taxonomy (10)
protein (113)
source (33)
structure (35)
composition (1)
disease (24)
reference (57)
site (157)
peptide (135)
- Homo sapiens (Human)
- Equus caballus (Domestic horse)
- Felis catus (Cat)
- Mus musculus (House mouse)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Gallus gallus (Chicken)
- Human immunodeficiency virus type 1 (HIV-1)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-fetoprotein / Homo sapiens P02771
- Alpha-S1-casein / Homo sapiens P47710
- Angiopoietin-related protein 6 / Homo sapiens Q8NI99
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Anoctamin-6 / Homo sapiens Q4KMQ2
- Asporin / Homo sapiens Q9BXN1
- Beta/gamma crystallin domain-containing protein 1 / Homo sapiens Q9Y4K1
- Biglycan / Homo sapiens P21810
- Butyrophilin subfamily 1 member A1 / Homo sapiens Q13410
- Cadherin-5 / Homo sapiens P33151
- Calumenin / Homo sapiens O43852
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cartilage oligomeric matrix protein / Homo sapiens P49747
- Catalase / Homo sapiens P04040
- CD166 antigen / Homo sapiens Q13740
- CD44 antigen / Homo sapiens P16070
- CD59 glycoprotein / Homo sapiens P13987
- Ceruloplasmin / Homo sapiens P00450
- Chordin-like protein 2 / Homo sapiens Q6WN34
- Clusterin / Homo sapiens P10909
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Complement c1r subcomponent / Homo sapiens P00736
- Complement C2 / Homo sapiens P06681
- Complement C5 / Homo sapiens P01031
- Corticosteroid-binding globulin / Homo sapiens P08185
- Decorin / Homo sapiens P07585
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Ectopic P granules protein 5 homolog / Homo sapiens Q9HCE0
- Ephrin-A3 / Homo sapiens P52797
- Epidermal growth factor receptor / Homo sapiens P00533
- Fibrillin-1 / Homo sapiens P35555
- Fibromodulin / Homo sapiens Q06828
- Fibronectin / Homo sapiens P02751
- Glycophorin-A / Homo sapiens P02724
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- Heparin cofactor 2 / Homo sapiens P05546
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens P01880
- Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens P01854
- Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens P01854
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Immunoglobulin kappa chain V-I region CAR / Homo sapiens P01596
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit beta-1 / Homo sapiens P07942
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens P08637
- Lumican / Homo sapiens P51884
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Membrane primary amine oxidase / Homo sapiens Q16853
- Mesothelin / Homo sapiens Q13421
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Microtubule-associated serine/threonine-protein kinase 1 / Homo sapiens Q9Y2H9
- Mucin-5B / Homo sapiens Q9HC84
- Multimerin-1 / Homo sapiens Q13201
- Multiple epidermal growth factor-like domains protein 8 / Homo sapiens Q7Z7M0
- Neuroendocrine convertase 2 / Homo sapiens P16519
- Neuron navigator 2 / Homo sapiens Q8IVL1
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Periostin / Homo sapiens Q15063
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Platelet glycoprotein 4 / Homo sapiens P16671
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prolargin / Homo sapiens P51888
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Protein AMBP / Homo sapiens P02760
- Prothrombin / Homo sapiens P00734
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens Q5H9R7
- Short transient receptor potential channel 6 / Homo sapiens Q9Y210
- Thrombospondin-1 / Homo sapiens P07996
- Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens Q9Y274
- Tyrosine-protein kinase Mer / Homo sapiens Q12866
- Uncharacterized protein from Blood Serum / Homo sapiens
- Vitronectin / Homo sapiens P04004
- Von willebrand factor / Homo sapiens P04275
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Immunoglobulin gamma / Equus caballus
- Immunoglobulin gamma / Felis catus
- Fetal antigen 1 / Mus musculus Q09163
- Immunoglobulin gamma / Ovis aries
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Neuroligin 1 / Rattus norvegicus Q62765
