU5
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Uncharacterized protein / Dirofilaria immitus
- Tsl-1 antigens / Trichinella spiralis
Protein
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Urine (UBERON_0001088)
- Egg Cell
- Egg Cell Egg White
Source
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)][GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GalNAc(b1-4)"
- N-Linked / Complex / Structure 9389
- N-Linked / Complex / Structure 11228
Reported structure
- Hex:3 HexNAc:7 (avg mass : 1926.8075 )
Composition
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
Reference
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Anoctamin-6 / Homo sapiens
- Band 4.1-like protein 3 / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Biglycan / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Coronin-1C / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dynein heavy chain 11, axonemal / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Hemopexin / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Junctional adhesion molecule A / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-1 / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Microtubule-associated protein 10 / Homo sapiens
- Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Periostin / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prothrombin / Homo sapiens
- Pseudopodium-enriched atypical kinase 1 / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Sparc / Homo sapiens
- Spondin-1 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Uromodulin / Homo sapiens
- Vacuolar protein sorting-associated protein 13A / Homo sapiens
- Vitronectin / Homo sapiens
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Neutral cholesterol ester hydrolase 1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sortilin / Mus musculus
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
Reported glycosite
- CSDGWSFDATTLDDNGTMLFFK (22aa)
- NQNGTFK (7aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- AIVNFTR (7aa)
- TFYWDFYTNR (10aa)
- VCSNDNK (7aa)
- NTTYCSK (7aa)
- GTFTDCALANMTEQIR (16aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- NGSLFAFR (8aa)
- AFSNSSYVINPTTGEIVFDPISASDTGEYSCEAR (34aa)
- NGSLICTASK (10aa)
- ITFYGNWSEK (10aa)
- NTTGFK (6aa)
- RDEDAENLGHFVMFPANGSIDLMYFPYYGK (30aa)
- FPQVNVTK (8aa)
- IININPNK (8aa)
- MIENGSISFIPTIR (14aa)
- GNYDFVEAMIVNNHTSLDVER (21aa)
- YIGNATAIFFIPDEGK (16aa)
- VTYQNHNK (8aa)
- MFSQNDTR (8aa)
- NATDNISK (8aa)
- LNITCESSK (9aa)
- ANYTILK (7aa)
- HLYTTTGGETDFTNVTSLR (19aa)
- NFTENDLLVR (10aa)
- NYTDCTSEGR (10aa)
- CGIVPVIAENYNK (13aa)
- AIPQPQNVTSIIGCTH (16aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- LGNTISSLFGGGTSSDAKENGTDAVQEEEESPAEGSKDEPAEQGELKEEAEPPAEETSQPPPSEPK (66aa)
- EVNDTLLVNELK (12aa)
- IINNITSIK (9aa)
- ANYSLQIYPDESHYFHSVALK (21aa)
- NMTLFSDLVAEK (12aa)
- VVPEGIRMNK (10aa)
- VVNSTTGPGEHIR (13aa)
- VVNSTTGTGEHIR (13aa)
- NLSEIK (6aa)
- P24043 Asn-2126     Laminin subunit alpha-2 / Homo sapiens
- Q9H792 Asn-589     Pseudopodium-enriched atypical kinase 1 / Homo sapiens
- Q96RL7 Asn-1071     Vacuolar protein sorting-associated protein 13A / Homo sapiens
- Q9P2G4 Asn-694     Microtubule-associated protein 10 / Homo sapiens
- Q9Y2J2 Asn-734     Band 4.1-like protein 3 / Homo sapiens
- P25391 Asn-2098     Laminin subunit alpha-1 / Homo sapiens
- Q96DT5 Asn-3201     Dynein heavy chain 11, axonemal / Homo sapiens
- O60566 Asn-983     Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
- AWGTPCEMCPAVNTSEYK (18aa)
- AFINGTGVETVVSADIPNAHGIAVDWVSR (29aa)
- MIEAYNITEK (10aa)
- QLINALQINNTAVGH (15aa)
- NASLALSASIGR (12aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1926.8075)
- Egg Cell
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1926.8075)
- Egg Cell
-
Ovomucoid / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1926.8075)
- Control/Healthy
- Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
-
Ovomucoid / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1926.8075)
- Egg Cell
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1926.8075)
