Hex:6 HexNAc:5 NeuAc:2

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Canis lupus familiaris (Dog)
• Equus caballus (Domestic horse)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Gallus gallus (Chicken)
• Torpedo californica (Pacific electric ray)
• Friend murine leukemia virus (F-mulv)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• ADAM DEC1 / Homo sapiens    O15204
• ADAMTS-like protein 2 / Homo sapiens    Q86TH1
• Adenosine deaminase 2 / Homo sapiens    Q9NZK5
• Adhesion G protein-coupled receptor F5 / Homo sapiens    Q8IZF2
• Adhesion G protein-coupled receptor L4 / Homo sapiens    Q9HBW9
• Adhesion G-protein coupled receptor D1 / Homo sapiens    Q6QNK2
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-1b-glycoprotein / Homo sapiens    P04217
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Angiopoietin-1 receptor / Homo sapiens    Q02763
• Angiopoietin-related protein 4 / Homo sapiens    Q9BY76
• Angiotensin-converting enzyme / Homo sapiens    P12821
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Angiotensinogen / Homo sapiens    P01019
• Apolipoprotein (a) / Homo sapiens    P08519
• Apolipoprotein B-100 / Homo sapiens    P04114
• Apolipoprotein D / Homo sapiens    P05090
• Apolipoprotein F / Homo sapiens    Q13790
• Asialoglycoprotein receptor 2 / Homo sapiens    P07307
• Attractin / Homo sapiens    O75882
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Beta-Ala-His dipeptidase / Homo sapiens    Q96KN2
• Biotinidase / Homo sapiens    P43251
• Bone marrow stromal antigen 2 / Homo sapiens    Q10589
• C4b-binding protein alpha chain / Homo sapiens    P04003
• C4b-binding protein beta chain / Homo sapiens    P20851
• Cadherin-13 / Homo sapiens    P55290
• Carboxypeptidase b2 / Homo sapiens    Q96IY4
• Carboxypeptidase N subunit 2 / Homo sapiens    P22792
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Catalase / Homo sapiens    P04040
• Cathepsin D / Homo sapiens    P07339
• Cathepsin L1 / Homo sapiens    P07711
• CD109 antigen / Homo sapiens    Q6YHK3
• CD166 antigen / Homo sapiens    Q13740
• CD276 antigen / Homo sapiens    Q5ZPR3
• CD44 antigen / Homo sapiens    P16070
• CD48 antigen / Homo sapiens    P09326
• Ceruloplasmin / Homo sapiens    P00450
• Cholesteryl ester transfer protein / Homo sapiens    P11597
• Clusterin / Homo sapiens    P10909
• Coagulation factor IX / Homo sapiens    P00740
• Coagulation factor VIII / Homo sapiens    P00451
• Coagulation factor XI / Homo sapiens    P03951
• Coagulation factor XIII B chain / Homo sapiens    P05160
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Complement factor h / Homo sapiens    P08603
• Complement factor H-related protein 1 / Homo sapiens    Q03591
• Complement factor H-related protein 3 / Homo sapiens    Q02985
• Complement factor H-related protein 4 / Homo sapiens    Q92496
• Complement factor i / Homo sapiens    P05156
• Contactin-3 / Homo sapiens    Q9P232
• Contactin-4 / Homo sapiens    Q8IWV2
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Decorin / Homo sapiens    P07585
• Desmoglein-2 / Homo sapiens    Q14126
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens    Q93070
• Endoplasmic reticulum aminopeptidase 2 / Homo sapiens    Q6P179
• Endothelial cell-selective adhesion molecule / Homo sapiens    Q96AP7
• Endothelin-converting enzyme 1 / Homo sapiens    P42892
• Epidermal growth factor receptor / Homo sapiens    P00533
• Epididymis-specific alpha-mannosidase / Homo sapiens    Q9Y2E5
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Extracellular sulfatase Sulf-2 / Homo sapiens    Q8IWU5
• Fibrillin-1 / Homo sapiens    P35555
• Fibroleukin / Homo sapiens    Q14314
• Follitropin, alpha and beta chains / Homo sapiens    P01225    P01215
• Frizzled-6 / Homo sapiens    O60353
• G-protein coupled receptor 126 / Homo sapiens    Q86SQ4
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-glutamyltranspeptidase 1 / Homo sapiens    P19440
• Glutaminase kidney isoform, mitochondrial / Homo sapiens    O94925
• Glycocalicin / Homo sapiens    P07359
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Heparin cofactor 2 / Homo sapiens    P05546
• Hepatocyte growth factor / Homo sapiens    P14210
• Hepatocyte growth factor activator / Homo sapiens    Q04756
• Hepatocyte growth factor receptor / Homo sapiens    P08581
• HLA class II histocompatibility antigen, DP alpha 1 chain / Homo sapiens    P20036
• Homeobox protein Hox-B3 / Homo sapiens    P14651
• IgGFc-binding protein / Homo sapiens    Q9Y6R7
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens    P0DOX2
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens    P01877
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens    P01880
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Integrin alpha-5 / Homo sapiens    P08648
• Integrin alpha-5/beta-1 / Homo sapiens    P08648    P05556
• Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens    P19827
• Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens    P19823
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Intercellular adhesion molecule 2 / Homo sapiens    P13598
• Interleukin-1 receptor accessory protein / Homo sapiens    Q9NPH3
• Interleukin-1 receptor-like 1 / Homo sapiens    Q01638
• Interleukin-6 receptor subunit beta / Homo sapiens    P40189
• Junction plakoglobin / Homo sapiens    P14923
• Kallistatin / Homo sapiens    P29622
• Keratin, type I cytoskeletal 9 / Homo sapiens    P35527
• Kininogen-1 / Homo sapiens    P01042
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Leptin receptor / Homo sapiens    P48357
• Leucine-rich repeat-containing protein 15 / Homo sapiens    Q8TF66
• Leucyl-cystinyl aminopeptidase / Homo sapiens    Q9UIQ6
• Lipopolysaccharide-binding protein / Homo sapiens    P18428
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens    P07333
• Maltase-glucoamylase, intestinal / Homo sapiens    O43451
• Mannan-binding lectin serine protease 1 / Homo sapiens    P48740
• Mesothelin / Homo sapiens    Q13421
• Mimecan / Homo sapiens    P20774
• Multimerin-1 / Homo sapiens    Q13201
• Multimerin-2 / Homo sapiens    Q9H8L6
• Multiple epidermal growth factor-like domains protein 8 / Homo sapiens    Q7Z7M0
• Myeloperoxidase / Homo sapiens    P05164
• Neogenin / Homo sapiens    Q92859
• Neuron navigator 2 / Homo sapiens    Q8IVL1
• Noelin / Homo sapiens    Q99784
• Oncoprotein-induced transcript 3 protein / Homo sapiens    Q8WWZ8
