Hex:6 HexNAc:5 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Columba livia (Domestic pigeon)
• Friend murine leukemia virus (F-mulv)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• Adhesion G protein-coupled receptor L4 / Homo sapiens    Q9HBW9
• Adhesion G-protein coupled receptor D1 / Homo sapiens    Q6QNK2
• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens    P05186
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Alpha-S1-casein / Homo sapiens    P47710
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein d / Homo sapiens    P05090
• Apolipoprotein f / Homo sapiens    Q13790
• Asporin / Homo sapiens    Q9BXN1
• Attractin / Homo sapiens    O75882
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Biglycan / Homo sapiens    P21810
• Biotinidase / Homo sapiens    P43251
• Butyrophilin subfamily 1 member A1 / Homo sapiens    Q13410
• C-type mannose receptor 2 / Homo sapiens    Q9UBG0
• Cadherin-5 / Homo sapiens    P33151
• Cadherin-related family member 2 / Homo sapiens    Q9BYE9
• Carboxypeptidase D / Homo sapiens    O75976
• Catalase / Homo sapiens    P04040
• Cation-independent mannose-6-phosphate receptor / Homo sapiens    P11717
• CD109 antigen / Homo sapiens    Q6YHK3
• CD166 antigen / Homo sapiens    Q13740
• CD59 glycoprotein / Homo sapiens    P13987
• CD63 antigen / Homo sapiens    P08962
• CD97 antigen / Homo sapiens    P48960
• Ceruloplasmin / Homo sapiens    P00450
• Cholinesterase / Homo sapiens    P06276
• Chordin-like protein 2 / Homo sapiens    Q6WN34
• Clusterin / Homo sapiens    P10909
• Coagulation factor VIII / Homo sapiens    P00451
• Coagulation factor x / Homo sapiens    P00742
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Complement C1q subcomponent subunit A / Homo sapiens    P02745
• Complement c1r subcomponent / Homo sapiens    P00736
• Complement C2 / Homo sapiens    P06681
• Complement c4-a / Homo sapiens    P0C0L4
• Complement C4-B / Homo sapiens    P0C0L5
• Complement factor h / Homo sapiens    P08603
• Contactin-4 / Homo sapiens    Q8IWV2
• Decorin / Homo sapiens    P07585
• Desmoglein-2 / Homo sapiens    Q14126
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens    P78536
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens    Q93070
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Ectopic P granules protein 5 homolog / Homo sapiens    Q9HCE0
• Endothelial cell-selective adhesion molecule / Homo sapiens    Q96AP7
• Endothelin-converting enzyme 1 / Homo sapiens    P42892
• Epidermal growth factor receptor / Homo sapiens    P00533
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Extracellular serine/threonine protein kinase FAM20C / Homo sapiens    Q8IXL6
• Fibroleukin / Homo sapiens    Q14314
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Fibulin-1 / Homo sapiens    P23142
• G-protein coupled receptor 126 / Homo sapiens    Q86SQ4
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-glutamyltranspeptidase 1 / Homo sapiens    P19440
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• HLA class II histocompatibility antigen, DRB1-11 beta chain / Homo sapiens    P20039
• HLA class II histocompatibility antigen, DRB1-13 beta chain / Homo sapiens    Q5Y7A7
• HLA class II histocompatibility antigen, DRB1-14 beta chain / Homo sapiens    Q9GIY3
• HLA class II histocompatibility antigen, DRB1-3 chain / Homo sapiens    P01912
• Homeobox protein Hox-B3 / Homo sapiens    P14651
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Insulin receptor / Homo sapiens    P06213
• Insulin-like growth factor-binding protein 3 / Homo sapiens    P17936
• Integrin alpha-5 / Homo sapiens    P08648
• Integrin alpha-6 / Homo sapiens    P23229
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interferon alpha/beta receptor 1 / Homo sapiens    P17181
• Interleukin-6 receptor subunit beta / Homo sapiens    P40189
• Kininogen-1 / Homo sapiens    P01042
• Lactadherin / Homo sapiens    Q08431
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit beta-1 / Homo sapiens    P07942
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leptin receptor / Homo sapiens    P48357
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens    Q6GTX8
• Lipoprotein lipase / Homo sapiens    P06858
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens    P07333
• Macrophage mannose receptor 1 / Homo sapiens    P22897
• Macrosialin / Homo sapiens    P34810
• Maltase-glucoamylase, intestinal / Homo sapiens    O43451
• Matrilin-4 / Homo sapiens    O95460
• Membrane primary amine oxidase / Homo sapiens    Q16853
• Metal transporter CNNM4 / Homo sapiens    Q6P4Q7
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Midasin / Homo sapiens    Q9NU22
• Mimecan / Homo sapiens    P20774
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Oncoprotein-induced transcript 3 protein / Homo sapiens    Q8WWZ8