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Immunoglobulin gamma / Gallus gallus
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amniotic Fluid (UBERON_0000173)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Liver (UBERON_0002107)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Yolk Sac (UBERON_0001040)
- C10 (CVCL_5245)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293SF-3F6 (CVCL_4V95)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- EBV-transformed B-cell (CL_0000236)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Neutrophil (CL_0000775)
- Microsome (GO_0005792)
Source
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ HexNAc"
- N-Linked / Complex / Structure 1049
- N-Linked / Complex / Structure 1149
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 2 x Gal(b1-4) + NeuAc(a2-6)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4) + NeuAc(a2-6)"
- N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ HexNAc"
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9487
- N-Linked / Complex / Structure 9582
- N-Linked / Complex / Structure 9734
- N-Linked / Complex / Structure 9892
- N-Linked / Complex / Structure 10083
- N-Linked / Complex / Structure 10203
- N-Linked / Complex / Structure 10227
- N-Linked / Complex / Structure 10231
- N-Linked / Complex / Structure 10264
- N-Linked / Complex / Structure 10451
- N-Linked / Complex / Structure 10495
- N-Linked / Complex / Structure 10532
- N-Linked / Complex / Structure 10544
- N-Linked / Complex / Structure 10910
- N-Linked / Complex / Structure 10918
- N-Linked / Complex / Structure 10955
- N-Linked / Complex / Structure 10992
- N-Linked / Complex / Structure 11190
- N-Linked / Complex / Structure 11196
- N-Linked / Complex / Structure 11476
- N-Linked / Complex / Structure 11550
- N-Linked / Complex / Structure 11826
- N-Linked / Complex / Structure 11888
- N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-3)GalNAc(b1-4)GlcNAc(?1-?)[GlcNAc(?1-?)]Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
Reported structure
- Alzheimer's disease (DOID:10652)
- Amyotrophic lateral sclerosis (DOID:0080917)
- Atopic dermatitis (DOID:3310)
- Cancer, breast (DOID:1612)
- Carcinoma, Squamous cell (DOID:1749)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Hyper IgE syndrome (DOID:0080545)
- Hyper IgE syndrome (HIES, p.Glu340del) (DOID:0080545)
- Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
- Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
- Hyper IgE syndrome (PGM3 mutation, p.Leu83Ser) (DOID:0080545)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- IgE myeloma (DOID:9538)
- Mild Cognitive Impairment (DOID:0080832)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Prostate cancer (DOID:10283)
- Schizophrenia (DOID:5419)
- Systemic lupus erythematosus (DOID:9074)
- Tumor, Endodermal Sinus (DOID:1911)
Disease
- Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Exploring Cerebrospinal Fluid IgG N-Glycosylation as Potential Biomarker for Amyotrophic Lateral Sclerosis (2019 - Costa J, Streich L, Pinto S, Pronto-Laborinho A, Nimtz M, Conradt HS, de Carvalho M) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- CSF N-glycoproteomics for early diagnosis in Alzheimer's disease (2016 - Palmigiano A, Barone R, Sturiale L, Sanfilippo C, Bua RO, Romeo DA, Messina A, Capuana ML, Maci T, Le Pira F, Zappia M, Garozzo D) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
- Fractionation and characterization of boar seminal plasma spermadhesion PSP-II glycoforms reveal the presence of uncommon N-acetylgalactosamine-containing N-linked oligosaccharides. (1997 - Solis D, Calvete J, Sanz L, Hettel C, Raida M, Diaz-Maurio T, Tpfer-Petersen E) / Status : Reviewed
- Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
- Three-dimensional elution mapping of pyridylaminated N-linked neutral and sialyl oligosaccharides. (1995 - Takahashi N, Nakagawa H, Fujikawa K, Kawamura Y, Tomiya N) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Sugar chain of alpha-fetoprotein produced in human yolk sac tumor. (1983 - Yamashita K, Hitoi A, Tsuchida Y, Nishi S, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of glycophorin A. (1980 - Yoshima H, Furthmayr H, Kobata A) / Status : Reviewed