• Oncostatin-M-specific receptor subunit beta / Homo sapiens    Q99650
• Peroxidasin homolog / Homo sapiens    Q92626
• Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens    P80108
• Plasma protease c1 inhibitor / Homo sapiens    P05155
• Plasma serine protease inhibitor / Homo sapiens    P05154
• Plasminogen / Homo sapiens    P00747
• Platelet endothelial cell adhesion molecule / Homo sapiens    P16284
• Platelet glycoprotein V / Homo sapiens    P40197
• Platelet-derived growth factor subunit b / Homo sapiens    P01127
• Plexin-B1 / Homo sapiens    O43157
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolargin / Homo sapiens    P51888
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein heg homolog 1 / Homo sapiens    Q9ULI3
• Prothrombin / Homo sapiens    P00734
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens    P23470
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens    P28827
• Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens    Q86VB7
• Secretogranin-3 / Homo sapiens    Q8WXD2
• Selenoprotein P / Homo sapiens    P49908
• Semaphorin-4D / Homo sapiens    Q92854
• Serotransferrin / Homo sapiens    P02787
• Serum paraoxonase/arylesterase 1 / Homo sapiens    P27169
• Tenascin-N / Homo sapiens    Q9UQP3
• Tensin-2 / Homo sapiens    Q63HR2
• Thrombospondin-1 / Homo sapiens    P07996
• Thyroxine-binding globulin / Homo sapiens    P05543
• Trem-like transcript 2 protein / Homo sapiens    Q5T2D2
• Tumor necrosis factor receptor superfamily member 21 / Homo sapiens    O75509
• Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens    Q9Y274
• Tyrosine-protein kinase Mer / Homo sapiens    Q12866
• Tyrosine-protein kinase receptor TYRO3 / Homo sapiens    Q06418
• Tyrosine-protein kinase receptor UFO / Homo sapiens    P30530
• Uncharacterized protein from Blood Serum / Homo sapiens    
• Uromodulin / Homo sapiens    P07911
• Vascular cell adhesion protein 1 / Homo sapiens    P19320
• Vitronectin / Homo sapiens    P04004
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens    P54289
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Acetylcholinesterase / Bos taurus    P23795
• Alpha-1-acid glycoprotein / Bos taurus    Q3SZR3
• Alpha-2-hs-glycoprotein / Bos taurus    P12763
• Alpha-1-acid glycoprotein / Canis lupus familiaris    F6Y713
• Uncharacterized protein from Dander / Equus caballus    
• Synaptophysin-like protein 1 / Mus musculus    O09117
• Alpha-1-acid glycoprotein / Ovis aries    W5P7S6
• Riboflavin-binding protein / Gallus gallus    P02752
• Acetylcholine receptor protein / Torpedo californica    P02714    P02718    P02712    P02710
• Envelope glycoprotein / Friend murine leukemia virus    P03395
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Dander  
• Electric Organ (UBERON_0006869)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Placenta (UBERON_0001987)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Eveline (CVCL_A1LI)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Jurkat (CVCL_0065)  
• LS174T (CVCL_1384)  
• Low-Density Lipoprotein Particle (GO_0034362)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(?1-?) + 2 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-6)[Gal(b1-?)GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-?)GlcNAc(b1-?) + NeuAc(a2-3) + NeuAc(a2-6)"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-?)"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 1479
• N-Linked / Complex / Structure 2391
• N-Linked / Complex / Structure 2691
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 9319
• N-Linked / Complex / Structure 9462
• N-Linked / Complex / Structure 9821
• N-Linked / Complex / Structure 10038
• N-Linked / Complex / Structure 10438
• N-Linked / Complex / Structure 10456
• N-Linked / Complex / Structure 10501
• N-Linked / Complex / Structure 10612
• N-Linked / Complex / Structure 10693
• N-Linked / Complex / Structure 10898
• N-Linked / Complex / Structure 10908
• N-Linked / Complex / Structure 10926
• N-Linked / Complex / Structure 10932
• N-Linked / Complex / Structure 11148

Composition

• Hex:6 HexNAc:5 NeuAc:2 (avg mass : 2589.3605 )

Disease

• Cancer, breast (DOID:1612)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Diabetes Mellitus, Non-insulin dependent (DOID:9352)
• Esophageal cancer (DOID:5041)
• Familial hepatic adenoma (DOID:111366)
• Hypercholesterolemia, Familial (DOID:13810)
• Maturity-onset diabetes of the young type 3 (DOID:0111102)
• Mixed phenotype acute leukemia (DOID:9953)
• Multiple myeloma (DOID:9538)
• Prostate cancer (DOID:10283)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)

Reference

• Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
• Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Quantitative analysis of site-specific N-glycans on sera haptoglobin β chain in liver diseases. (2013 - Zhang S, Jiang K, Sun C, Lu H, Liu Y.) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
• Characterisation of horse dander allergen glycoproteins using amino acid and glycan structure analyses. A mass spectrometric method for glycan chain analysis of glycoproteins separated by two-dimensional electrophoresis. (2000 - Bulone V, Rademaker G, Pergantis S, Krogstad-Johnsen T, Smestad-Paulsen B, Thomas-Oates J) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
• Structures of sugar chains of hen egg yolk riboflavin-binding protein. (1993 - Tarutani M, Norioka N, Mega T, Hase S, Ikenaka T) / Status : Reviewed
• Structural study of the N-linked oligosaccharides of hepatocyte growth factor by two-dimensional sugar mapping. (1993 - Hara H, Nakae Y, Sogabe T, Ihara I, Ueno S, Sakai H, Inoue H, Shimizu S, Nakamura T, Shimizu N) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
• Structure determination of the glycans of human-serum alpha 1-antichymotrypsin using 1H-NMR spectroscopy and deglycosylation by N-glycanase. (1991 - Laine A, Hachulla E, Strecker G, Michalski J, Wieruszeski J) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
• Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
• The asparagine-linked oligosaccharides on bovine fetuin. Structural analysis of N-glycanase-released oligosaccharides by 500-megahertz 1H NMR spectroscopy. (1988 - Green E, Adelt G, Baenziger J, Wilson S, Van Halbeek H) / Status : Reviewed

Reported glycosite

• ADAM DEC1 / Homo sapiens
  •        Asn-184
• ADAMTS-like protein 2 / Homo sapiens
  •        Asn-428