• Pantetheinase / Homo sapiens    O95497
• Periostin / Homo sapiens    Q15063
• Phosphatidylcholine-sterol acyltransferase / Homo sapiens    P04180
• Phospholipid transfer protein / Homo sapiens    P55058
• Plasma kallikrein / Homo sapiens    P03952
• Platelet glycoprotein 4 / Homo sapiens    P16671
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Probable lysosomal cobalamin transporter / Homo sapiens    Q9NUN5
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prosaposin / Homo sapiens    P07602
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens    P28827
• Recombinant Mucin-1 Muc1f/4tr / Homo sapiens    Q99102    P15941
• Signal transducer CD24 / Homo sapiens    P25063
• Sortilin-related receptor / Homo sapiens    Q92673
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Tenascin / Homo sapiens    P24821
• Thrombopoietin / Homo sapiens    P40225
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Thrombospondin-3 / Homo sapiens    P49746
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Transcobalamin-1 / Homo sapiens    P20061
• Tubulin epsilon chain / Homo sapiens    Q9UJT0
• Tumor necrosis factor receptor superfamily member 11B / Homo sapiens    O00300
• Tyrosine-protein kinase receptor UFO / Homo sapiens    P30530
• Uromodulin / Homo sapiens    P07911
• Vitronectin / Homo sapiens    P04004
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens    P54289
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Acetylcholinesterase / Bos taurus    P23795
• Ribonuclease, brain / Bos taurus    P39873
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Fetal antigen 1 / Mus musculus    Q09163
• Zona pellucida sperm-binding protein matrix / Mus musculus    Q62005    P10761    P20239
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Neuroligin 1 / Rattus norvegicus    Q62765
• Thyroglobulin / Sus scrofa    
• Immunoglobulin gamma / Columba livia    
• Envelope glycoprotein / Friend murine leukemia virus    P03395
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amniotic Fluid (UBERON_0000173)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Kidney (UBERON_0002113)   BHK570 (CVCL_6370)   Fibroblast (CL_0000057)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)   C127 (CVCL_6550)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Thyroid (UBERON_0002046)  
• Umbilical Vein (UBERON_0002066)   HUVEC-C (CVCL_2959)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Zona Pellucida (UBERON_0000086)  
• Eveline (CVCL_A1LI)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Jurkat (CVCL_0065)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  
• Microsome (GO_0005792)  

Reported structure

• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 587
• N-Linked / Complex / Gal(a1-4)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc(a2-6)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Structure 2089
• N-Linked / Complex / Structure 2271
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-6)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ NeuAc(a2-?)"
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ Hex + HexNAc"
• N-Linked / Complex / Structure 9296
• N-Linked / Complex / Structure 9499
• N-Linked / Complex / Structure 9568
• N-Linked / Complex / Structure 9575
• N-Linked / Complex / Structure 9813
• N-Linked / Complex / Structure 9815
• N-Linked / Complex / Structure 9817
• N-Linked / Complex / Structure 10061
• N-Linked / Hybrid / Structure 225

Composition

• Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Healthy
• Hyperimmune condition
• IgE myeloma (DOID:9538)
• Myeloma, Multiple (DOID:9538)
• Prostate cancer (DOID:10283)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)

Reference

• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• N-glycan structures of pigeon IgG: a major serum glycoprotein containing Galalpha1-4 Gal termini.. (2003 - Suzuki N, Khoo KH, Chen CM, Chen HC, Lee YC) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
• Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995 - Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Structure determination by 1H NMR spectroscopy of (sulfated) sialylated N-linked carbohydrate chains released from porcine thyroglobulin by peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase-F. (1991 - de Waard P, Koorevaar A, Kamerling J, Vliegenthart J) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
• The structure of the asparagine-linked sugar chains of bovine brain ribonuclease. (1990 - Katoh H, Ohgi K, Irie M, Endo T, Kobata A) / Status : Reviewed
• Carbohydrate structures of a human tissue plasminogen activator variant expressed in recombinant Chinese hamster ovary cells. (1990 - Nimtz M, Noll G, Pques E, Conradt H) / Status : Reviewed
• Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-365
• Adhesion G protein-coupled receptor L4 / Homo sapiens
  •        Asn-249
• Adhesion G-protein coupled receptor D1 / Homo sapiens
  •        Asn-394
• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-528
• Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens
  •        Asn-430
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-33
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Asn-33
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-127
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-271
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-1424
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein d / Homo sapiens
  •        Asn-65
  •        Asn-98
• Apolipoprotein f / Homo sapiens
  •        Asn-118
• Asporin / Homo sapiens
  •        Asn-282
• Attractin / Homo sapiens
  •        Asn-383
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Biotinidase / Homo sapiens
  •        Asn-150
• Butyrophilin subfamily 1 member A1 / Homo sapiens
  •        Asn-55
  •        Asn-215
• C-type mannose receptor 2 / Homo sapiens
  •        Asn-492
• Cadherin-5 / Homo sapiens
  •        Undefined site
• Cadherin-related family member 2 / Homo sapiens
  •        Asn-300
• Carboxypeptidase D / Homo sapiens
  •        Asn-522
• Catalase / Homo sapiens
  •        Asn-481
• Cation-independent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-626
• CD109 antigen / Homo sapiens
  •        Asn-118
  •        Asn-419
• CD166 antigen / Homo sapiens
  •        Asn-265
  •        Asn-306
  •        Asn-361
  •        Asn-480
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• CD63 antigen / Homo sapiens
  •        Asn-130
• CD97 antigen / Homo sapiens
  •        Asn-453
• Ceruloplasmin / Homo sapiens
  •        Asn-138
  •        Asn-762
• Cholinesterase / Homo sapiens
  •        Asn-509
• Chordin-like protein 2 / Homo sapiens
  •        Asn-114
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
  •        Asn-291
  •        Asn-354
  •        Asn-374
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Coagulation factor x / Homo sapiens
  •        Asn-221
  •        Asn-231
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Collagen alpha-3(VI) chain / Homo sapiens
  •        Asn-2677
• Complement C1q subcomponent subunit A / Homo sapiens
  •        Asn-146
• Complement c1r subcomponent / Homo sapiens
  •        Asn-125
• Complement C2 / Homo sapiens
  •        Asn-333
• Complement c4-a / Homo sapiens
  •        Asn-1328
• Complement C4-B / Homo sapiens
  •        Asn-1328
• Complement factor h / Homo sapiens
  •        Asn-882
  •        Asn-911
• Contactin-4 / Homo sapiens
  •        Asn-858
  •        Asn-929
• Decorin / Homo sapiens
  •        Asn-262
  •        Asn-303
• Desmoglein-2 / Homo sapiens
  •        Asn-462
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-276
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
  •        Asn-539
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens
  •        Asn-178
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-294
• Ectopic P granules protein 5 homolog / Homo sapiens
  •        Asn-137
• Endothelial cell-selective adhesion molecule / Homo sapiens
  •        Asn-213
• Endothelin-converting enzyme 1 / Homo sapiens
  •        Asn-187
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-816
• Epithelial cell adhesion molecule / Homo sapiens
  •        Asn-74
• Erythropoietin / Homo sapiens
  •        Asn-51
  •        Asn-65
  •        Asn-110
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-354
• Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
  •        Asn-335
  •        Asn-470
• Fibroleukin / Homo sapiens
  •        Asn-179
  •        Asn-336
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-1291
• Fibulin-1 / Homo sapiens
  •        Asn-98
• G-protein coupled receptor 126 / Homo sapiens
  •        Asn-505
• Galectin-3-binding protein / Homo sapiens
  •        Asn-69
  •        Asn-398
  •        Asn-551
• Gamma-glutamyltranspeptidase 1 / Homo sapiens
  •        Asn-511
• Haptoglobin / Homo sapiens
  •        Asn-207
  •        Asn-211
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
• HLA class II histocompatibility antigen, DRB1-11 beta chain / Homo sapiens
  •        Asn-48
• HLA class II histocompatibility antigen, DRB1-13 beta chain / Homo sapiens
  •        Asn-48
• HLA class II histocompatibility antigen, DRB1-14 beta chain / Homo sapiens
  •        Asn-48
• HLA class II histocompatibility antigen, DRB1-3 chain / Homo sapiens
  •        Asn-48
• Homeobox protein Hox-B3 / Homo sapiens
  •        Asn-226
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-830
  •        Asn-862
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-21
  •        Asn-49
  •        Asn-99
