Hex:5 HexNAc:5 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Equus caballus (Domestic horse)
• Felis catus (Cat)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-fetoprotein / Homo sapiens    P02771
• Alpha-S1-casein / Homo sapiens    P47710
• Angiopoietin-related protein 6 / Homo sapiens    Q8NI99
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Anoctamin-6 / Homo sapiens    Q4KMQ2
• Asporin / Homo sapiens    Q9BXN1
• Beta/gamma crystallin domain-containing protein 1 / Homo sapiens    Q9Y4K1
• Biglycan / Homo sapiens    P21810
• Butyrophilin subfamily 1 member A1 / Homo sapiens    Q13410
• Cadherin-5 / Homo sapiens    P33151
• Calumenin / Homo sapiens    O43852
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Cartilage oligomeric matrix protein / Homo sapiens    P49747
• Catalase / Homo sapiens    P04040
• CD166 antigen / Homo sapiens    Q13740
• CD44 antigen / Homo sapiens    P16070
• CD59 glycoprotein / Homo sapiens    P13987
• Ceruloplasmin / Homo sapiens    P00450
• Chordin-like protein 2 / Homo sapiens    Q6WN34
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Complement c1r subcomponent / Homo sapiens    P00736
• Complement C2 / Homo sapiens    P06681
• Complement C5 / Homo sapiens    P01031
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Decorin / Homo sapiens    P07585
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Ectopic P granules protein 5 homolog / Homo sapiens    Q9HCE0
• Ephrin-A3 / Homo sapiens    P52797
• Epidermal growth factor receptor / Homo sapiens    P00533
• Fibrillin-1 / Homo sapiens    P35555
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Glycophorin-A / Homo sapiens    P02724
• Golgi membrane protein 1 / Homo sapiens    Q8NBJ4
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Heparin cofactor 2 / Homo sapiens    P05546
• Immunoglobulin alpha (non secretory) / Homo sapiens    P01877    P01876
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens    P0DOX2
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin gamma-1 heavy chain / Homo sapiens    P0DOX5
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens    P01877
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens    P01880
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Immunoglobulin kappa chain V-I region CAR / Homo sapiens    P01596
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit beta-1 / Homo sapiens    P07942
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Membrane primary amine oxidase / Homo sapiens    Q16853
• Mesothelin / Homo sapiens    Q13421
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Microtubule-associated serine/threonine-protein kinase 1 / Homo sapiens    Q9Y2H9
• Mucin-5B / Homo sapiens    Q9HC84
• Multimerin-1 / Homo sapiens    Q13201
• Multiple epidermal growth factor-like domains protein 8 / Homo sapiens    Q7Z7M0
• Neuroendocrine convertase 2 / Homo sapiens    P16519
• Neuron navigator 2 / Homo sapiens    Q8IVL1
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Periostin / Homo sapiens    Q15063
• Plasma protease c1 inhibitor / Homo sapiens    P05155
• Platelet glycoprotein 4 / Homo sapiens    P16671
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolargin / Homo sapiens    P51888
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Protein AMBP / Homo sapiens    P02760
• Prothrombin / Homo sapiens    P00734
• Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens    Q5H9R7
• Short transient receptor potential channel 6 / Homo sapiens    Q9Y210
• Thrombospondin-1 / Homo sapiens    P07996
• Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens    Q9Y274
• Tyrosine-protein kinase Mer / Homo sapiens    Q12866
• Uncharacterized protein from Blood Serum / Homo sapiens    
• Vitronectin / Homo sapiens    P04004
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Immunoglobulin gamma / Equus caballus    
• Immunoglobulin gamma / Felis catus    
• Fetal antigen 1 / Mus musculus    Q09163
• Immunoglobulin gamma / Ovis aries    
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Neuroligin 1 / Rattus norvegicus    Q62765
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Immunoglobulin gamma / Gallus gallus    
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amniotic Fluid (UBERON_0000173)  
• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Colon (UBERON_0001155)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Liver (UBERON_0002107)  
• Mammalian Vulva (UBERON_0000997)   A-431 (CVCL_0037)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Seminal Fluid (UBERON_0006530)  
• Umbilical Vein (UBERON_0002066)   HUVEC-C (CVCL_2959)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Yolk Sac (UBERON_0001040)  
• CHO (CVCL_0213)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• LS174T (CVCL_1384)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  
• EBV-transformed B-cell (CL_0000236)  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  
• Neutrophil (CL_0000775)  
• Microsome (GO_0005792)  