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 1926.8075)
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1926.8075)
- Milk (UBERON_0001913)
- Lactotransferrin / Homo sapiens
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
-
- N-Linked / Complex
(avg mass : 1926.8075)
- Control/Healthy
-
- Hex:3 HexNAc:7 / N-Linked
(avg mass : 1926.8075)
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)][GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GalNAc(b1-4)"
- N-Linked / Complex / Structure 9389
- N-Linked / Complex / Structure 11228
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Anoctamin-6 / Homo sapiens
- Band 4.1-like protein 3 / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Biglycan / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Coronin-1C / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dynein heavy chain 11, axonemal / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Hemopexin / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Junctional adhesion molecule A / Homo sapiens
- Laminin subunit alpha-1 / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Microtubule-associated protein 10 / Homo sapiens
- Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Periostin / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prothrombin / Homo sapiens
- Pseudopodium-enriched atypical kinase 1 / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Sparc / Homo sapiens
- Spondin-1 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Uromodulin / Homo sapiens
- Vacuolar protein sorting-associated protein 13A / Homo sapiens
- Vitronectin / Homo sapiens
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Neutral cholesterol ester hydrolase 1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sortilin / Mus musculus
- CSDGWSFDATTLDDNGTMLFFK (22aa)
- NQNGTFK (7aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- AIVNFTR (7aa)
- TFYWDFYTNR (10aa)
- VCSNDNK (7aa)
- NTTYCSK (7aa)
- GTFTDCALANMTEQIR (16aa)
- NGSLFAFR (8aa)
- AFSNSSYVINPTTGEIVFDPISASDTGEYSCEAR (34aa)
- NGSLICTASK (10aa)
- ITFYGNWSEK (10aa)
- NTTGFK (6aa)
- RDEDAENLGHFVMFPANGSIDLMYFPYYGK (30aa)
- FPQVNVTK (8aa)
- IININPNK (8aa)
- MIENGSISFIPTIR (14aa)
- GNYDFVEAMIVNNHTSLDVER (21aa)
- YIGNATAIFFIPDEGK (16aa)
- VTYQNHNK (8aa)
- MFSQNDTR (8aa)
- NATDNISK (8aa)
- LNITCESSK (9aa)
- ANYTILK (7aa)
- HLYTTTGGETDFTNVTSLR (19aa)
- NFTENDLLVR (10aa)
- NYTDCTSEGR (10aa)
- CGIVPVIAENYNK (13aa)
- AIPQPQNVTSIIGCTH (16aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- LGNTISSLFGGGTSSDAKENGTDAVQEEEESPAEGSKDEPAEQGELKEEAEPPAEETSQPPPSEPK (66aa)
- EVNDTLLVNELK (12aa)
- IINNITSIK (9aa)
- ANYSLQIYPDESHYFHSVALK (21aa)
- NMTLFSDLVAEK (12aa)
- VVPEGIRMNK (10aa)
- VVNSTTGPGEHIR (13aa)
- VVNSTTGTGEHIR (13aa)
- NLSEIK (6aa)
- P24043 Asn-2126     Laminin subunit alpha-2 / Homo sapiens
- Q9H792 Asn-589     Pseudopodium-enriched atypical kinase 1 / Homo sapiens
- Q96RL7 Asn-1071     Vacuolar protein sorting-associated protein 13A / Homo sapiens
- Q9P2G4 Asn-694     Microtubule-associated protein 10 / Homo sapiens
- Q9Y2J2 Asn-734     Band 4.1-like protein 3 / Homo sapiens
- P25391 Asn-2098     Laminin subunit alpha-1 / Homo sapiens
- Q96DT5 Asn-3201     Dynein heavy chain 11, axonemal / Homo sapiens
- O60566 Asn-983     Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
- AWGTPCEMCPAVNTSEYK (18aa)
- AFINGTGVETVVSADIPNAHGIAVDWVSR (29aa)
- MIEAYNITEK (10aa)
- QLINALQINNTAVGH (15aa)
- NASLALSASIGR (12aa)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:7 / N-Linked
(avg mass : 1926.8075)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1926.8075)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1926.8075)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1926.8075)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1926.8075)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1926.8075)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1926.8075)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1926.8075)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1926.8075)