  •        Asn-475
• Adenosine deaminase 2 / Homo sapiens
  •        Asn-174
  •        Asn-378
• Adhesion G protein-coupled receptor F5 / Homo sapiens
  •        Asn-301
• Adhesion G protein-coupled receptor L4 / Homo sapiens
  •        Asn-249
• Adhesion G-protein coupled receptor D1 / Homo sapiens
  •        Asn-319
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-56
  •        Asn-72
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-88
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Undefined site
  •        Asn-93
  •        Asn-106
  •        Asn-127
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Undefined site
  •        Asn-107
  •        Asn-271
• Alpha-1b-glycoprotein / Homo sapiens
  •        Asn-179
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
  •        Asn-176
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-1424
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-261
• Angiopoietin-1 receptor / Homo sapiens
  •        Asn-140
• Angiopoietin-related protein 4 / Homo sapiens
  •        Asn-177
• Angiotensin-converting enzyme / Homo sapiens
  •        Asn-695
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Angiotensinogen / Homo sapiens
  •        Asn-47
• Apolipoprotein (a) / Homo sapiens
  •        Asn-75
  •        Asn-4057
• Apolipoprotein B-100 / Homo sapiens
  •        Undefined site
  •        Asn-185
  •        Asn-3411
  •        Asn-3465
  •        Asn-3895
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Apolipoprotein F / Homo sapiens
  •        Asn-267
• Asialoglycoprotein receptor 2 / Homo sapiens
  •        Asn-170
• Attractin / Homo sapiens
  •        Asn-416
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-89
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
  •        Asn-253
• Beta-Ala-His dipeptidase / Homo sapiens
  •        Asn-382
• Biotinidase / Homo sapiens
  •        Asn-349
• Bone marrow stromal antigen 2 / Homo sapiens
  •        Asn-65
• C4b-binding protein alpha chain / Homo sapiens
  •        Asn-221
• C4b-binding protein beta chain / Homo sapiens
  •        Asn-214
• Cadherin-13 / Homo sapiens
  •        Asn-671
• Carboxypeptidase b2 / Homo sapiens
  •        Asn-73
• Carboxypeptidase N subunit 2 / Homo sapiens
  •        Asn-74
  •        Asn-348
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Catalase / Homo sapiens
  •        Asn-244
  •        Asn-481
• Cathepsin D / Homo sapiens
  •        Asn-263
• Cathepsin L1 / Homo sapiens
  •        Asn-221
• CD109 antigen / Homo sapiens
  •        Asn-337
• CD166 antigen / Homo sapiens
  •        Asn-91
• CD276 antigen / Homo sapiens
  •        Asn-104
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD48 antigen / Homo sapiens
  •        Asn-206
• Ceruloplasmin / Homo sapiens
  •        Asn-138
  •        Asn-358
  •        Asn-397
  •        Asn-762
• Cholesteryl ester transfer protein / Homo sapiens
  •        Asn-105
  •        Asn-358
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
  •        Asn-354
  •        Asn-374
• Coagulation factor IX / Homo sapiens
  •        Undefined site
• Coagulation factor VIII / Homo sapiens
  •        Asn-1461
• Coagulation factor XI / Homo sapiens
  •        Asn-90
  •        Asn-126
  •        Asn-450
  •        Asn-491
• Coagulation factor XIII B chain / Homo sapiens
  •        Asn-545
• Collagen alpha-3(VI) chain / Homo sapiens
  •        Asn-2324
  •        Asn-3037
• Complement factor h / Homo sapiens
  •        Asn-217
  •        Asn-882
  •        Asn-911
  •        Asn-1095
• Complement factor H-related protein 1 / Homo sapiens
  •        Asn-194
• Complement factor H-related protein 3 / Homo sapiens
  •        Asn-309
• Complement factor H-related protein 4 / Homo sapiens
  •        Asn-557
• Complement factor i / Homo sapiens
  •        Asn-103
  •        Asn-177
• Contactin-3 / Homo sapiens
  •        Asn-489
  •        Asn-624
• Contactin-4 / Homo sapiens
  •        Asn-705
  •        Asn-764
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-96
• Decorin / Homo sapiens
  •        Asn-211
  •        Asn-262
• Desmoglein-2 / Homo sapiens
  •        Asn-789
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens
  •        Asn-257
• Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
  •        Asn-714
• Endothelial cell-selective adhesion molecule / Homo sapiens
  •        Asn-213
• Endothelin-converting enzyme 1 / Homo sapiens
  •        Asn-210
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-271
  •        Asn-361
  •        Asn-816
• Epididymis-specific alpha-mannosidase / Homo sapiens
  •        Asn-336
• Erythropoietin / Homo sapiens
  •        Asn-65
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-444
• Extracellular sulfatase Sulf-2 / Homo sapiens
  •        Asn-149
• Fibrillin-1 / Homo sapiens
  •        Asn-78
  •        Asn-2767
• Fibroleukin / Homo sapiens
  •        Asn-336
• Follitropin, alpha and beta chains / Homo sapiens
  •        Undefined site
• Frizzled-6 / Homo sapiens
  •        Asn-38
• G-protein coupled receptor 126 / Homo sapiens
  •        Asn-314
  •        Asn-1169
• Galectin-3-binding protein / Homo sapiens
  •        Asn-398
• Gamma-glutamyltranspeptidase 1 / Homo sapiens
  •        Asn-120
• Glutaminase kidney isoform, mitochondrial / Homo sapiens
  •        Asn-620
• Glycocalicin / Homo sapiens
  •        Asn-362
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-207
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-64
  •        Asn-187
  •        Asn-453
• Heparin cofactor 2 / Homo sapiens
  •        Asn-49
• Hepatocyte growth factor / Homo sapiens
  •        Asn-294
  •        Asn-402
  •        Asn-566
  •        Asn-653
• Hepatocyte growth factor activator / Homo sapiens
  •        Asn-492
• Hepatocyte growth factor receptor / Homo sapiens
  •        Asn-785
  •        Asn-998
  •        Asn-1171
• HLA class II histocompatibility antigen, DP alpha 1 chain / Homo sapiens
  •        Asn-149
• Homeobox protein Hox-B3 / Homo sapiens
  •        Asn-226
• IgGFc-binding protein / Homo sapiens
  •        Asn-1063
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
  •        Asn-340
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Undefined site
  •        Asn-205
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-46
• Integrin alpha-5 / Homo sapiens
  •        Asn-518
  •        Asn-773
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens
  •        Asn-285
• Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
  •        Asn-715
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
  •        Asn-517
  •        Asn-577
• Intercellular adhesion molecule 2 / Homo sapiens
  •        Asn-153
  •        Asn-187
• Interleukin-1 receptor accessory protein / Homo sapiens
  •        Asn-57
• Interleukin-1 receptor-like 1 / Homo sapiens
  •        Asn-101
• Interleukin-6 receptor subunit beta / Homo sapiens
  •        Asn-157
• Junction plakoglobin / Homo sapiens
  •        Asn-195
• Kallistatin / Homo sapiens
  •        Asn-238
• Keratin, type I cytoskeletal 9 / Homo sapiens
  •        Asn-266
• Kininogen-1 / Homo sapiens
  •        Asn-169
  •        Asn-205
  •        Asn-294
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-89
  •        Asn-1614
  •        Asn-1700
  •        Asn-2028
  •        Asn-2558
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-315
  •        Asn-810
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1241
  •        Asn-1395
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-167
• Leptin receptor / Homo sapiens
  •        Asn-276
• Leucine-rich repeat-containing protein 15 / Homo sapiens
  •        Asn-369
• Leucyl-cystinyl aminopeptidase / Homo sapiens
  •        Asn-834
• Lipopolysaccharide-binding protein / Homo sapiens
  •        Asn-386
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
  •        Asn-160
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-103
  •        Asn-249
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-49
  •        Asn-58
  •        Asn-101
  •        Asn-257
  •        Asn-275
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens
  •        Asn-805
• Maltase-glucoamylase, intestinal / Homo sapiens
  •        Asn-912
• Mannan-binding lectin serine protease 1 / Homo sapiens
  •        Asn-178
• Mesothelin / Homo sapiens
  •        Asn-523
• Mimecan / Homo sapiens
  •        Asn-214
• Multimerin-1 / Homo sapiens
  •        Asn-344
  •        Asn-576
• Multimerin-2 / Homo sapiens
  •        Asn-249
• Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
  •        Asn-1271
• Myeloperoxidase / Homo sapiens
  •        Asn-355
  •        Asn-729
• Neogenin / Homo sapiens
  •        Asn-470
• Neuron navigator 2 / Homo sapiens
  •        Asn-1240
• Noelin / Homo sapiens
  •        Asn-394
• Oncoprotein-induced transcript 3 protein / Homo sapiens
  •        Asn-299
• Oncostatin-M-specific receptor subunit beta / Homo sapiens
  •        Asn-380
• Peroxidasin homolog / Homo sapiens
  •        Asn-1280
• Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
  •        Asn-568
• Plasma protease c1 inhibitor / Homo sapiens
  •        Asn-25
  •        Asn-69
  •        Asn-253
  •        Asn-352
• Plasma serine protease inhibitor / Homo sapiens
  •        Asn-262
• Plasminogen / Homo sapiens
  •        Asn-150
• Platelet endothelial cell adhesion molecule / Homo sapiens
  •        Asn-84
• Platelet glycoprotein V / Homo sapiens
  •        Asn-181
• Platelet-derived growth factor subunit b / Homo sapiens
  •        Asn-63
• Plexin-B1 / Homo sapiens
  •        Asn-1253
• Plexin-B2 / Homo sapiens
  •        Asn-1002
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-135
  •        Asn-499
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolargin / Homo sapiens
  •        Asn-289
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-1511
  •        Asn-1733
  •        Asn-1825
  •        Asn-2127
  •        Asn-2157
  •        Asn-3953
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
• Protein heg homolog 1 / Homo sapiens
  •        Asn-1101
• Prothrombin / Homo sapiens
  •        Asn-143
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Asn-421
  •        Asn-1019
• Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
  •        Asn-722
  •        Asn-1181
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-101
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
  •        Asn-131
• Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens
  •        Asn-1001
• Secretogranin-3 / Homo sapiens
  •        Asn-346
• Selenoprotein P / Homo sapiens
  •        Asn-83
• Semaphorin-4D / Homo sapiens
  •        Asn-379
• Serotransferrin / Homo sapiens
  •        Undefined site
  •        Asn-432
  •        Asn-630
• Serum paraoxonase/arylesterase 1 / Homo sapiens
  •        Asn-253
  •        Asn-324
• Tenascin-N / Homo sapiens
  •        Asn-1149
• Tensin-2 / Homo sapiens
  •        Asn-445
• Thrombospondin-1 / Homo sapiens
  •        Asn-521
  •        Asn-1051
  •        Asn-1067
• Thyroxine-binding globulin / Homo sapiens
  •        Asn-36
• Trem-like transcript 2 protein / Homo sapiens
  •        Asn-89
• Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
  •        Asn-573
• Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
  •        Asn-308
• Tyrosine-protein kinase Mer / Homo sapiens
  •        Asn-442
• Tyrosine-protein kinase receptor TYRO3 / Homo sapiens
  •        Asn-380
• Tyrosine-protein kinase receptor UFO / Homo sapiens
  •        Asn-40
  •        Asn-345
  •        Asn-682
• Uncharacterized protein from Blood Serum / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Undefined site
  •        Asn-232
  •        Asn-513
• Vascular cell adhesion protein 1 / Homo sapiens
  •        Asn-225
• Vitronectin / Homo sapiens
  •        Asn-86
  •        Asn-169
  •        Asn-242
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
  •        Asn-1042
• Von willebrand factor / Homo sapiens
  •        Asn-2585
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Alpha-1-acid glycoprotein / Bos taurus
  •        Undefined site
• Alpha-2-hs-glycoprotein / Bos taurus
  •        Undefined site
  •        Asn-99
  •        Asn-156
  •        Asn-176
• Alpha-1-acid glycoprotein / Canis lupus familiaris
  •        Undefined site
• Uncharacterized protein from Dander / Equus caballus
  •        Undefined site
• Synaptophysin-like protein 1 / Mus musculus
  •        Asn-72
• Alpha-1-acid glycoprotein / Ovis aries
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-334 and/or Asn-341
  •        Asn-341 and/or Asn-334
  •        Asn-266
  •        Asn-302
  •        Asn-374
  •        Asn-410
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165

Mass spectrometry observed peptide

• NPNATSSSSQDPESLQDR (18aa)