Reported structure

• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4) + NeuAc(a2-6)"
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ HexNAc"
• N-Linked / Complex / Structure 1049
• N-Linked / Complex / Structure 1149
• N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 2 x Gal(b1-4) + NeuAc(a2-6)"
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ HexNAc"
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 9487
• N-Linked / Complex / Structure 9734
• N-Linked / Complex / Structure 9892
• N-Linked / Complex / Structure 10083
• N-Linked / Complex / Structure 10203
• N-Linked / Complex / Structure 10227
• N-Linked / Complex / Structure 10231
• N-Linked / Complex / Structure 10264
• N-Linked / Complex / Structure 10451
• N-Linked / Complex / Structure 10495
• N-Linked / Complex / Structure 10532
• N-Linked / Complex / Structure 10544
• N-Linked / Complex / Structure 10910
• N-Linked / Complex / Structure 10918
• N-Linked / Complex / Structure 10955
• N-Linked / Complex / Structure 10992
• N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-3)GalNAc(b1-4)GlcNAc(?1-?)[GlcNAc(?1-?)]Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc

Composition

• Hex:5 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2282.1032 )

Disease

• Atopic dermatitis (DOID:3310)
• Cancer, breast (DOID:1612)
• Carcinoma, Squamous cell (DOID:1749)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Gastritis (DOID:4029)
• Hyper IgE syndrome (DOID:0080545)
• Hyper IgE syndrome (HIES, p.Glu340del) (DOID:0080545)
• Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
• Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
• Hyper IgE syndrome (PGM3 mutation, p.Leu83Ser) (DOID:0080545)
• Hyperimmune condition
• Hypersensitivity reaction disease (DOID:0060056)
• IgE myeloma (DOID:9538)
• Mixed phenotype acute leukemia (DOID:9953)
• Myeloma, Multiple (DOID:9538)
• Prostate cancer (DOID:10283)
• Systemic lupus erythematosus (DOID:9074)
• Tumor, Endodermal Sinus (DOID:1911)

Reference

• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• B-cell precursor acute lymphoblastic leukemia with MLL rearrangement shows extensive glycomic-related changes (2021 - Oliveira T) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
• A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
• Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
• Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
• Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
• Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
• The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
• Fractionation and characterization of boar seminal plasma spermadhesion PSP-II glycoforms reveal the presence of uncommon N-acetylgalactosamine-containing N-linked oligosaccharides. (1997 - Solis D, Calvete J, Sanz L, Hettel C, Raida M, Diaz-Maurio T, Tpfer-Petersen E) / Status : Reviewed
• Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
• Three-dimensional elution mapping of pyridylaminated N-linked neutral and sialyl oligosaccharides. (1995 - Takahashi N, Nakagawa H, Fujikawa K, Kawamura Y, Tomiya N) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
• Sugar chain of alpha-fetoprotein produced in human yolk sac tumor. (1983 - Yamashita K, Hitoi A, Tsuchida Y, Nishi S, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked sugar chains of glycophorin A. (1980 - Yoshima H, Furthmayr H, Kobata A) / Status : Reviewed

