taxonomy (2)
protein (6)
source (3)
structure (2)
composition (1)
disease (1)
reference (3)
site (6)
peptide (6)
- Alpha-S1-casein / Homo sapiens P47710
- Haptoglobin / Homo sapiens P00738
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Uromodulin / Homo sapiens P07911
- Uncharacterized protein / Rattus norvegicus
Protein
- Milk (UBERON_0001913)
- Urine (UBERON_0001088)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9440
Reported structure
- Hex:7 HexNAc:5 (avg mass : 2168.9871 )
Composition
- Prostate cancer (DOID:10283)
Disease
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed
Reference
- Alpha-S1-casein / Homo sapiens
- Haptoglobin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Uromodulin / Homo sapiens
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
Reported glycosite
-
- N-Linked / Complex
(avg mass : 2168.9871)
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 2168.9871)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Haptoglobin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- KDTRNESTQNCVVAEPEKM (19aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKC (34aa)
- KNLFLNHSENATAKD (15aa)
-
- Hex:7 HexNAc:5 / N-Linked
(avg mass : 2168.9871)
- Urine (UBERON_0001088)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9440
- Prostate cancer (DOID:10283)
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Uromodulin / Homo sapiens
Source
Suggested structure
Disease
Reported glycosite
- Hex:7 HexNAc:5 / N-Linked
(avg mass : 2168.9871)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 2168.9871)
Reported glycosite
- N-Linked / Complex
(avg mass : 2168.9871)