  •    P05155    Asn-25     Plasma protease c1 inhibitor / Homo sapiens
• CANLVPVPITNATLDR (16aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• VTACHSSQPNATLYK (15aa)
  •    P05543    Asn-36     Thyroxine-binding globulin / Homo sapiens
• MAYNMTFFPNLM (12aa)
  •    O60353    Asn-38     Frizzled-6 / Homo sapiens
• GTQAEESPFVGNPGNITGAR (20aa)
  •    P30530    Asn-40     Tyrosine-protein kinase receptor UFO / Homo sapiens
• NNSDISSTR (9aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• HLVIHNESTCEQLAK (15aa)
  •    P01019    Asn-47     Angiotensinogen / Homo sapiens
• NLSMPLLPADFHK (13aa)
  •    P05546    Asn-49     Heparin cofactor 2 / Homo sapiens
• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• KWFYIASAFRNEEYNKS (17aa)
  •    P02763    Asn-56     Alpha-1-acid glycoprotein 1 / Homo sapiens
• FNYSTAHSAGLTLIWYWTR (19aa)
  •    Q9NPH3    Asn-57     Interleukin-1 receptor accessory protein / Homo sapiens
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57     CD44 antigen / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• LLHGDPGEEDGAELDLNMTR (20aa)
  •    P01127    Asn-63     Platelet-derived growth factor subunit b / Homo sapiens
• CSDGWSFDATTLDDNGTMLFFK (22aa)
  •    P02790    Asn-64     Hemopexin / Homo sapiens
• NVTHLLQQELTEAQK (15aa)
  •    Q10589    Asn-65     Bone marrow stromal antigen 2 / Homo sapiens
• CIQANYSLMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• MLFVEPILEVSSLPTTNSTTNSATK (25aa)
  •    P05155    Asn-69     Plasma protease c1 inhibitor / Homo sapiens
• SVQEIQATFFYFTPNKTEDTIFLR (24aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• SVQEIQATFFYFTPNK (16aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• NQTVTATFGYPFR (13aa)
  •    O09117    Asn-72     Synaptophysin-like protein 1 / Mus musculus
• YFTPNKTEDTIFLR (14aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• KSVQEIQATFFYFTPNKT (18aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QVHFFVNASDVDNVK (15aa)
  •    Q96IY4    Asn-73     Carboxypeptidase b2 / Homo sapiens
• AFGSNPNLTK (10aa)
  •    P22792    Asn-74     Carboxypeptidase N subunit 2 / Homo sapiens
• TTENYPNAGLIMNYCR (16aa)
  •    P08519    Asn-75     Apolipoprotein (a) / Homo sapiens
• TLPGGNQCIVPICR (14aa)
  •    P35555    Asn-78     Fibrillin-1 / Homo sapiens
• AFITNFSMIIDGMTYPGIIK (20aa)
  •    Q14624    Asn-81     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• EGYSNISYIVVNHQGISSR (19aa)
  •    P49908    Asn-83     Selenoprotein P / Homo sapiens
• DDVLFYNISSMK (12aa)
  •    P16284    Asn-84     Platelet endothelial cell adhesion molecule / Homo sapiens
• NNATVHEQVGGPSLTSDLQAQSK (23aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• KNNATVHEQVGGPSLTSDLQAQSKG (25aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• KKKEDALNETRE (12aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KKKEDALNETRESETKL (17aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• NNATVHEQVGGPSITSDIQAQSK (23aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• AIVNFTR (7aa)
  •    P98160    Asn-89     Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
• VVNITMVALK (10aa)
  •    Q5T2D2    Asn-89     Trem-like transcript 2 protein / Homo sapiens
• ICNQNSSNPNQR (12aa)
  •    P24043    Asn-89     Laminin subunit alpha-2 / Homo sapiens
• LNLSENYTLSISNAR (15aa)
  •    Q13740    Asn-91     CD166 antigen / Homo sapiens
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-88     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
• LSLGAHNTTLTEILK (15aa)
  •    P01011    Asn-93     Alpha-1-antichymotrypsin / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QNQCFYNSSYINVQR (15aa)
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
• QDQCIYNTTYINVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• AQLLQGLGFNLTER (14aa)
  •    P08185    Asn-96     Corticosteroid-binding globulin / Homo sapiens
• AQIIQGIGFNITER (14aa)
  •    P08185    Asn-96     Corticosteroid-binding globulin / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• RPTGEVYDIEIDTLETTCHVLDPTPLANCSVR (32aa)
  •    P12763    Asn-99     Alpha-2-hs-glycoprotein / Bos taurus
• IAVQFGPGFSWIANFTK (17aa)
  •    P13473    Asn-101     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• TGYANVTIYK (10aa)
  •    Q01638    Asn-101     Interleukin-1 receptor-like 1 / Homo sapiens
• ENDTHCIDFSYLLYSQK (17aa)
  •    Q15262    Asn-101     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• GHTLTLNFTR (10aa)
  •    P11279    Asn-103     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• FLNNGTCTAEGK (12aa)
  •    P05156    Asn-103     Complement factor i / Homo sapiens
• TAIFPDIIAQGNASIR (16aa)
  •    Q5ZPR3    Asn-104     CD276 antigen / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• SIDVSIQNVSVVFK (14aa)
  •    P11597    Asn-105     Cholesteryl ester transfer protein / Homo sapiens
• FNLTETSEAEIHQSFQHLLR (20aa)
  •    P01011    Asn-106     Alpha-1-antichymotrypsin / Homo sapiens
• FNITETSEAEIHQSFQHIIR (20aa)
  •    P01011    Asn-106     Alpha-1-antichymotrypsin / Homo sapiens
• ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
  •    P01009    Asn-107     Alpha-1-antitrypsin / Homo sapiens
• DIVEYYNDSNGSHVLQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• LAFATMFNSSEQSQK (15aa)
  •    P19440    Asn-120     Gamma-glutamyltranspeptidase 1 / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• TLNQSSDELQLSMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• TLNQSSDELQLSMGN (15aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• TINQSSDEIQISMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• RTLNQSSDELQLSMGNAMFVKE (22aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• VNNGPLGNPIWNISGDPTR (19aa)
  •    P28827    Asn-131     Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
• RGLSFDVSLEVSQGPGLLNDTKV (23aa)
  •    P01833    Asn-135     Polymeric immunoglobulin receptor / Homo sapiens
• KEHEGAIYPDNTTDFQRADDKV (22aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• GDNVNISFK (9aa)
  •    Q02763    Asn-140     Angiopoietin-1 receptor / Homo sapiens
• YPHKPEINSTTHPGADLQENFCR (23aa)
  •    P00734    Asn-143     Prothrombin / Homo sapiens
• YLNEYNGSYVPPGWKEWVGLLK (22aa)
  •    Q8IWU5    Asn-149     Extracellular sulfatase Sulf-2 / Homo sapiens
• FFPPVLNVTWLCNGELVTEGVAESLFLPR (29aa)
  •    P20036    Asn-149     HLA class II histocompatibility antigen, DP alpha 1 chain / Homo sapiens
• FSPATHPSEGLEENYCR (17aa)
  •    P00747    Asn-150     Plasminogen / Homo sapiens