  •        Asn-146
  •        Asn-252
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-205
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-209
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-116
  •        Asn-405
• Insulin receptor / Homo sapiens
  •        Asn-445
• Insulin-like growth factor-binding protein 3 / Homo sapiens
  •        Asn-116
• Integrin alpha-5 / Homo sapiens
  •        Asn-773
• Integrin alpha-6 / Homo sapiens
  •        Asn-770
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
  •        Asn-577
• Interferon alpha/beta receptor 1 / Homo sapiens
  •        Asn-254
• Interleukin-6 receptor subunit beta / Homo sapiens
  •        Asn-131
• Kininogen-1 / Homo sapiens
  •        Asn-205
  •        Asn-294
• Lactadherin / Homo sapiens
  •        Asn-325
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
  •        Asn-642
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-1810
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-531
  •        Asn-742
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-2568
• Laminin subunit beta-1 / Homo sapiens
  •        Asn-677
  •        Asn-1279
  •        Asn-1336
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1223
  •        Asn-1241
• Leptin receptor / Homo sapiens
  •        Asn-624
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
  •        Asn-69
• Lipoprotein lipase / Homo sapiens
  •        Asn-70
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
  •        Asn-160
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-249
  •        Asn-261
  •        Asn-322
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
  •        Asn-49
  •        Asn-58
  •        Asn-101
  •        Asn-257
  •        Asn-275
  •        Asn-356
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens
  •        Asn-153
• Macrophage mannose receptor 1 / Homo sapiens
  •        Asn-1205
• Macrosialin / Homo sapiens
  •        Asn-199
• Maltase-glucoamylase, intestinal / Homo sapiens
  •        Asn-135
• Matrilin-4 / Homo sapiens
  •        Asn-69
• Membrane primary amine oxidase / Homo sapiens
  •        Asn-592
  •        Asn-618
• Metal transporter CNNM4 / Homo sapiens
  •        Asn-127
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Midasin / Homo sapiens
  •        Asn-602
• Mimecan / Homo sapiens
  •        Asn-214
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
  •        Asn-248
• Oncoprotein-induced transcript 3 protein / Homo sapiens
  •        Asn-116
• Pantetheinase / Homo sapiens
  •        Asn-130
• Periostin / Homo sapiens
  •        Asn-599
• Phosphatidylcholine-sterol acyltransferase / Homo sapiens
  •        Asn-296
• Phospholipid transfer protein / Homo sapiens
  •        Asn-64
• Plasma kallikrein / Homo sapiens
  •        Asn-164
• Platelet glycoprotein 4 / Homo sapiens
  •        Asn-321
• Plexin-B2 / Homo sapiens
  •        Asn-1099
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-186
  •        Asn-421
  •        Asn-469
  •        Asn-499
• Probable lysosomal cobalamin transporter / Homo sapiens
  •        Asn-78
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-729
  •        Asn-1575
  •        Asn-1825
  •        Asn-2942
  •        Asn-3662
• Prosaposin / Homo sapiens
  •        Asn-215
  •        Asn-332
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-286
  •        Asn-300
  •        Asn-413
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Asn-234
  •        Asn-337
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-101
  •        Asn-462
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
  •        Asn-131
• Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
  •        Asn-1647
• Signal transducer CD24 / Homo sapiens
  •        Asn-52
• Sortilin-related receptor / Homo sapiens
  •        Asn-1068
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-313
• Tenascin / Homo sapiens
  •        Asn-38
  •        Asn-166
  •        Asn-184
  •        Asn-1392
  •        Asn-1485
  •        Asn-1809
• Thrombopoietin / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-248
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Thrombospondin-3 / Homo sapiens
  •        Asn-407
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Transcobalamin-1 / Homo sapiens
  •        Asn-369
• Tubulin epsilon chain / Homo sapiens
  •        Asn-401
• Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
  •        Asn-289
• Tyrosine-protein kinase receptor UFO / Homo sapiens
  •        Asn-345
• Uromodulin / Homo sapiens
  •        Asn-513
• Vitronectin / Homo sapiens
  •        Asn-86
  •        Asn-169
  •        Asn-242
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
  •        Asn-675
• Von willebrand factor / Homo sapiens
  •        Asn-2223
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Ribonuclease, brain / Bos taurus
  •        Asn-88
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Fetal antigen 1 / Mus musculus
  •        Asn-100
• Zona pellucida sperm-binding protein matrix / Mus musculus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Thyroglobulin / Sus scrofa
  •        Undefined site
• Immunoglobulin gamma / Columba livia
  •        Undefined site
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-334 and/or Asn-341
  •        Asn-341 and/or Asn-334
  •        Asn-266
  •        Asn-302
  •        Asn-374
  •        Asn-410
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-657
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-1098

Mass spectrometry observed peptide

• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• KRQSGVNATLPEENQPVVFNHVYNIKL (27aa)
  •    P24821    Asn-38     Tenascin / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• TAVNCSSDFDACIITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• FIEYSTSECHFFNGTER (17aa)
  •    Q5Y7A7    Asn-48     HLA class II histocompatibility antigen, DRB1-13 beta chain / Homo sapiens
  •    P01912    Asn-48     HLA class II histocompatibility antigen, DRB1-3 chain / Homo sapiens
  •    P20039    Asn-48     HLA class II histocompatibility antigen, DRB1-11 beta chain / Homo sapiens
  •    Q9GIY3    Asn-48     HLA class II histocompatibility antigen, DRB1-14 beta chain / Homo sapiens
• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• EAENITTGC (9aa)
  •    P01588    Asn-51     Erythropoietin / Homo sapiens
• APNPTNATTK (10aa)
  •    P25063    Asn-52     Signal transducer CD24 / Homo sapiens
• RLSPNASAEHLELRW (15aa)
  •    Q13410    Asn-55     Butyrophilin subfamily 1 member A1 / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• EGHFYYNISEVK (12aa)
  •    P55058    Asn-64     Phospholipid transfer protein / Homo sapiens
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein d / Homo sapiens
• STYNDTEDVSQASPSESEAR (20aa)
  •    Q6GTX8    Asn-69     Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
• GLNVGPNATR (10aa)
  •    O95460    Asn-69     Matrilin-4 / Homo sapiens
• AIGFENATQAIGR (13aa)
  •    Q08380    Asn-69     Galectin-3-binding protein / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT (32aa)
  •    P06858    Asn-70     Lipoprotein lipase / Homo sapiens
• AEMNGSK (7aa)
  •    P16422    Asn-74     Epithelial cell adhesion molecule / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• NQNGTFK (7aa)
  •    Q9NUN5    Asn-78     Probable lysosomal cobalamin transporter / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• KEDALNETR (9aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• NNATVHEQVGGPSLTSDLQAQSK (23aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• KKKEDALNETRE (12aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KKKEDALNETRESETKL (17aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRESETKL (15aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KKEDALNETRESETKL (16aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRE (10aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein d / Homo sapiens
• CATPHGDNASIEATFVK (17aa)
  •    P23142    Asn-98     Fibulin-1 / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein d / Homo sapiens
• IAVQFGPGFSWIANFTK (17aa)
  •    P13473    Asn-101     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• ENDTHCIDFSYLLYSQK (17aa)
  •    Q15262    Asn-101     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• RSHNRSEEFLIAGKL (15aa)
  •    P01033    Asn-101     Metalloproteinase inhibitor 1 / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• LPGVCNETMMALWEECKPCLK (21aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• GQALLVNSSQPWEPLQLHVDK (21aa)
  •    P01588    Asn-110     Erythropoietin / Homo sapiens
• KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
  •    Q6WN34    Asn-114     Chordin-like protein 2 / Homo sapiens
• QACASFNGNCCLWNTTVEVK (20aa)
  •    Q8WWZ8    Asn-116     Oncoprotein-induced transcript 3 protein / Homo sapiens
• SANASFNIK (9aa)
  •    Q13308    Asn-116     Inactive tyrosine-protein kinase 7 / Homo sapiens
• GLCVNASAVSR (11aa)
  •    P17936    Asn-116     Insulin-like growth factor-binding protein 3 / Homo sapiens
• QGGVNATQVLIQHLR (15aa)
  •    Q13790    Asn-118     Apolipoprotein f / Homo sapiens
• TQDEIIFSNSTR (12aa)
  •    Q6YHK3    Asn-118     CD109 antigen / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MLLTFHTDFSNEENGTIMFYK (21aa)
  •    P00736    Asn-125     Complement c1r subcomponent / Homo sapiens
• HINHNNLTESVGPLPK (16aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• GNTSGVIVVITK (12aa)
  •    Q6P4Q7    Asn-127     Metal transporter CNNM4 / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• KLHINHNNLTESVGPLPKS (19aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• RTLNQSSDELQLSMGNAMFVKE (22aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NNSIYVVANIGDK (13aa)