Reported glycosite

• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-271
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-1424
• Alpha-fetoprotein / Homo sapiens
  •        Asn-251
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiopoietin-related protein 6 / Homo sapiens
  •        Asn-58
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Anoctamin-6 / Homo sapiens
  •        Asn-361
• Asporin / Homo sapiens
  •        Asn-282
• Beta/gamma crystallin domain-containing protein 1 / Homo sapiens
  •        Asn-1462
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Butyrophilin subfamily 1 member A1 / Homo sapiens
  •        Asn-55
• Cadherin-5 / Homo sapiens
  •        Undefined site
• Calumenin / Homo sapiens
  •        Asn-131
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Cartilage oligomeric matrix protein / Homo sapiens
  •        Asn-121
• Catalase / Homo sapiens
  •        Asn-481
• CD166 antigen / Homo sapiens
  •        Asn-306
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Ceruloplasmin / Homo sapiens
  •        Asn-762
• Chordin-like protein 2 / Homo sapiens
  •        Asn-114
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
  •        Asn-374
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2679
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Complement c1r subcomponent / Homo sapiens
  •        Asn-125
• Complement C2 / Homo sapiens
  •        Asn-651
• Complement C5 / Homo sapiens
  •        Asn-1115
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-31
• Decorin / Homo sapiens
  •        Asn-262
  •        Asn-303
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-276
• Ectopic P granules protein 5 homolog / Homo sapiens
  •        Asn-137
• Ephrin-A3 / Homo sapiens
  •        Asn-100
• Epidermal growth factor receptor / Homo sapiens
  •        Undefined site
• Fibrillin-1 / Homo sapiens
  •        Asn-1581
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
• Glycophorin-A / Homo sapiens
  •        Undefined site
• Golgi membrane protein 1 / Homo sapiens
  •        Asn-109
• Haptoglobin / Homo sapiens
  •        Asn-184
• Hemopexin / Homo sapiens
  •        Asn-453
• Heparin cofactor 2 / Homo sapiens
  •        Asn-49
  •        Asn-188
• Immunoglobulin alpha (non secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Undefined site
  •        Asn-21
  •        Asn-49
  •        Asn-99
  •        Asn-146
  •        Asn-252
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-1 heavy chain / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Asn-144
  •        Asn-340
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Undefined site
  •        Asn-47
  •        Asn-92
  •        Asn-131
  •        Asn-205
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
  •        Asn-316
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-46
  •        Asn-209
  •        Asn-272
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Immunoglobulin kappa chain V-I region CAR / Homo sapiens
  •        Asn-28
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
• Laminin subunit beta-1 / Homo sapiens
  •        Asn-1279
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-249
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-257
• Membrane primary amine oxidase / Homo sapiens
  •        Asn-592
  •        Asn-618
• Mesothelin / Homo sapiens
  •        Asn-496
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Microtubule-associated serine/threonine-protein kinase 1 / Homo sapiens
  •        Asn-11
• Mucin-5B / Homo sapiens
  •        Asn-805
• Multimerin-1 / Homo sapiens
  •        Asn-828
• Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
  •        Asn-421
• Neuroendocrine convertase 2 / Homo sapiens
  •        Asn-524
• Neuron navigator 2 / Homo sapiens
  •        Asn-1240
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-248
• Periostin / Homo sapiens
  •        Asn-599
• Plasma protease c1 inhibitor / Homo sapiens
  •        Asn-25
  •        Asn-238
• Platelet glycoprotein 4 / Homo sapiens
  •        Asn-79
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-135
  •        Asn-186
  •        Asn-421
  •        Asn-469
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolargin / Homo sapiens
  •        Asn-124
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-729
  •        Asn-1825
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Protein AMBP / Homo sapiens
  •        Asn-250
• Prothrombin / Homo sapiens
  •        Asn-416
• Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
  •        Asn-682
• Short transient receptor potential channel 6 / Homo sapiens
  •        Asn-473
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
• Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
  •        Asn-308
• Tyrosine-protein kinase Mer / Homo sapiens
  •        Asn-442
  •        Asn-454
• Uncharacterized protein from Blood Serum / Homo sapiens
  •        Undefined site
• Vitronectin / Homo sapiens
  •        Asn-169
• Von willebrand factor / Homo sapiens
  •        Asn-666
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Immunoglobulin gamma / Equus caballus
  •        Undefined site
• Immunoglobulin gamma / Felis catus
  •        Undefined site
• Fetal antigen 1 / Mus musculus
  •        Asn-100
• Immunoglobulin gamma / Ovis aries
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Undefined site
  •        Asn-119
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-74
  •        Asn-331
  •        Asn-615
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-657
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343

Mass spectrometry observed peptide

• SNFSMPSFPGGSMFR (15aa)
  •    Q9Y2H9    Asn-11     Microtubule-associated serine/threonine-protein kinase 1 / Homo sapiens
• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NPNATSSSSQDPESLQDR (18aa)
  •    P05155    Asn-25     Plasma protease c1 inhibitor / Homo sapiens
• ASQNISSWLAWYQQK (15aa)
  •    P01596    Asn-28     Immunoglobulin kappa chain V-I region CAR / Homo sapiens
• YVNMSNHHR (9aa)
  •    P08185    Asn-31     Corticosteroid-binding globulin / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• KNNSDISSTRGFPSVLRGGKY (21aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• KYKNNSDISSTRG (13aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• KNNSDISSTRG (11aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• YKNNSDISSTR (11aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• NNSDISSTR (9aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• SVTWSESGQNVTAR (14aa)
  •    P01877    Asn-47     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTAR (44aa)
  •    P01877    Asn-47     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• NLSMPLLPADFHK (13aa)
  •    P05546    Asn-49     Heparin cofactor 2 / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• RLSPNASAEHLELRW (15aa)
  •    Q13410    Asn-55     Butyrophilin subfamily 1 member A1 / Homo sapiens
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57     CD44 antigen / Homo sapiens
• ATPEAANASELAALR (15aa)
  •    Q8NI99    Asn-58     Angiopoietin-related protein 6 / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• ENISDPTSPLR (11aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• RIIVPLNNRENISDPTSPLRT (21aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• QFWIFDVQNPQEVMMNSSNIQVK (23aa)
  •    P16671    Asn-79     Platelet glycoprotein 4 / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• KKKEDALNETRE (12aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• HYTNSSQDVTVPCR (14aa)
  •    P01877    Asn-92     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• TCNASQGFK (9aa)
  •    P52797    Asn-100     Ephrin-A3 / Homo sapiens
• RSHNRSEEFLIAGKL (15aa)
  •    P01033    Asn-101     Metalloproteinase inhibitor 1 / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• AVIVNNITTGER (12aa)
  •    Q8NBJ4    Asn-109     Golgi membrane protein 1 / Homo sapiens
• KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
  •    Q6WN34    Asn-114     Chordin-like protein 2 / Homo sapiens
• CGPCPAGFTGNGSHCTDVNECNAHPCFPR (29aa)
  •    P49747    Asn-121     Cartilage oligomeric matrix protein / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IHYLYLQNNFITELPVESFQNATGLR (26aa)
  •    P51888    Asn-124     Prolargin / Homo sapiens
• MLLTFHTDFSNEENGTIMFYK (21aa)
  •    P00736    Asn-125     Complement c1r subcomponent / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •    P01877    Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• GLSFDVSLEVSQGPGLLNDTK (21aa)
  •    P01833    Asn-135     Polymeric immunoglobulin receptor / Homo sapiens
• NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
  •    Q9HCE0    Asn-137     Ectopic P granules protein 5 homolog / Homo sapiens
• VCQDCPIIAPINDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• EEQFNSTFR (9aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
• KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
  •    P00738    Asn-184     Haptoglobin / Homo sapiens
• DFVNASSK (8aa)
  •    P05546    Asn-188     Heparin cofactor 2 / Homo sapiens
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• GLTFQQNASSM(SO)CVPDQDTAIR (25aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GLTFQQNASSMCGPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
  •    VAR_003904   215:V→G   dbSNP:rs12365
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• RGLTFQQNASSMCVPDQDTAIRV (23aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GLTFQQNASSM (11aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• DTFVNASR (8aa)
  •    P05155    Asn-238     Plasma protease c1 inhibitor / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
  •    P02760    Asn-250     Protein AMBP / Homo sapiens
• VASVININPNTTHSTGSCR (19aa)
  •    P13473    Asn-257     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• GLSFNSISAVDNGSLANTPHLR (22aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• THTNISE (7aa)
  •    P01871    Asn-272     Immunoglobulin heavy constant mu / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• YIQVVYLHNNNISVVGSSDFCPPGHNTK (28aa)
  •    P07585    Asn-303     Decorin / Homo sapiens
• NATGDYK (7aa)
  •    Q13740    Asn-306     CD166 antigen / Homo sapiens
• NVTAEQLFLK (10aa)
  •    Q9Y274    Asn-308     Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LAGKPTHVNVS (11aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY (23aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• IAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• LNITCESSK (9aa)
  •    Q4KMQ2    Asn-361     Anoctamin-6 / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• RLANLTQGEDQYYLRV (16aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• CLLYPPWDKNFTENDLLVR (19aa)
  •    P00734    Asn-416     Prothrombin / Homo sapiens
• NFTENDLLVR (10aa)
  •    P00734    Asn-416     Prothrombin / Homo sapiens
• VNSTELFHVDR (11aa)
  •    Q7Z7M0    Asn-421     Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• ELLEEVGQNGSR (12aa)
  •    Q12866    Asn-442     Tyrosine-protein kinase Mer / Homo sapiens
• AIPQPQNVTSIIGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• ISVQVHNATCTVR (13aa)
  •    Q12866    Asn-454     Tyrosine-protein kinase Mer / Homo sapiens
• KVPGNVTAVLGETLKV (16aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• LLPNETSTDNAK (12aa)
  •    Q9Y210    Asn-473     Short transient receptor potential channel 6 / Homo sapiens
• NFTEVHPDYGSHIQALLDK (19aa)
  •    P04040    Asn-481     Catalase / Homo sapiens
• LAFQNMNGSEYFVK (14aa)
  •    Q13421    Asn-496     Mesothelin / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• TAGWNIPMGLLFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• NMTSPMGTK (9aa)
  •    P16519    Asn-524     Neuroendocrine convertase 2 / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• YIYIASNHSNK (11aa)
  •    Q16853    Asn-592     Membrane primary amine oxidase / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IQMISFAGEPIPQNSSMAR (19aa)
  •    Q16853    Asn-618     Membrane primary amine oxidase / Homo sapiens
• KTMFPNLTDVRE (12aa)
  •    P06681    Asn-651     Complement C2 / Homo sapiens
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GQVYLQCGTPCNLTCR (16aa)
  •    P04275    Asn-666     Von willebrand factor / Homo sapiens
• MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
  •    Q5H9R7    Asn-682     Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
• IETILLNGTDR (11aa)
  •    Q07954    Asn-729     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• STGCAAPMVYLDCSNSSAGTPGAECLR (27aa)
  •    Q9HC84    Asn-805     Mucin-5B / Homo sapiens
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NYQLDNGSFKE (11aa)
  •    P01031    Asn-1115     Complement C5 / Homo sapiens
• SSTSSIDSNISSK (13aa)
  •    Q8IVL1    Asn-1240     Neuron navigator 2 / Homo sapiens
• LSDTTSQSNSTAK (13aa)
  •    P07942    Asn-1279     Laminin subunit beta-1 / Homo sapiens
• VSNQTLSLFFTVLQDVPVR (19aa)
  •    P01023    Asn-1424     Alpha-2-macroglobulin / Homo sapiens
• VSGGSWVVYDGENFTGNQYVLEEGHYPCLSAMGCPPGATFK (41aa)
  •    Q9Y4K1    Asn-1462     Beta/gamma crystallin domain-containing protein 1 / Homo sapiens
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581     Fibrillin-1 / Homo sapiens
• NSTTLVMHMK (10aa)
  •    Q07954    Asn-1825     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens