Hex:6 HexNAc:5 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Columba livia (Domestic pigeon)
• Friend murine leukemia virus (F-mulv)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• Adhesion G protein-coupled receptor L4 / Homo sapiens    Q9HBW9
• Adhesion G-protein coupled receptor D1 / Homo sapiens    Q6QNK2
• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens    P05186
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Alpha-S1-casein / Homo sapiens    P47710
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein D / Homo sapiens    P05090
• Apolipoprotein F / Homo sapiens    Q13790
• Asporin / Homo sapiens    Q9BXN1
• Attractin / Homo sapiens    O75882
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Biglycan / Homo sapiens    P21810
• Biotinidase / Homo sapiens    P43251
• Butyrophilin subfamily 1 member A1 / Homo sapiens    Q13410
• C-type mannose receptor 2 / Homo sapiens    Q9UBG0
• Cadherin-5 / Homo sapiens    P33151
• Cadherin-related family member 2 / Homo sapiens    Q9BYE9
• Carboxypeptidase D / Homo sapiens    O75976
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Catalase / Homo sapiens    P04040
• Cation-independent mannose-6-phosphate receptor / Homo sapiens    P11717
• CD109 antigen / Homo sapiens    Q6YHK3
• CD166 antigen / Homo sapiens    Q13740
• CD59 glycoprotein / Homo sapiens    P13987
• CD63 antigen / Homo sapiens    P08962
• CD97 antigen / Homo sapiens    P48960
• Ceruloplasmin / Homo sapiens    P00450
• Cholinesterase / Homo sapiens    P06276
• Chordin-like protein 2 / Homo sapiens    Q6WN34
• Clusterin / Homo sapiens    P10909
• Coagulation factor VIII / Homo sapiens    P00451
• Coagulation factor x / Homo sapiens    P00742
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Complement C1q subcomponent subunit A / Homo sapiens    P02745
• Complement c1r subcomponent / Homo sapiens    P00736
• Complement C2 / Homo sapiens    P06681
• Complement c4-a / Homo sapiens    P0C0L4
• Complement C4-B / Homo sapiens    P0C0L5
• Complement factor h / Homo sapiens    P08603
• Contactin-4 / Homo sapiens    Q8IWV2
• Decorin / Homo sapiens    P07585
• Desmoglein-2 / Homo sapiens    Q14126
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens    P78536
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens    Q93070
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Ectopic P granules protein 5 homolog / Homo sapiens    Q9HCE0
• Endothelial cell-selective adhesion molecule / Homo sapiens    Q96AP7
• Endothelin-converting enzyme 1 / Homo sapiens    P42892
• Epidermal growth factor receptor / Homo sapiens    P00533
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Extracellular serine/threonine protein kinase FAM20C / Homo sapiens    Q8IXL6
• Fibroleukin / Homo sapiens    Q14314
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Fibulin-1 / Homo sapiens    P23142
• G-protein coupled receptor 126 / Homo sapiens    Q86SQ4
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-glutamyltranspeptidase 1 / Homo sapiens    P19440
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• HLA class II histocompatibility antigen, DRB1-11 beta chain / Homo sapiens    P20039
• HLA class II histocompatibility antigen, DRB1-13 beta chain / Homo sapiens    Q5Y7A7
• HLA class II histocompatibility antigen, DRB1-14 beta chain / Homo sapiens    Q9GIY3
• HLA class II histocompatibility antigen, DRB1-3 chain / Homo sapiens    P01912
• Homeobox protein Hox-B3 / Homo sapiens    P14651
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Insulin receptor / Homo sapiens    P06213
• Insulin-like growth factor-binding protein 3 / Homo sapiens    P17936
• Integrin alpha-5 / Homo sapiens    P08648
• Integrin alpha-6 / Homo sapiens    P23229
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interferon alpha/beta receptor 1 / Homo sapiens    P17181
• Interleukin-6 receptor subunit beta / Homo sapiens    P40189
• Kininogen-1 / Homo sapiens    P01042
• Lactadherin / Homo sapiens    Q08431
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit beta-1 / Homo sapiens    P07942
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leptin receptor / Homo sapiens    P48357
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens    Q6GTX8
• Lipoprotein lipase / Homo sapiens    P06858
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens    P07333
• Macrophage mannose receptor 1 / Homo sapiens    P22897
• Macrosialin / Homo sapiens    P34810
• Maltase-glucoamylase, intestinal / Homo sapiens    O43451
• Matrilin-4 / Homo sapiens    O95460
• Membrane primary amine oxidase / Homo sapiens    Q16853
• Metal transporter CNNM4 / Homo sapiens    Q6P4Q7
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Midasin / Homo sapiens    Q9NU22
• Mimecan / Homo sapiens    P20774
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Oncoprotein-induced transcript 3 protein / Homo sapiens    Q8WWZ8
• Pantetheinase / Homo sapiens    O95497
• Periostin / Homo sapiens    Q15063
• Phosphatidylcholine-sterol acyltransferase / Homo sapiens    P04180
• Phospholipid transfer protein / Homo sapiens    P55058
• Plasma kallikrein / Homo sapiens    P03952
• Platelet glycoprotein 4 / Homo sapiens    P16671
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Probable lysosomal cobalamin transporter / Homo sapiens    Q9NUN5
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prosaposin / Homo sapiens    P07602
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens    P28827
• Recombinant Mucin-1 Muc1f/4tr / Homo sapiens    P15941    Q99102
• Signal transducer CD24 / Homo sapiens    P25063
• Sortilin-related receptor / Homo sapiens    Q92673
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Tenascin / Homo sapiens    P24821
• Thrombopoietin / Homo sapiens    P40225
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Thrombospondin-3 / Homo sapiens    P49746
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Transcobalamin-1 / Homo sapiens    P20061
• Tubulin epsilon chain / Homo sapiens    Q9UJT0
• Tumor necrosis factor receptor superfamily member 11B / Homo sapiens    O00300
• Tyrosine-protein kinase receptor UFO / Homo sapiens    P30530
• Uromodulin / Homo sapiens    P07911
• Vitronectin / Homo sapiens    P04004
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens    P54289
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Acetylcholinesterase / Bos taurus    P23795
• Ribonuclease, brain / Bos taurus    P39873
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Fetal antigen 1 / Mus musculus    Q09163
• Zona pellucida sperm-binding protein matrix / Mus musculus    P10761    P20239    Q62005
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Neuroligin 1 / Rattus norvegicus    Q62765
• Thyroglobulin / Sus scrofa    
• Immunoglobulin gamma / Columba livia    
• Envelope glycoprotein / Friend murine leukemia virus    P03395
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amniotic Fluid (UBERON_0000173)  
• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Kidney (UBERON_0002113)   BHK570 (CVCL_6370)   Fibroblast (CL_0000057)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)   C127 (CVCL_6550)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Seminal Fluid (UBERON_0006530)  
• Thyroid (UBERON_0002046)  
• Umbilical Vein (UBERON_0002066)   HUVEC-C (CVCL_2959)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Zona Pellucida (UBERON_0000086)  
• CHO (CVCL_0213)  
• Eveline (CVCL_A1LI)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293T (CVCL_0063)  
• Jurkat (CVCL_0065)  
• LS174T (CVCL_1384)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  
• EBV-transformed B-cell (CL_0000236)  
• Neutrophil (CL_0000775)  
• Microsome (GO_0005792)  