  •    O95497    Asn-130     Pantetheinase / Homo sapiens
• KNNHTASILDRM (12aa)
  •    P08962    Asn-130     CD63 antigen / Homo sapiens
• KNNHTASILDRMQADFKC (18aa)
  •    P08962    Asn-130     CD63 antigen / Homo sapiens
• NLSCIVNEGK (10aa)
  •    P40189    Asn-131     Interleukin-6 receptor subunit beta / Homo sapiens
• VNNGPLGNPIWNISGDPTR (19aa)
  •    P28827    Asn-131     Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
• NHSYHVEGNLVNTNAGFTAR (20aa)
  •    O43451    Asn-135     Maltase-glucoamylase, intestinal / Homo sapiens
• NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
  •    Q9HCE0    Asn-137     Ectopic P granules protein 5 homolog / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• VVIFDTVITNQEEPYQNHSGR (21aa)
  •    P02745    Asn-146     Complement C1q subcomponent subunit A / Homo sapiens
• RNPPMGGNVVIFDTVITNQEEPYQNHSGR (29aa)
  •    P02745    Asn-146     Complement C1q subcomponent subunit A / Homo sapiens
• FNDTEVLQR (9aa)
  •    P43251    Asn-150     Biotinidase / Homo sapiens
• HTNYSFSPWHGFTIHR (16aa)
  •    P07333    Asn-153     Macrophage colony-stimulating factor 1 receptor / Homo sapiens
• RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• IGSFEGIVNITFIHIQHNR (19aa)
  •    P51884    Asn-160     Lumican / Homo sapiens
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• NNCLLK (6aa)
  •    P03952    Asn-164     Plasma kallikrein / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• GNFSTEGCGCVCEPGWK (17aa)
  •    P24821    Asn-166     Tenascin / Homo sapiens
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• DSIMENGTLCYEVHYR (16aa)
  •    Q93070    Asn-178     Ecto-ADP-ribosyltransferase 4 / Homo sapiens
• VANITFVVNSIDGK (14aa)
  •    Q14314    Asn-179     Fibroleukin / Homo sapiens
• KGPNCSEPECPGNCHLRG (18aa)
  •    P24821    Asn-184     Tenascin / Homo sapiens
• KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• ACMNETR (7aa)
  •    P42892    Asn-187     Endothelin-converting enzyme 1 / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• VMYTTQGGGEAWGISVLNPNK (21aa)
  •    P34810    Asn-199     Macrosialin / Homo sapiens
• AWGISVLNPNK (11aa)
  •    P34810    Asn-199     Macrosialin / Homo sapiens
• ITYSIVQTNCSK (12aa)
  •    P01042    Asn-205     Kininogen-1 / Homo sapiens
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
• GLTFQQNASSMCGPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
  •    VAR_003904   215:V→G   dbSNP:rs12365
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GSLSLTNLSSSMAGVYVCK (19aa)
  •    Q96AP7    Asn-213     Endothelial cell-selective adhesion molecule / Homo sapiens
• KLNNLTFLYLDHNALESVPLNLPESLR (27aa)
  •    P20774    Asn-214     Mimecan / Homo sapiens
• LNNLTFLYLDHNALESVPLNLPESLR (26aa)
  •    P20774    Asn-214     Mimecan / Homo sapiens
• TNSTFVQALVEHVK (14aa)
  •    P07602    Asn-215     Prosaposin / Homo sapiens
• KNVSCYIQNLLLGQEKK (17aa)
  •    Q13410    Asn-215     Butyrophilin subfamily 1 member A1 / Homo sapiens
• VEMANLLNLSER (12aa)
  •    P14651    Asn-226     Homeobox protein Hox-B3 / Homo sapiens
• YANITVDYLYNK (12aa)
  •    P08575    Asn-234     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• YANITVDYLYNKETK (15aa)
  •    P08575    Asn-234     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• KVVLHPNYSQVDIGLIKL (18aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
  •    P07996    Asn-248     Thrombospondin-1 / Homo sapiens
• LTLDNNVVNGSSPAIR (16aa)
  •    P07996    Asn-248     Thrombospondin-1 / Homo sapiens
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• TTEFDTNSTDIALK (14aa)
  •    Q9HBW9    Asn-249     Adhesion G protein-coupled receptor L4 / Homo sapiens
• WDYTYANMTFQVQWLHAFLK (20aa)
  •    P17181    Asn-254     Interferon alpha/beta receptor 1 / Homo sapiens
• VASVININPNTTHSTGSCR (19aa)
  •    P13473    Asn-257     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• LGLSFNSISAVDNGSLANTPH (21aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• GLSFNSISAVDNGSLANTPHLR (22aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• NAIKEGDNITIK (12aa)
  •    Q13740    Asn-265     CD166 antigen / Homo sapiens
• EGDNITIK (8aa)
  •    Q13740    Asn-265     CD166 antigen / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• KYTGNASALFILPDQDKM (18aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NVSVAEGK (8aa)
  •    Q9P2B2    Asn-286     Prostaglandin F2 receptor negative regulator / Homo sapiens
• RHIGHANLTFEQLRS (15aa)
  •    O00300    Asn-289     Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
• REIRHNSTGCLRM (13aa)
  •    P10909    Asn-291     Clusterin / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