• GNETLHYETFGK (12aa)
  •    P13598    Asn-153     Intercellular adhesion molecule 2 / Homo sapiens
• LCPDCPLLAPLNDSR (15aa)
  •    P12763    Asn-156     Alpha-2-hs-glycoprotein / Bos taurus
• VCQDCPIIAPINDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• KVCQDCPLLAPLNDTRV (17aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• ETHLETNFTLK (11aa)
  •    P40189    Asn-157     Interleukin-6 receptor subunit beta / Homo sapiens
• IGSFEGIVNITFIHIQHNR (19aa)
  •    P51884    Asn-160     Lumican / Homo sapiens
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• RVYKPSAGNNSLYRD (15aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QQLQGVNVCGGR (12aa)
  •    Q14766    Asn-167     Latent transforming growth factor beta binding protein 1 / Homo sapiens
• HGIQYFNNNTQHSSLFMLNEVK (22aa)
  •    P01042    Asn-169     Kininogen-1 / Homo sapiens
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• HGIQYFNNNTQHSSLFTLNEVK (22aa)
  •    P01042    Asn-169     Kininogen-1 / Homo sapiens
  •    VAR_019278   178:M→T   dbSNP:rs1656922
• FVACQMELLHSNGSQR (16aa)
  •    P07307    Asn-170     Asialoglycoprotein receptor 2 / Homo sapiens
• VQNVTEFDDSLLR (13aa)
  •    Q9NZK5    Asn-174     Adenosine deaminase 2 / Homo sapiens
• VVHAVEVALATFNAESNGSYLQLVEISR (28aa)
  •    P12763    Asn-176     Alpha-2-hs-glycoprotein / Bos taurus
• AALAAFNAQNNGSNFQLEEISR (22aa)
  •    P02765    Asn-176     Alpha-2-HS-glycoprotein / Homo sapiens
• NAQNNGSNFQLEEISR (16aa)
  •    P02765    Asn-176     Alpha-2-HS-glycoprotein / Homo sapiens
• LSDLSINSTECLHVHCR (17aa)
  •    P05156    Asn-177     Complement factor i / Homo sapiens
• LPEMAQPVDPAHNVSR (16aa)
  •    Q9BY76    Asn-177     Angiopoietin-related protein 4 / Homo sapiens
• FGYILHTDNR (10aa)
  •    P48740    Asn-178     Mannan-binding lectin serine protease 1 / Homo sapiens
• EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR (33aa)
  •    P04217    Asn-179     Alpha-1b-glycoprotein / Homo sapiens
• LLDLSGNNLTHLPK (14aa)
  •    P40197    Asn-181     Platelet glycoprotein V / Homo sapiens
• MVSHHNITTGATIINEQWIITTAK (24aa)
  •    P00738    Asn-184     Haptoglobin / Homo sapiens
• MVSHHNLTTGATLINEQWLLTTAK (24aa)
  •    P00738    Asn-184     Haptoglobin / Homo sapiens
• EHAVFTSNQEEQDPANHTCGVK (22aa)
  •    O15204    Asn-184     ADAM DEC1 / Homo sapiens
• KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
  •    P00738    Asn-184     Haptoglobin / Homo sapiens
• QVLFLDTVYGNCSTHFTVK (19aa)
  •    P04114    Asn-185     Apolipoprotein B-100 / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• SWPAVGNCSSAIR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• NFSCLAVLDLMSR (13aa)
  •    P13598    Asn-187     Intercellular adhesion molecule 2 / Homo sapiens
• TMQNTSDLDTAR (12aa)
  •    P14923    Asn-195     Junction plakoglobin / Homo sapiens
• ITYSIVQTNCSK (12aa)
  •    P01042    Asn-205     Kininogen-1 / Homo sapiens
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• NGTVCLSPPCTLAR (14aa)
  •    P09326    Asn-206     CD48 antigen / Homo sapiens
• NLFLNHSENATAK (13aa)
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
• IGGWNITGPWAK (12aa)
  •    P42892    Asn-210     Endothelin-converting enzyme 1 / Homo sapiens
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• GSLSLTNLSSSMAGVYVCK (19aa)
  •    Q96AP7    Asn-213     Endothelial cell-selective adhesion molecule / Homo sapiens
• KLNNLTFLYLDHNALESVPLNLPESLR (27aa)
  •    P20774    Asn-214     Mimecan / Homo sapiens
• NLCEAMENFMQQLK (14aa)
  •    P20851    Asn-214     C4b-binding protein beta chain / Homo sapiens
• LNNLTFLYLDHNALESVPLNLPESLR (26aa)
  •    P20774    Asn-214     Mimecan / Homo sapiens
• SPDVINGSPISQK (13aa)
  •    P08603    Asn-217     Complement factor h / Homo sapiens
• ASISCTVENETIGVWRPSPPTCEK (24aa)
  •    P04003    Asn-221     C4b-binding protein alpha chain / Homo sapiens
• YSVANDTGFVDIPK (14aa)
  •    P07711    Asn-221     Cathepsin L1 / Homo sapiens
• NTVISVNPSTK (11aa)
  •    P19320    Asn-225     Vascular cell adhesion protein 1 / Homo sapiens
• VEMANLLNLSER (12aa)
  •    P14651    Asn-226     Homeobox protein Hox-B3 / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• NTTVRVPMMLQDQE (14aa)
  •    P29622    Asn-238     Kallistatin / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• KVVLHPNYSQVDIGLIKL (18aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• VVIHPNYSQVDIGIIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• NISDGFDGIPDNVDAALALPAHSYSGR (27aa)
  •    P04004    Asn-242     Vitronectin / Homo sapiens
• FEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR (39aa)
  •    P04004    Asn-242     Vitronectin / Homo sapiens
• NLSVEDAAR (9aa)
  •    P04040    Asn-244     Catalase / Homo sapiens
• SFNQSLHSLTQAIR (14aa)
  •    Q9H8L6    Asn-249     Multimerin-2 / Homo sapiens
• TTEFDTNSTDIALK (14aa)
  •    Q9HBW9    Asn-249     Adhesion G protein-coupled receptor L4 / Homo sapiens
• HANWTLTPLK (10aa)
  •    P27169    Asn-253     Serum paraoxonase/arylesterase 1 / Homo sapiens
• IGNWSAMPSCK (11aa)
  •    P02749    Asn-253     Beta-2-glycoprotein 1 / Homo sapiens
• VLSNNSDANLELINTWVAK (19aa)
  •    P05155    Asn-253     Plasma protease c1 inhibitor / Homo sapiens
• LGNWSAMPSCK (11aa)
  •    P02749    Asn-253     Beta-2-glycoprotein 1 / Homo sapiens
• VASVININPNTTHSTGSCR (19aa)
  •    P13473    Asn-257     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• VINMSYHPR (9aa)
  •    Q93070    Asn-257     Ecto-ADP-ribosyltransferase 4 / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• VFPQVNVTK (9aa)
  •    P54802    Asn-261     Alpha-n-acetylglucosaminidase / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• VVGVPYQGNATALFILPSEGK (21aa)
  •    P05154    Asn-262     Plasma serine protease inhibitor / Homo sapiens
• GSLSYLNVTR (10aa)
  •    P07339    Asn-263     Cathepsin D / Homo sapiens
• QVLDNLTMEK (10aa)
  •    P35527    Asn-266     Keratin, type I cytoskeletal 9 / Homo sapiens
• DANISQPETTK (11aa)
  •    Q13790    Asn-267     Apolipoprotein F / Homo sapiens
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• YTGNASALFILPDQDK (16aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• KYTGNASALFILPDQDKM (18aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• KYLGNATAIFFLPDEGKL (18aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• DTCPPLMLYNPTTYQMDVNPEGK (23aa)
  •    P00533    Asn-271     Epidermal growth factor receptor / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• YSENSTTVIR (10aa)
  •    P48357    Asn-276     Leptin receptor / Homo sapiens
• ICDLLVANNHFAHFFAPQNLTNMNK (25aa)
  •    P19827    Asn-285     Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens
• NSFNISNLLVLHLSHNR (17aa)
  •    P51888    Asn-289     Prolargin / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• INAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• GVSNGTHVNILFSLK (15aa)
  •    Q8WWZ8    Asn-299     Oncoprotein-induced transcript 3 protein / Homo sapiens
• EVLSSNVSWR (10aa)
  •    Q8IZF2    Asn-301     Adhesion G protein-coupled receptor F5 / Homo sapiens
• NVTAEQLFLK (10aa)
  •    Q9Y274    Asn-308     Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
• LGYNANTSILSFQAVCR (17aa)
  •    Q02985    Asn-309     Complement factor H-related protein 3 / Homo sapiens
• LWNFTMNAK (9aa)
  •    Q86SQ4    Asn-314     G-protein coupled receptor 126 / Homo sapiens
• HVNEINATIYLLK (13aa)
  •    Q16363    Asn-315     Laminin subunit alpha-4 / Homo sapiens
• SLSEQTALNLTK (12aa)
  •    Q6QNK2    Asn-319     Adhesion G-protein coupled receptor D1 / Homo sapiens
• VTQVYAENGTVIQGSTVASVYK (22aa)
  •    P27169    Asn-324     Serum paraoxonase/arylesterase 1 / Homo sapiens
• VTQVYAENGTVLQGSTVASVYK (22aa)
  •    P27169    Asn-324     Serum paraoxonase/arylesterase 1 / Homo sapiens
• ALHALNVTWR (10aa)
  •    Q9Y2E5    Asn-336     Epididymis-specific alpha-mannosidase / Homo sapiens
• LHVGNYNGTAGDALR (15aa)
  •    Q14314    Asn-336     Fibroleukin / Homo sapiens
• NVSTNVFFK (9aa)
  •    Q6YHK3    Asn-337     CD109 antigen / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• IDNISLTVNDVR (12aa)
  •    Q13201    Asn-344     Multimerin-1 / Homo sapiens
• NGSQAFVHWQEPR (13aa)
  •    P30530    Asn-345     Tyrosine-protein kinase receptor UFO / Homo sapiens
• NATDNISK (8aa)
  •    Q8WXD2    Asn-346     Secretogranin-3 / Homo sapiens
• LYLGSNNLTALHPALFQNLSK (21aa)
  •    P22792    Asn-348     Carboxypeptidase N subunit 2 / Homo sapiens
• NPVGLIGAENATGETDPSHSK (21aa)
  •    P43251    Asn-349     Biotinidase / Homo sapiens
• VGQLQLSHNLSLVILVPQNLK (21aa)
  •    P05155    Asn-352     Plasma protease c1 inhibitor / Homo sapiens
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• NMSNQLGLLAVNQR (14aa)
  •    P05164    Asn-355     Myeloperoxidase / Homo sapiens
• GVVVNSSVMVK (11aa)
  •    P11597    Asn-358     Cholesteryl ester transfer protein / Homo sapiens
• AGIQAFFQVQECNK (14aa)
  •    P00450    Asn-358     Ceruloplasmin / Homo sapiens
• AGLQAFFQVQECNK (14aa)
  •    P00450    Asn-358     Ceruloplasmin / Homo sapiens
• NCTSISGDLHILPVAFR (17aa)
  •    P00533    Asn-361     Epidermal growth factor receptor / Homo sapiens
• WTPNFTLHMESITFSK (16aa)
  •    P07359    Asn-362     Glycocalicin / Homo sapiens
• MLANLQNISLQNNR (14aa)
  •    Q8TF66    Asn-369     Leucine-rich repeat-containing protein 15 / Homo sapiens
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• RLANLTQGEDQYYLRV (16aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• NILDALMLNTTR (12aa)
  •    Q9NZK5    Asn-378     Adenosine deaminase 2 / Homo sapiens
• AANYTSSLNLPDK (13aa)
  •    Q92854    Asn-379     Semaphorin-4D / Homo sapiens
• ANLTGWDPQK (10aa)
  •    Q06418    Asn-380     Tyrosine-protein kinase receptor TYRO3 / Homo sapiens
• MMQYNVSIK (9aa)
  •    Q99650    Asn-380     Oncostatin-M-specific receptor subunit beta / Homo sapiens
• LVPHMNVSAVEK (12aa)
  •    Q96KN2    Asn-382     Beta-Ala-His dipeptidase / Homo sapiens
• LSVATNVSATLTFNTSK (17aa)
  •    P18428    Asn-386     Lipopolysaccharide-binding protein / Homo sapiens
• LDPVSLQTLQTWNTSYPK (18aa)
  •    Q99784    Asn-394     Noelin / Homo sapiens
• ENITAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397     Ceruloplasmin / Homo sapiens
• ENLTAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397     Ceruloplasmin / Homo sapiens
• YKGLNLTEDTYKPR (14aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• IDSTGNVTNELR (12aa)
  •    O75882    Asn-416     Attractin / Homo sapiens
• SFHNFTLCYIK (11aa)
  •    P08575    Asn-421     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• NVTGTPLTGDK (11aa)
  •    Q86TH1    Asn-428     ADAMTS-like protein 2 / Homo sapiens
• CGIVPVIAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• CGLVPVLAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• KCGLVPVLAENYNKS (15aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• ELLEEVGQNGSR (12aa)
  •    Q12866    Asn-442     Tyrosine-protein kinase Mer / Homo sapiens
• HIPGLIHNMTAR (12aa)
  •    Q16610    Asn-444     Extracellular matrix protein 1 / Homo sapiens
• GSTPRNDPSVSVDYNTTEPAVR (22aa)
  •    Q63HR2    Asn-445     Tensin-2 / Homo sapiens
• ALPQPQNVTSLLGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• AIPQPQNVTSIIGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• TPASDPHGDNLTYSVFYTK (19aa)
  •    Q92859    Asn-470     Neogenin / Homo sapiens
• DFTLNETVNSIFAQGAPR (18aa)
  •    Q86TH1    Asn-475     ADAMTS-like protein 2 / Homo sapiens
• NFTEVHPDYGSHIQALLDK (19aa)
  •    P04040    Asn-481     Catalase / Homo sapiens
• ANGTTHLVVTEPTR (14aa)
  •    Q9P232    Asn-489     Contactin-3 / Homo sapiens
• LETTVNYTDSQRPICLPSK (19aa)
  •    P03951    Asn-491     Coagulation factor XI / Homo sapiens
• YIPYTLYSVFNPSDHDLVLIR (21aa)
  •    Q04756    Asn-492     Hepatocyte growth factor activator / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens
• LPTQNITFQTESSVAEQEAEFQSPK (25aa)
  •    Q14624    Asn-517     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• IPTQNITFQTESSVAEQEAEFQSPK (25aa)
  •    Q14624    Asn-517     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• SCSLEGNPVACINLSFCLNASGK (23aa)
  •    P08648    Asn-518     Integrin alpha-5 / Homo sapiens
• LCNNPTPQFGGK (12aa)
  •    P07996    Asn-521     Thrombospondin-1 / Homo sapiens
• ALSQQNVSMDLATFMK (16aa)
  •    Q13421    Asn-523     Mesothelin / Homo sapiens
• HGVIISSTVDTYENGSSVEYR (21aa)
  •    P05160    Asn-545     Coagulation factor XIII B chain / Homo sapiens
• LGYNANTSVLSFQAVCR (17aa)
  •    Q92496    Asn-557     Complement factor H-related protein 4 / Homo sapiens
• LNVEAANWTVR (11aa)
  •    P80108    Asn-568     Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
• NGSFITK (7aa)
  •    O75509    Asn-573     Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
• INNLTVSLEMEK (12aa)
  •    Q13201    Asn-576     Multimerin-1 / Homo sapiens
• NQALNLSLAYSFVTPLTSMVVTK (23aa)
  •    Q14624    Asn-577     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• WNNTPMDEALHFGHHDVFK (19aa)
  •    O94925    Asn-620     Glutaminase kidney isoform, mitochondrial / Homo sapiens
• DNHSPVISYSIQAR (14aa)
  •    Q9P232    Asn-624     Contactin-3 / Homo sapiens
• QQQHLFGSNVTDCSGNFCLFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• QQQHIFGSNVTDCSGNFCIFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• ANYNLPIMVTDSGKPPMTNITDLR (24aa)
  •    P55290    Asn-671     Cadherin-13 / Homo sapiens
• NCMLNENMSVCVADFGLSK (19aa)
  •    P30530    Asn-682     Tyrosine-protein kinase receptor UFO / Homo sapiens
• NMQIANHTLK (10aa)
  •    P12821    Asn-695     Angiotensin-converting enzyme / Homo sapiens
• TEEALPEVTPANVSGGGGSK (20aa)
  •    Q8IWV2    Asn-705     Contactin-4 / Homo sapiens
• NISDISENLK (10aa)
  •    Q6P179    Asn-714     Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
• NICFNIDSEPGK (12aa)
  •    P19823    Asn-715     Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
• NTSGMISRPAPGR (13aa)
  •    P23470    Asn-722     Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
• DFVNCSTLPALNLASWR (17aa)
  •    P05164    Asn-729     Myeloperoxidase / Homo sapiens
• LHHLQEQNVSNAFLDKGE (18aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• KELHHLQEQNVSNAFLDKG (19aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• NESVHPFSPFEVK (13aa)
  •    Q8IWV2    Asn-764     Contactin-4 / Homo sapiens
• NLNNSQSDVVSFR (13aa)
  •    P08648    Asn-773     Integrin alpha-5 / Homo sapiens
• NFTVACQHR (9aa)
  •    P08581    Asn-785     Hepatocyte growth factor receptor / Homo sapiens
• AASYTEEDENHTAK (14aa)
  •    Q14126    Asn-789     Desmoglein-2 / Homo sapiens
• DIMNDSNYIVK (11aa)
  •    P07333    Asn-805     Macrophage colony-stimulating factor 1 receptor / Homo sapiens
• RPASNVSASIQR (12aa)
  •    Q16363    Asn-810     Laminin subunit alpha-4 / Homo sapiens
• DNIGSQYLLNWCVQIAK (17aa)
  •    P00533    Asn-816     Epidermal growth factor receptor / Homo sapiens
• SAIIEFACTHNIGNCSTTAMK (21aa)
  •    Q9UIQ6    Asn-834     Leucyl-cystinyl aminopeptidase / Homo sapiens
• IPCSQPPQIEHGTINSSR (18aa)
  •    P08603    Asn-882     Complement factor h / Homo sapiens
• ISEENETTCYMGK (13aa)
  •    P08603    Asn-911     Complement factor h / Homo sapiens
• ILGTEEPSNVTVK (13aa)
  •    O43451    Asn-912     Maltase-glucoamylase, intestinal / Homo sapiens
• SVSPTTEMVSNESVDYR (17aa)
  •    P08581    Asn-998     Hepatocyte growth factor receptor / Homo sapiens
• GNESSLWDCPAR (12aa)
  •    Q86VB7    Asn-1001     Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens
• SINVTGQGFSLIQR (14aa)
  •    O15031    Asn-1002     Plexin-B2 / Homo sapiens
• YINASFIMSYWK (12aa)
  •    P08575    Asn-1019     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• LLIQAEQTSDGPNPCDMVK (19aa)
  •    P54289    Asn-1042     Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
• QVTQSYWDTNPTR (13aa)
  •    P07996    Asn-1051     Thrombospondin-1 / Homo sapiens
• NECGILADPK (10aa)
  •    Q9Y6R7    Asn-1063     IgGFc-binding protein / Homo sapiens
• VVNSTTGPGEHLR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• SPYEMFGDEEVMCLNGNWTEPPQCK (25aa)
  •    Q03591    Asn-194     Complement factor H-related protein 1 / Homo sapiens
  •    P08603    Asn-1095     Complement factor h / Homo sapiens
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TLNMCFSALPSYIR (14aa)
  •    Q9ULI3    Asn-1101     Protein heg homolog 1 / Homo sapiens
• LHNLTTGTPAR (11aa)
  •    Q9UQP3    Asn-1149     Tenascin-N / Homo sapiens
• SLSSSSIGSNSTYLTSK (17aa)
  •    Q86SQ4    Asn-1169     G-protein coupled receptor 126 / Homo sapiens
• NETHNPTVK (9aa)
  •    P08581    Asn-1171     Hepatocyte growth factor receptor / Homo sapiens
• NSSVVPSER (9aa)
  •    P23470    Asn-1181     Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
• SSTSSIDSNISSK (13aa)
  •    Q8IVL1    Asn-1240     Neuron navigator 2 / Homo sapiens
• NISQDLEK (8aa)
  •    P11047    Asn-1241     Laminin subunit gamma-1 / Homo sapiens
• YTLDPNITSAGPTK (14aa)
  •    O43157    Asn-1253     Plexin-B1 / Homo sapiens
• ALLTNVSSVALGSR (14aa)
  •    Q7Z7M0    Asn-1271     Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
• ILCDNADNITR (11aa)
  •    Q92626    Asn-1280     Peroxidasin homolog / Homo sapiens
• IPAINQTITEANEK (14aa)
  •    P11047    Asn-1395     Laminin subunit gamma-1 / Homo sapiens
• VSNQTLSLFFTVLQDVPVR (19aa)
  •    P01023    Asn-1424     Alpha-2-macroglobulin / Homo sapiens
• NNLSLAILTLEMTGDQR (17aa)
  •    P00451    Asn-1461     Coagulation factor VIII / Homo sapiens
• WTGHNVTVVQR (11aa)
  •    Q07954    Asn-1511     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• MLYGLENMTQELK (13aa)
  •    P24043    Asn-1614     Laminin subunit alpha-2 / Homo sapiens
• LNETLGTR (8aa)
  •    P24043    Asn-1700     Laminin subunit alpha-2 / Homo sapiens
• LYWTDGDNISMANMDGSNR (19aa)
  •    Q07954    Asn-1733     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• NSTTLVMHMK (10aa)
  •    Q07954    Asn-1825     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• LSAIPNDTAAK (11aa)
  •    P24043    Asn-2028     Laminin subunit alpha-2 / Homo sapiens
• DNATDSVPLR (10aa)
  •    Q07954    Asn-2127     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• GTNVCAVANGGCQQLCLYR (19aa)
  •    Q07954    Asn-2157     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• GNPGEPGLNGTTGPK (15aa)
  •    P12111    Asn-2324     Collagen alpha-3(VI) chain / Homo sapiens
• NESGIILLGSGGTPAPPR (18aa)
  •    P24043    Asn-2558     Laminin subunit alpha-2 / Homo sapiens
• MEACMLNGTVIGPGK (15aa)
  •    P04275    Asn-2585     Von willebrand factor / Homo sapiens
• TAIFAFNISHVSNK (14aa)
  •    P35555    Asn-2767     Fibrillin-1 / Homo sapiens
• QNLTVTDR (8aa)
  •    P12111    Asn-3037     Collagen alpha-3(VI) chain / Homo sapiens
• VEGSHNSTVSLTTK (14aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens
• YDFNSSMLYSTAK (13aa)
  •    P04114    Asn-3465     Apolipoprotein B-100 / Homo sapiens
• FEVDSPVYNATWSASLK (17aa)
  •    P04114    Asn-3895     Apolipoprotein B-100 / Homo sapiens
• FEVDSPVYNATWSASIK (17aa)
  •    P04114    Asn-3895     Apolipoprotein B-100 / Homo sapiens
• GVTHLNISGLK (11aa)
  •    Q07954    Asn-3953     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• TPENYPNAGLTENYCR (16aa)
  •    P08519    Asn-4057     Apolipoprotein (a) / Homo sapiens