Reference
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Alpha-fetoprotein / Homo sapiens
- Alpha-S1-casein / Homo sapiens
- Angiopoietin-related protein 6 / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Anoctamin-6 / Homo sapiens
- Asporin / Homo sapiens
- Beta/gamma crystallin domain-containing protein 1 / Homo sapiens
- Biglycan / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
-
Cadherin-5 / Homo sapiens
- Undefined site
- Calumenin / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cartilage oligomeric matrix protein / Homo sapiens
- Catalase / Homo sapiens
- CD166 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement C2 / Homo sapiens
- Complement C5 / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Ectopic P granules protein 5 homolog / Homo sapiens
- Ephrin-A3 / Homo sapiens
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
- Fibrillin-1 / Homo sapiens
- Fibromodulin / Homo sapiens
- Fibronectin / Homo sapiens
-
Glycophorin-A / Homo sapiens
- Undefined site
- Golgi membrane protein 1 / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-316
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Immunoglobulin kappa chain V-I region CAR / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Membrane primary amine oxidase / Homo sapiens
- Mesothelin / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Microtubule-associated serine/threonine-protein kinase 1 / Homo sapiens
- Mucin-5B / Homo sapiens
- Multimerin-1 / Homo sapiens
- Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
- Neuroendocrine convertase 2 / Homo sapiens
- Neuron navigator 2 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Platelet glycoprotein 4 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolargin / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Protein AMBP / Homo sapiens
- Prothrombin / Homo sapiens
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
- Short transient receptor potential channel 6 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
- Tyrosine-protein kinase Mer / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
- Vitronectin / Homo sapiens
- Von willebrand factor / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
- Fetal antigen 1 / Mus musculus
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
-
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Undefined site
- Asn-119
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- SNFSMPSFPGGSMFR (15aa)
- QCVNLTTR (8aa)
- NPNATSSSSQDPESLQDR (18aa)
- ASQNISSWLAWYQQK (15aa)
- YVNMSNHHR (9aa)
- TAVNCSSDFDACLITK (16aa)
- KNNSDISSTRGFPSVLRGGKY (21aa)
- KYKNNSDISSTRG (13aa)
- KNNSDISSTRG (11aa)
- YKNNSDISSTR (11aa)
- NNSDISSTR (9aa)
- SVTWSESGQNVTAR (14aa)
- VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTAR (44aa)
- NLSMPLLPADFHK (13aa)
- WFSAGLASNSSWLR (14aa)
- RLSPNASAEHLELRW (15aa)
- AFNSTLPTMAQMEK (14aa)
- ATPEAANASELAALR (15aa)
- NKSVLLGR (8aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- ENISDPTSPLR (11aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- HAIHVSGTNGTKRF (14aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- QFWIFDVQNPQEVMMNSSNIQVK (23aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- KKKEDALNETRE (12aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- HYTNSSQDVTVPCR (14aa)
- TCNASQGFK (9aa)
- RSHNRSEEFLIAGKL (15aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- CGPCPAGFTGNGSHCTDVNECNAHPCFPR (29aa)
- TQSLLIVNNATNVVIK (16aa)
- IHYLYLQNNFITELPVESFQNATGLR (26aa)
- MLLTFHTDFSNEENGTIMFYK (21aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- GLSFDVSLEVSQGPGLLNDTK (21aa)
- NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
- VCQDCPIIAPINDTR (15aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- VYSSANNCTFE (11aa)
- IYIDHNNITR (10aa)
- NGSLFAFR (8aa)
- EEQFNSTFR (9aa)
- CRGLVGSKNVSSE (13aa)
- FGSKNVSSE (9aa)
- KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
- DFVNASSK (8aa)
- TPLTANITK (9aa)
- GLTFQQNASSM(SO)CVPDQDTAIR (25aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- GLTFQQNASSM (11aa)
- DTFVNASR (8aa)
- FHLANR (6aa)
- KDNTTVTR (8aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- VASVININPNTTHSTGSCR (19aa)
- GLSFNSISAVDNGSLANTPHLR (22aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- MIENGSISFIPTIR (14aa)
- YLGNATAIFFLPDEGK (16aa)
- THTNISE (7aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- ITDIENGSIANIPR (14aa)
- NGTITDAVDCALDPLSE (17aa)
- YIQVVYLHNNNISVVGSSDFCPPGHNTK (28aa)
- NATGDYK (7aa)
- NVTAEQLFLK (10aa)
- IIQVVYIHSNNITK (14aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- FPNITNLCPFGE (12aa)
- LAGKPTHVNVS (11aa)
- RLAGKPTHVNVSVVMAEVDGTCY (23aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- VFNATR (6aa)
- GEVFNATR (8aa)
- KVSCPIMPCSNATVPDGECCPR (22aa)
- LNITCESSK (9aa)
- IANITQGEDQYYIR (14aa)
- RLANLTQGEDQYYLRV (16aa)
- CLLYPPWDKNFTENDLLVR (19aa)
- NFTENDLLVR (10aa)
- VNSTELFHVDR (11aa)
- NYTDCTSEGR (10aa)
- ELLEEVGQNGSR (12aa)
- AIPQPQNVTSIIGCTH (16aa)
- ISVQVHNATCTVR (13aa)
- KVPGNVTAVLGETLKV (16aa)
- LLPNETSTDNAK (12aa)
- NFTEVHPDYGSHIQALLDK (19aa)
- LAFQNMNGSEYFVK (14aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- TAGWNIPMGLLFNQTGSCK (19aa)
- NMTSPMGTK (9aa)
- DQCIVDDITYNVNDTFHK (18aa)
- YIYIASNHSNK (11aa)
- EVNDTLLVNELK (12aa)
- LYQDVNCT (8aa)
- IQMISFAGEPIPQNSSMAR (19aa)
- KTMFPNLTDVRE (12aa)
- AGCLIGAEHVNNSYE (15aa)
- GQVYLQCGTPCNLTCR (16aa)
- MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
- IETILLNGTDR (11aa)
- ELHHLQEQNVSNAFLDK (17aa)
- NMTLFSDLVAEK (12aa)
- STGCAAPMVYLDCSNSSAGTPGAECLR (27aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- NYQLDNGSFKE (11aa)
- SSTSSIDSNISSK (13aa)
- LSDTTSQSNSTAK (13aa)
- VSNQTLSLFFTVLQDVPVR (19aa)
- VSGGSWVVYDGENFTGNQYVLEEGHYPCLSAMGCPPGATFK (41aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- NSTTLVMHMK (10aa)
- EAGNITTDGYEIIGK (15aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Carcinoma, Squamous cell (DOID:1749)
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Amniotic Fluid (UBERON_0000173)
- Fetal antigen 1 / Mus musculus
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
- Hyper IgE syndrome (PGM3 mutation, p.Leu83Ser) (DOID:0080545)
- Hyperimmune condition
- IgE myeloma (DOID:9538)
- Multiple myeloma (DOID:9538)
- Systemic lupus erythematosus (DOID:9074)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- YKNNSDISSTR (11aa)
- NNSDISSTR (9aa)
- ENISDPTSPLR (11aa)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- GLTFQQNASSM(SO)CVPDQDTAIR (25aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- THTNISE (7aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
- AGCLIGAEHVNNSYE (15aa)
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Carcinoma, Squamous cell (DOID:1749)
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
-
Cadherin-5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- Yolk Sac (UBERON_0001040)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Tumor, Endodermal Sinus (DOID:1911)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Three-dimensional elution mapping of pyridylaminated N-linked neutral and sialyl oligosaccharides. (1995 - Takahashi N, Nakagawa H, Fujikawa K, Kawamura Y, Tomiya N) / Status : Reviewed
- Sugar chain of alpha-fetoprotein produced in human yolk sac tumor. (1983 - Yamashita K, Hitoi A, Tsuchida Y, Nishi S, Kobata A) / Status : Reviewed
- Alpha-fetoprotein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of glycophorin A. (1980 - Yoshima H, Furthmayr H, Kobata A) / Status : Reviewed
-
Glycophorin-A / Homo sapiens
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
- Clusterin / Homo sapiens
- Haptoglobin / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- KNNSDISSTRG (11aa)
- KNNSDISSTRGFPSVLRGGKY (21aa)
- KYKNNSDISSTRG (13aa)
- RLSPNASAEHLELRW (15aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- KKKEDALNETRE (12aa)
- RSHNRSEEFLIAGKL (15aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- RLAGKPTHVNVSVVMAEVDGTCY (23aa)