  •    Q9Y5L3    Asn-294     Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
• MAWPEDHVFISTPSFNYTGR (20aa)
  •    P04180    Asn-296     Phosphatidylcholine-sterol acyltransferase / Homo sapiens
• ELDLTCNITTDR (12aa)
  •    Q9P2B2    Asn-300     Prostaglandin F2 receptor negative regulator / Homo sapiens
• VNGSLDR (7aa)
  •    Q9BYE9    Asn-300     Cadherin-related family member 2 / Homo sapiens
• YIQVVYLHNNNISVVGSSDFCPPGHNTK (28aa)
  •    P07585    Asn-303     Decorin / Homo sapiens
• NATGDYK (7aa)
  •    Q13740    Asn-306     CD166 antigen / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LQVVYLHSNNITK (13aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LHSNNITK (8aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• NETLALPAESK (11aa)
  •    Q7Z7G0    Asn-313     Target of Nesh-SH3 / Homo sapiens
• KNCTSYGVLDISKC (14aa)
  •    P16671    Asn-321     Platelet glycoprotein 4 / Homo sapiens
• AANGSLR (7aa)
  •    P11279    Asn-322     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• MFSQNDTR (8aa)
  •    P02750    Asn-325     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• KVAYSNDSANWTEYQDPRT (19aa)
  •    Q08431    Asn-325     Lactadherin / Homo sapiens
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330     Thrombospondin-2 / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IIDNNKTEK (9aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• DHENGTGTNTYAALNSVYLMMNNQMR (26aa)
  •    P06681    Asn-333     Complement C2 / Homo sapiens
• MVNMTK (6aa)
  •    Q8IXL6    Asn-335     Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
• IHVGNYNGTAGDAIR (15aa)
  •    Q14314    Asn-336     Fibroleukin / Homo sapiens
• NIETFTCDTQNITYR (15aa)
  •    P08575    Asn-337     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGSQAFVHWQEPR (13aa)
  •    P30530    Asn-345     Tyrosine-protein kinase receptor UFO / Homo sapiens
• QGNNHTCTWK (10aa)
  •    Q16610    Asn-354     Extracellular matrix protein 1 / Homo sapiens
• KMLNTSSLLEQLNEQFNWVSRL (22aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• NATVVWMK (8aa)
  •    Q13740    Asn-361     CD166 antigen / Homo sapiens
• DASSFIAEWQNITK (14aa)
  •    P08195    Asn-365     4F2 cell-surface antigen heavy chain / Homo sapiens
• KMNDTIFGFTMEERS (15aa)
  •    P20061    Asn-369     Transcobalamin-1 / Homo sapiens
• RLANLTQGEDQYYLRV (16aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• EWIPINR (7aa)
  •    O75882    Asn-383     Attractin / Homo sapiens
• TVNSSHYR (8aa)
  •    Q6QNK2    Asn-394     Adhesion G-protein coupled receptor D1 / Homo sapiens
• GLNLTEDTYKPR (12aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• NNTCVK (6aa)
  •    Q92673    Asn-1068     Sortilin-related receptor / Homo sapiens
  •    Q9UJT0    Asn-401     Tubulin epsilon chain / Homo sapiens
• RQDVNITVATVPSWIK (16aa)
  •    Q13308    Asn-405     Inactive tyrosine-protein kinase 7 / Homo sapiens
• IGFIGNQSQGCIPAR (15aa)
  •    P49746    Asn-407     Thrombospondin-3 / Homo sapiens
• VAEAVSSPAGVGVTWIEPDYQVYINASK (28aa)
  •    Q9P2B2    Asn-413     Prostaglandin F2 receptor negative regulator / Homo sapiens
• INYTVPQSGTFK (12aa)
  •    Q6YHK3    Asn-419     CD109 antigen / Homo sapiens
• RLSLLEEPGNGTFTVILNQLTSRD (24aa)
  •    P01833    Asn-421     Polymeric immunoglobulin receptor / Homo sapiens
• ENVSMVDYAHNNYQAQSAVPLR (22aa)
  •    P05186    Asn-430     Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens
• GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• HNLTITQGK (9aa)
  •    P06213    Asn-445     Insulin receptor / Homo sapiens
• ISAVNSIFISHNNTK (15aa)
  •    P48960    Asn-453     CD97 antigen / Homo sapiens
• YVQNGTYTVK (10aa)
  •    Q14126    Asn-462     Desmoglein-2 / Homo sapiens
• APQHVVNHLPPYTNVSLK (18aa)
  •    Q15262    Asn-462     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• KVPGNVTAVLGETLKV (16aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• FGNETFIIHLDNGR (14aa)
  •    Q8IXL6    Asn-470     Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480     CD166 antigen / Homo sapiens
• NFTEVHPDYGSHIQALLDK (19aa)
  •    P04040    Asn-481     Catalase / Homo sapiens
• WNDSPCNQSLPSICK (15aa)
  •    Q9UBG0    Asn-492     C-type mannose receptor 2 / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• NNESLDEGLR (10aa)
  •    Q86SQ4    Asn-505     G-protein coupled receptor 126 / Homo sapiens
• YGNPNETQNNSTSWPVFK (18aa)
  •    P06276    Asn-509     Cholinesterase / Homo sapiens
• LHNQLLPNVTTVER (14aa)
  •    P19440    Asn-511     Gamma-glutamyltranspeptidase 1 / Homo sapiens
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens
• FANEYPNITR (10aa)
  •    O75976    Asn-522     Carboxypeptidase D / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• IYPITWNGSICMR (13aa)
  •    Q8IUX7    Asn-528     Adipocyte enhancer-binding protein 1 / Homo sapiens
• EQMEVVNMSLSTSADSLTTPR (21aa)
  •    Q16363    Asn-531     Laminin subunit alpha-4 / Homo sapiens
• CQEAINATCK (10aa)
  •    P78536    Asn-539     Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• KAAIPSALDTNSSKS (15aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• YIYIASNHSNK (11aa)
  •    Q16853    Asn-592     Membrane primary amine oxidase / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• MAEVIGSKLNISR (13aa)
  •    Q9NU22    Asn-602     Midasin / Homo sapiens
• IQMISFAGEPIPQNSSMAR (19aa)
  •    Q16853    Asn-618     Membrane primary amine oxidase / Homo sapiens
• LDGLGYWSNWSNPAYTVVMDIK (22aa)
  •    P48357    Asn-624     Leptin receptor / Homo sapiens
• TEGENCTVFDSQAGFSFDLSPLTK (24aa)
  •    P11717    Asn-626     Cation-independent mannose-6-phosphate receptor / Homo sapiens
• KFGRNGSDCPDKF (13aa)
  •    P02788    Asn-642     Lactotransferrin / Homo sapiens
• RNGSDCPDKF (10aa)
  •    P02788    Asn-642     Lactotransferrin / Homo sapiens
• NNSYECDIPI (10aa)
  •    P0DTC2    Asn-657     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ISDNNTEFLLNFNEFIDR (18aa)
  •    P54289    Asn-675     Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
• GTNYTVR (7aa)
  •    P07942    Asn-677     Laminin subunit beta-1 / Homo sapiens
• IETILLNGTDR (11aa)
  •    Q07954    Asn-729     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• LITEEANR (8aa)
  •    Q16363    Asn-742     Laminin subunit alpha-4 / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• KELHHLQEQNVSNAFLDKG (19aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• QISCVANQNGSQADCEIGNPFKR (23aa)
  •    P23229    Asn-770     Integrin alpha-6 / Homo sapiens
• NLNNSQSDVVSFR (13aa)
  •    P08648    Asn-773     Integrin alpha-5 / Homo sapiens
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• DNIGSQYLLNWCVQIAK (17aa)
  •    P00533    Asn-816     Epidermal growth factor receptor / Homo sapiens
• LSALDNLLNHSSMFLK (16aa)
  •    Q9Y4L1    Asn-830     Hypoxia up-regulated protein 1 / Homo sapiens
• TVGNQTSTK (9aa)
  •    Q8IWV2    Asn-858     Contactin-4 / Homo sapiens
• VINETWAWK (9aa)
  •    Q9Y4L1    Asn-862     Hypoxia up-regulated protein 1 / Homo sapiens
• IPCSQPPQIEHGTINSSR (18aa)
  •    P08603    Asn-882     Complement factor h / Homo sapiens
• ISEENETTCYMGK (13aa)
  •    P08603    Asn-911     Complement factor h / Homo sapiens
• ALDNESEVK (9aa)
  •    Q8IWV2    Asn-929     Contactin-4 / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TEAGAFEYVPDPTFENFTGGVK (22aa)
  •    O15031    Asn-1099     Plexin-B2 / Homo sapiens
• KTAHCNESFYFLCKR (15aa)
  •    P22897    Asn-1205     Macrophage mannose receptor 1 / Homo sapiens
• TIAGENQTAFEIEEINR (17aa)
  •    P11047    Asn-1223     Laminin subunit gamma-1 / Homo sapiens
• NISQDLEK (8aa)
  •    P11047    Asn-1241     Laminin subunit gamma-1 / Homo sapiens
• LSDTTSQSNSTAK (13aa)
  •    P07942    Asn-1279     Laminin subunit beta-1 / Homo sapiens
• WTPINSSTIIGYR (13aa)
  •    P02751    Asn-1291     Fibronectin / Homo sapiens
• RGLNVTLSSTGRN (13aa)
  •    P0C0L4    Asn-1328     Complement c4-a / Homo sapiens
  •    P0C0L5    Asn-1328     Complement C4-B / Homo sapiens
• VNASTTEPNSTVEQSALMR (19aa)
  •    P07942    Asn-1336     Laminin subunit beta-1 / Homo sapiens
• VEAAQNLTLPGSLR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• VEAAQNITIPGSIR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• KVEAAQNLTLPGSLRA (16aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• VSNQTLSLFFTVLQDVPVR (19aa)
  •    P01023    Asn-1424     Alpha-2-macroglobulin / Homo sapiens
• RLLETVEYNISGAERT (16aa)
  •    P24821    Asn-1485     Tenascin / Homo sapiens
• IIETVEYNISGAER (14aa)
  •    P24821    Asn-1485     Tenascin / Homo sapiens
• DNTTCYEFK (9aa)
  •    Q07954    Asn-1575     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• KRNDQLPSNFTPVFYSQLQKN (21aa)
  •    Q99102    Asn-1647     Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
  •    P15941    Asn-1647     Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
• GFEESEPVSGSFTTAIDGPSGIVTANITDSEAIAR (35aa)
  •    P24821    Asn-1809     Tenascin / Homo sapiens
• NMTALEK (7aa)
  •    P24043    Asn-1810     Laminin subunit alpha-2 / Homo sapiens
• NSTTLVMHMK (10aa)
  •    Q07954    Asn-1825     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• HCDGNVSSCGDHPSEGCFCPPDK (23aa)
  •    P04275    Asn-2223     Von willebrand factor / Homo sapiens
• AQQIIANSTAIEEAMIQEQQR (21aa)
  •    O15230    Asn-2568     Laminin subunit alpha-5 / Homo sapiens
• VAVVQHAPSESVDNASMPPVK (21aa)
  •    P12111    Asn-2677     Collagen alpha-3(VI) chain / Homo sapiens
• GCHINECLSR (10aa)
  •    Q07954    Asn-2942     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• TCPIDEFQCNNTICKPIAWK (20aa)
  •    Q07954    Asn-3662     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens