Hex:7 HexNAc:6 NeuAc:4

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Torpedo californica (Pacific electric ray)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• Aggrecan core protein / Homo sapiens    P16112
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Apolipoprotein (a) / Homo sapiens    P08519
• Apolipoprotein D / Homo sapiens    P05090
• Butyrophilin subfamily 1 member A1 / Homo sapiens    Q13410
• Coagulation factor IX / Homo sapiens    P00740
• Folate receptor alpha / Homo sapiens    P15328
• Follitropin, alpha and beta chains / Homo sapiens    P01225    P01215
• G-protein coupled receptor 126 / Homo sapiens    Q86SQ4
• Glucose-6-phosphate isomerase / Homo sapiens    P06744
• Haptoglobin / Homo sapiens    P00738
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Kallistatin / Homo sapiens    P29622
• Kininogen-1 / Homo sapiens    P01042
• Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens    P38571
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Multimerin-2 / Homo sapiens    Q9H8L6
• Nitrogen permease regulator 3-like protein / Homo sapiens    Q12980
• Plasma protease c1 inhibitor / Homo sapiens    P05155
• Plasminogen / Homo sapiens    P00747
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Receptor-type tyrosine-protein phosphatase F / Homo sapiens    P10586
• Uncharacterized protein from Pleura / Homo sapiens    
• Uromodulin / Homo sapiens    P07911
• V-type proton ATPase subunit S1 / Mus musculus    Q9R1Q9
• Alpha-1-acid glycoprotein / Ovis aries    W5P7S6
• Acetylcholine receptor protein / Torpedo californica    P02712    P02718    P02710    P02714
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Electric Organ (UBERON_0006869)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   Sf21 (CVCL_0518)  
• Placenta (UBERON_0001987)  
• Pleura (UBERON_0000977)   K-562 (CVCL_0004)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(?1-?) + 4 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3) + 2 x NeuAc(2-6)"
• N-Linked / Complex / Structure 775
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3) + 2 x NeuAc(a2-6)"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 10751
• N-Linked / Complex / Structure 10927

Composition

• Hex:7 HexNAc:6 NeuAc:4 (avg mass : 3537.2137 )

Disease

• Cancer, breast (DOID:1612)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Familial hepatic adenoma (DOID:111366)
• Leukemia, Myloid, Chronic (DOID:8552)
• Maturity-onset diabetes of the young type 3 (DOID:0111102)
• Myeloma, Multiple (DOID:9538)
• Prostate cancer (DOID:10283)

Reference

• Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
• Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
• Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
• The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-381
• Aggrecan core protein / Homo sapiens
  •        Asn-658
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-93
  •        Asn-103
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-88
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-106
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Undefined site
• Apolipoprotein (a) / Homo sapiens
  •        Asn-4057
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Butyrophilin subfamily 1 member A1 / Homo sapiens
  •        Asn-55
• Coagulation factor IX / Homo sapiens
  •        Undefined site
• Folate receptor alpha / Homo sapiens
  •        Asn-161
• Follitropin, alpha and beta chains / Homo sapiens
  •        Undefined site
• G-protein coupled receptor 126 / Homo sapiens
  •        Asn-1169
• Glucose-6-phosphate isomerase / Homo sapiens
  •        Asn-91
• Haptoglobin / Homo sapiens
  •        Asn-241
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-272
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Kallistatin / Homo sapiens
  •        Asn-108
• Kininogen-1 / Homo sapiens
  •        Asn-169
• Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
  •        Asn-161
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-101
• Multimerin-2 / Homo sapiens
  •        Asn-205
• Nitrogen permease regulator 3-like protein / Homo sapiens
  •        Asn-465
• Plasma protease c1 inhibitor / Homo sapiens
  •        Asn-69
• Plasminogen / Homo sapiens
  •        Undefined site
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Receptor-type tyrosine-protein phosphatase F / Homo sapiens
  •        Asn-1731
• Uncharacterized protein from Pleura / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Undefined site
  •        Asn-232
  •        Asn-322
• V-type proton ATPase subunit S1 / Mus musculus
  •        Asn-344
• Alpha-1-acid glycoprotein / Ovis aries
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-74

Mass spectrometry observed peptide

• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• RLSPNASAEHLELRW (15aa)
  •    Q13410    Asn-55     Butyrophilin subfamily 1 member A1 / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• MLFVEPILEVSSLPTTNSTTNSATK (25aa)
  •    P05155    Asn-69     Plasma protease c1 inhibitor / Homo sapiens
• SVQEIQATFFYFTPNK (16aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• YFTPNKTEDTIFLR (14aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• SVQEIQATFFYFTPNKTEDTIFLR (24aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• INYTEGR (7aa)
  •    P06744    Asn-91     Glucose-6-phosphate isomerase / Homo sapiens
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P19652    Asn-88     Alpha-1-acid glycoprotein 2 / Homo sapiens
• QDQCIYNTTYINVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• IAVQFGPGFSWIANFTK (17aa)
  •    P13473    Asn-101     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• ENGTISR (7aa)
  •    P02763    Asn-103     Alpha-1-acid glycoprotein 1 / Homo sapiens
• FNLTETSEAEIHQSFQHLLR (20aa)
  •    P01011    Asn-106     Alpha-1-antichymotrypsin / Homo sapiens
• SQILEGLGFNLTELSESDVHR (21aa)
  •    P29622    Asn-108     Kallistatin / Homo sapiens
• GWNWTSGFNK (10aa)
  •    P15328    Asn-161     Folate receptor alpha / Homo sapiens
• YDIPASINFIINK (13aa)
  •    P38571    Asn-161     Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
• HGIQYFNNNTQHSSLFTLNEVK (22aa)
  •    P01042    Asn-169     Kininogen-1 / Homo sapiens
  •    VAR_019278   178:M→T   dbSNP:rs1656922
• ALPGNLTAAVMEANQTGHEFPDR (23aa)
  •    Q9H8L6    Asn-205     Multimerin-2 / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• KYTGNASALFILPDQDKM (18aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• YTGNASALFILPDQDKMEEVEAMLLPETLK (30aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• YTGNASALFILPDQDK (16aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• THTNISESHPNATFSAVGEASICEDDWNSGER (32aa)
  •    P01871    Asn-272     Immunoglobulin heavy constant mu / Homo sapiens
• QDFNITDISLLEHR (14aa)
  •    P07911    Asn-322     Uromodulin / Homo sapiens
• LEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSVSK (35aa)
  •    Q9R1Q9    Asn-344     V-type proton ATPase subunit S1 / Mus musculus
• IIIAGTNSSDIQQIISIIESNK (22aa)
  •    P08195    Asn-381     4F2 cell-surface antigen heavy chain / Homo sapiens
• DNSSAELLPSGDSPLNQR (18aa)
  •    Q12980    Asn-465     Nitrogen permease regulator 3-like protein / Homo sapiens
• TVYLYPNQTGLPDPLSR (17aa)
  •    P16112    Asn-658     Aggrecan core protein / Homo sapiens
• SLSSSSIGSNSTYLTSK (17aa)
  •    Q86SQ4    Asn-1169     G-protein coupled receptor 126 / Homo sapiens
• MLWEHNSTIIVMLTK (15aa)
  •    P10586    Asn-1731     Receptor-type tyrosine-protein phosphatase F / Homo sapiens
• TPENYPNAGLTENYCR (16aa)
  •    P08519    Asn-4057     Apolipoprotein (a) / Homo sapiens