- RLANLTQGEDQYYLRV (16aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Adipocytes (CL_0000136)
-
- N-Linked / Complex
(avg mass : 2282.1032)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Blood Plasma (UBERON_0001969)
- Adipocytes (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant delta / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2282.1032)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Atopic dermatitis (DOID:3310)
- Control/Healthy
- Hyper IgE syndrome (DOID:0080545)
- Hyper IgE syndrome (HIES, p.Glu340del) (DOID:0080545)
- Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant delta / Homo sapiens
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Blood Serum (UBERON_0001977)
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Blood Serum (UBERON_0001977)
- Control/Healthy
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Ascitic fluid (UBERON_0007795)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Liver (UBERON_0002107)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Colon (UBERON_0001155)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Amyotrophic lateral sclerosis (DOID:0080917)
- Control/Healthy
- Multiple myeloma (DOID:9538)
- Schizophrenia (DOID:5419)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Exploring Cerebrospinal Fluid IgG N-Glycosylation as Potential Biomarker for Amyotrophic Lateral Sclerosis (2019 - Costa J, Streich L, Pinto S, Pronto-Laborinho A, Nimtz M, Conradt HS, de Carvalho M) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 2282.1032)
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Alzheimer's disease (DOID:10652)
-
- N-Linked / Complex
(avg mass : 2282.1032)
- HEK293SF-3F6 (CVCL_4V95)
-
- N-Linked / Complex
(avg mass : 2282.1032)
- HEK293SF-3F6 (CVCL_4V95)
-
- N-Linked / Hybrid
(avg mass : 2282.1032)
- Seminal Fluid (UBERON_0006530)
-
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Undefined site
-
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2282.1032)
- Ascitic fluid (UBERON_0007795)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ HexNAc"
- N-Linked / Complex / Structure 1049
- N-Linked / Complex / Structure 1149
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 2 x Gal(b1-4) + NeuAc(a2-6)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4) + NeuAc(a2-6)"
- N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ HexNAc"
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9487
- N-Linked / Complex / Structure 9582
- N-Linked / Complex / Structure 9734
- N-Linked / Complex / Structure 9892
- N-Linked / Complex / Structure 10083
- N-Linked / Complex / Structure 10203
- N-Linked / Complex / Structure 10227
- N-Linked / Complex / Structure 10231
- N-Linked / Complex / Structure 10264
- N-Linked / Complex / Structure 10451
- N-Linked / Complex / Structure 10495
- N-Linked / Complex / Structure 10532
- N-Linked / Complex / Structure 10544
- N-Linked / Complex / Structure 10910
- N-Linked / Complex / Structure 10918
- N-Linked / Complex / Structure 10955
- N-Linked / Complex / Structure 10992
- N-Linked / Complex / Structure 11190
- N-Linked / Complex / Structure 11196
- N-Linked / Complex / Structure 11476
- N-Linked / Complex / Structure 11550
- N-Linked / Complex / Structure 11826
- N-Linked / Complex / Structure 11888
- N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-3)GalNAc(b1-4)GlcNAc(?1-?)[GlcNAc(?1-?)]Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Angiopoietin-related protein 6 / Homo sapiens
- Anoctamin-6 / Homo sapiens
- Asporin / Homo sapiens
- Beta/gamma crystallin domain-containing protein 1 / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cartilage oligomeric matrix protein / Homo sapiens
- Catalase / Homo sapiens
- CD166 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement C2 / Homo sapiens
- Complement C5 / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Ectopic P granules protein 5 homolog / Homo sapiens
- Ephrin-A3 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibromodulin / Homo sapiens
- Fibronectin / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin kappa chain V-I region CAR / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Membrane primary amine oxidase / Homo sapiens
- Mesothelin / Homo sapiens
- Microtubule-associated serine/threonine-protein kinase 1 / Homo sapiens
- Mucin-5B / Homo sapiens
- Multimerin-1 / Homo sapiens
- Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
- Neuroendocrine convertase 2 / Homo sapiens
- Neuron navigator 2 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Platelet glycoprotein 4 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolargin / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Protein AMBP / Homo sapiens
- Prothrombin / Homo sapiens
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
- Short transient receptor potential channel 6 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
- Tyrosine-protein kinase Mer / Homo sapiens
- Vitronectin / Homo sapiens
- Von willebrand factor / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- SNFSMPSFPGGSMFR (15aa)
- QCVNLTTR (8aa)
- NPNATSSSSQDPESLQDR (18aa)
- ASQNISSWLAWYQQK (15aa)
- YVNMSNHHR (9aa)
- TAVNCSSDFDACLITK (16aa)
- YKNNSDISSTR (11aa)
- SVTWSESGQNVTAR (14aa)
- VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTAR (44aa)
- NLSMPLLPADFHK (13aa)
- WFSAGLASNSSWLR (14aa)
- AFNSTLPTMAQMEK (14aa)
- ATPEAANASELAALR (15aa)
- HAIHVSGTNGTKRF (14aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- QFWIFDVQNPQEVMMNSSNIQVK (23aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- HYTNSSQDVTVPCR (14aa)
- TCNASQGFK (9aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- CGPCPAGFTGNGSHCTDVNECNAHPCFPR (29aa)
- IHYLYLQNNFITELPVESFQNATGLR (26aa)
- MLLTFHTDFSNEENGTIMFYK (21aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- GLSFDVSLEVSQGPGLLNDTK (21aa)
- NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
- VCQDCPIIAPINDTR (15aa)
- IYIDHNNITR (10aa)
- NGSLFAFR (8aa)
- EEQFNSTFR (9aa)
- CRGLVGSKNVSSE (13aa)
- FGSKNVSSE (9aa)
- DFVNASSK (8aa)
- TPLTANITK (9aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- GLTFQQNASSM (11aa)
- DTFVNASR (8aa)
- FHLANR (6aa)
- KDNTTVTR (8aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- VASVININPNTTHSTGSCR (19aa)
- GLSFNSISAVDNGSLANTPHLR (22aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- MIENGSISFIPTIR (14aa)
- YLGNATAIFFLPDEGK (16aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- ITDIENGSIANIPR (14aa)
- YIQVVYLHNNNISVVGSSDFCPPGHNTK (28aa)
- NATGDYK (7aa)
- NVTAEQLFLK (10aa)
- IIQVVYIHSNNITK (14aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- LAGKPTHVNVS (11aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- KVSCPIMPCSNATVPDGECCPR (22aa)
- LNITCESSK (9aa)
- IANITQGEDQYYIR (14aa)
- CLLYPPWDKNFTENDLLVR (19aa)
- NFTENDLLVR (10aa)
- VNSTELFHVDR (11aa)
- NYTDCTSEGR (10aa)
- ELLEEVGQNGSR (12aa)
- AIPQPQNVTSIIGCTH (16aa)
- ISVQVHNATCTVR (13aa)
- LLPNETSTDNAK (12aa)
- NFTEVHPDYGSHIQALLDK (19aa)
- LAFQNMNGSEYFVK (14aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- TAGWNIPMGLLFNQTGSCK (19aa)
- NMTSPMGTK (9aa)
- DQCIVDDITYNVNDTFHK (18aa)
- YIYIASNHSNK (11aa)
- EVNDTLLVNELK (12aa)
- LYQDVNCT (8aa)
- IQMISFAGEPIPQNSSMAR (19aa)
- KTMFPNLTDVRE (12aa)
- GQVYLQCGTPCNLTCR (16aa)
- MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
- IETILLNGTDR (11aa)
- ELHHLQEQNVSNAFLDK (17aa)
- NMTLFSDLVAEK (12aa)
- STGCAAPMVYLDCSNSSAGTPGAECLR (27aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- NYQLDNGSFKE (11aa)
- SSTSSIDSNISSK (13aa)
- LSDTTSQSNSTAK (13aa)
- VSNQTLSLFFTVLQDVPVR (19aa)
- VSGGSWVVYDGENFTGNQYVLEEGHYPCLSAMGCPPGATFK (41aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- NSTTLVMHMK (10aa)
- EAGNITTDGYEIIGK (15aa)
-
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 / O-Linked
(avg mass : 2282.1032)
- C10 (CVCL_5245)
- Colon adenocarcinoma (DOID:234)
Source
Suggested structure
Disease
Reported glycosite
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 / O-Linked
(avg mass : 2282.1032)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2282.1032)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2282.1032)