Reported structure

• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 587
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(a1-4)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc(a2-6)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-6)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ NeuAc(a2-?)"
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ Hex + HexNAc"
• N-Linked / Complex / Structure 2089
• N-Linked / Complex / Structure 2271
• N-Linked / Complex / Structure 9296
• N-Linked / Complex / Structure 9499
• N-Linked / Complex / Structure 9568
• N-Linked / Complex / Structure 9575
• N-Linked / Complex / Structure 9813
• N-Linked / Complex / Structure 9815
• N-Linked / Complex / Structure 9817
• N-Linked / Complex / Structure 10061
• N-Linked / Complex / Structure 10151
• N-Linked / Complex / Structure 10155
• N-Linked / Complex / Structure 10251
• N-Linked / Complex / Structure 10296
• N-Linked / Complex / Structure 10465
• N-Linked / Complex / Structure 10530
• N-Linked / Complex / Structure 10547
• N-Linked / Complex / Structure 10630
• N-Linked / Complex / Structure 10671
• N-Linked / Complex / Structure 10674
• N-Linked / Complex / Structure 10756
• N-Linked / Complex / Structure 10941
• N-Linked / Complex / Structure 10966

Composition

• Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )

Disease

• Atopic dermatitis (DOID:3310)
• Cancer, breast (DOID:1612)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Gastritis (DOID:4029)
• Hyper IgE syndrome (DOID:0080545)
• Hyper IgE syndrome (HIES, p.Glu340del) (DOID:0080545)
• Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
• Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
• Hyper IgE syndrome (PGM3 mutation, p.Leu83Ser) (DOID:0080545)
• Hyperimmune condition
• IgE myeloma (DOID:9538)
• Mixed phenotype acute leukemia (DOID:9953)
• Myeloma, Multiple (DOID:9538)
• Prostate cancer (DOID:10283)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)

Reference

• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• B-cell precursor acute lymphoblastic leukemia with MLL rearrangement shows extensive glycomic-related changes (2021 - Oliveira T) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• N-glycan structures of pigeon IgG: a major serum glycoprotein containing Galalpha1-4 Gal termini.. (2003 - Suzuki N, Khoo KH, Chen CM, Chen HC, Lee YC) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
• Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995 - Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Structure determination by 1H NMR spectroscopy of (sulfated) sialylated N-linked carbohydrate chains released from porcine thyroglobulin by peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase-F. (1991 - de Waard P, Koorevaar A, Kamerling J, Vliegenthart J) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
• The structure of the asparagine-linked sugar chains of bovine brain ribonuclease. (1990 - Katoh H, Ohgi K, Irie M, Endo T, Kobata A) / Status : Reviewed
• Carbohydrate structures of a human tissue plasminogen activator variant expressed in recombinant Chinese hamster ovary cells. (1990 - Nimtz M, Noll G, Pques E, Conradt H) / Status : Reviewed
• Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-365
• Adhesion G protein-coupled receptor L4 / Homo sapiens
  •        Asn-249
• Adhesion G-protein coupled receptor D1 / Homo sapiens
  •        Asn-394
• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-528
• Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens
  •        Asn-430
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-33
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Asn-33
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-127
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-271
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-1424
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Apolipoprotein F / Homo sapiens
  •        Asn-118
• Asporin / Homo sapiens
  •        Asn-282
• Attractin / Homo sapiens
  •        Asn-383
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Biotinidase / Homo sapiens
  •        Asn-150
• Butyrophilin subfamily 1 member A1 / Homo sapiens
  •        Asn-55
  •        Asn-215
• C-type mannose receptor 2 / Homo sapiens
  •        Asn-492
• Cadherin-5 / Homo sapiens
  •        Undefined site
• Cadherin-related family member 2 / Homo sapiens
  •        Asn-300
• Carboxypeptidase D / Homo sapiens
  •        Asn-522
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Catalase / Homo sapiens
  •        Asn-481
• Cation-independent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-626
• CD109 antigen / Homo sapiens
  •        Asn-118
  •        Asn-419
• CD166 antigen / Homo sapiens
  •        Asn-265
  •        Asn-306
  •        Asn-361
  •        Asn-480
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• CD63 antigen / Homo sapiens
  •        Asn-130
• CD97 antigen / Homo sapiens
  •        Asn-453
• Ceruloplasmin / Homo sapiens
  •        Asn-138
  •        Asn-762
• Cholinesterase / Homo sapiens
  •        Asn-509
• Chordin-like protein 2 / Homo sapiens
  •        Asn-114
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
  •        Asn-291
  •        Asn-354
  •        Asn-374
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Coagulation factor x / Homo sapiens
  •        Asn-221
  •        Asn-231
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Collagen alpha-3(VI) chain / Homo sapiens
  •        Asn-2677
• Complement C1q subcomponent subunit A / Homo sapiens
  •        Asn-146
• Complement c1r subcomponent / Homo sapiens
  •        Asn-125
• Complement C2 / Homo sapiens
  •        Asn-333
• Complement c4-a / Homo sapiens
  •        Asn-1328
• Complement C4-B / Homo sapiens
  •        Asn-1328
• Complement factor h / Homo sapiens
  •        Asn-882
  •        Asn-911
• Contactin-4 / Homo sapiens
  •        Asn-858
  •        Asn-929
• Decorin / Homo sapiens
  •        Asn-262
  •        Asn-303
• Desmoglein-2 / Homo sapiens
  •        Asn-462
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-276
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
  •        Asn-539
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens
  •        Asn-178
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-294
• Ectopic P granules protein 5 homolog / Homo sapiens
  •        Asn-137
• Endothelial cell-selective adhesion molecule / Homo sapiens
  •        Asn-213
• Endothelin-converting enzyme 1 / Homo sapiens
  •        Asn-187
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-816
• Epithelial cell adhesion molecule / Homo sapiens
  •        Asn-74
• Erythropoietin / Homo sapiens
  •        Asn-51
  •        Asn-65
  •        Asn-110
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-354
• Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
  •        Asn-335
  •        Asn-470
• Fibroleukin / Homo sapiens
  •        Asn-179
  •        Asn-336
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-1291
• Fibulin-1 / Homo sapiens
  •        Asn-98
• G-protein coupled receptor 126 / Homo sapiens
  •        Asn-505
• Galectin-3-binding protein / Homo sapiens
  •        Asn-69
  •        Asn-398
  •        Asn-551
• Gamma-glutamyltranspeptidase 1 / Homo sapiens
  •        Asn-511
• Haptoglobin / Homo sapiens
  •        Asn-207
  •        Asn-211
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
• HLA class II histocompatibility antigen, DRB1-11 beta chain / Homo sapiens
  •        Asn-48
• HLA class II histocompatibility antigen, DRB1-13 beta chain / Homo sapiens
  •        Asn-48
• HLA class II histocompatibility antigen, DRB1-14 beta chain / Homo sapiens
  •        Asn-48
• HLA class II histocompatibility antigen, DRB1-3 chain / Homo sapiens
  •        Asn-48
• Homeobox protein Hox-B3 / Homo sapiens
  •        Asn-226
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-830
  •        Asn-862
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Undefined site
  •        Asn-21
  •        Asn-49
  •        Asn-99
  •        Asn-146
  •        Asn-252
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-205
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-209
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-116
  •        Asn-405
• Insulin receptor / Homo sapiens
  •        Asn-445
• Insulin-like growth factor-binding protein 3 / Homo sapiens
  •        Asn-116
• Integrin alpha-5 / Homo sapiens
  •        Asn-773
• Integrin alpha-6 / Homo sapiens
  •        Asn-770
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
  •        Asn-577
• Interferon alpha/beta receptor 1 / Homo sapiens
  •        Asn-254
• Interleukin-6 receptor subunit beta / Homo sapiens
  •        Asn-131
• Kininogen-1 / Homo sapiens
  •        Asn-205
  •        Asn-294
• Lactadherin / Homo sapiens
  •        Asn-325
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
  •        Asn-642
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-1810
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-531
  •        Asn-742
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-2568
• Laminin subunit beta-1 / Homo sapiens
  •        Asn-677
  •        Asn-1279
  •        Asn-1336
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1223
  •        Asn-1241
• Leptin receptor / Homo sapiens
  •        Asn-624
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
  •        Asn-69
• Lipoprotein lipase / Homo sapiens
  •        Asn-70
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
  •        Asn-160
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-249
  •        Asn-261
  •        Asn-322
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
  •        Asn-49
  •        Asn-58
  •        Asn-101
  •        Asn-257
  •        Asn-275
  •        Asn-356
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens
  •        Asn-153
• Macrophage mannose receptor 1 / Homo sapiens
  •        Asn-1205
• Macrosialin / Homo sapiens
  •        Asn-199
• Maltase-glucoamylase, intestinal / Homo sapiens
  •        Asn-135
• Matrilin-4 / Homo sapiens
  •        Asn-69
• Membrane primary amine oxidase / Homo sapiens
  •        Asn-592
  •        Asn-618
• Metal transporter CNNM4 / Homo sapiens
  •        Asn-127
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Midasin / Homo sapiens
  •        Asn-602
• Mimecan / Homo sapiens
  •        Asn-214
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
  •        Asn-248
• Oncoprotein-induced transcript 3 protein / Homo sapiens
  •        Asn-116
• Pantetheinase / Homo sapiens
  •        Asn-130
• Periostin / Homo sapiens
  •        Asn-599
• Phosphatidylcholine-sterol acyltransferase / Homo sapiens
  •        Asn-296
• Phospholipid transfer protein / Homo sapiens
  •        Asn-64
• Plasma kallikrein / Homo sapiens
  •        Asn-164
• Platelet glycoprotein 4 / Homo sapiens
  •        Asn-321
• Plexin-B2 / Homo sapiens
  •        Asn-1099
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-186
  •        Asn-421
  •        Asn-469
  •        Asn-499
• Probable lysosomal cobalamin transporter / Homo sapiens
  •        Asn-78
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-729
  •        Asn-1575
  •        Asn-1825
  •        Asn-2942
  •        Asn-3662
• Prosaposin / Homo sapiens
  •        Asn-215
  •        Asn-332
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-286
  •        Asn-300
  •        Asn-413
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Asn-234
  •        Asn-337
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-101
  •        Asn-462
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
  •        Asn-131
• Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
  •        Asn-1647
• Signal transducer CD24 / Homo sapiens
  •        Asn-52
• Sortilin-related receptor / Homo sapiens
  •        Asn-1068
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-313
• Tenascin / Homo sapiens
  •        Asn-38
  •        Asn-166
  •        Asn-184
  •        Asn-1392
  •        Asn-1485
  •        Asn-1809
• Thrombopoietin / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-248
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Thrombospondin-3 / Homo sapiens
  •        Asn-407
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Transcobalamin-1 / Homo sapiens
  •        Asn-369
• Tubulin epsilon chain / Homo sapiens
  •        Asn-401
• Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
  •        Asn-289
• Tyrosine-protein kinase receptor UFO / Homo sapiens
  •        Asn-345
• Uromodulin / Homo sapiens
  •        Asn-513
• Vitronectin / Homo sapiens
  •        Asn-86
  •        Asn-169
  •        Asn-242
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
  •        Asn-675
• Von willebrand factor / Homo sapiens
  •        Asn-2223
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Ribonuclease, brain / Bos taurus
  •        Asn-88
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Fetal antigen 1 / Mus musculus
  •        Asn-100
• Zona pellucida sperm-binding protein matrix / Mus musculus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Thyroglobulin / Sus scrofa
  •        Undefined site
• Immunoglobulin gamma / Columba livia
  •        Undefined site
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-334 and/or Asn-341
  •        Asn-341 and/or Asn-334
  •        Asn-266
  •        Asn-302
  •        Asn-374
  •        Asn-410
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-657
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343

Mass spectrometry observed peptide

• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• KRQSGVNATLPEENQPVVFNHVYNIKL (27aa)
  •    P24821    Asn-38     Tenascin / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• TAVNCSSDFDACIITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• FIEYSTSECHFFNGTER (17aa)
  •    P01912    Asn-48     HLA class II histocompatibility antigen, DRB1-3 chain / Homo sapiens
  •    P20039    Asn-48     HLA class II histocompatibility antigen, DRB1-11 beta chain / Homo sapiens
  •    Q9GIY3    Asn-48     HLA class II histocompatibility antigen, DRB1-14 beta chain / Homo sapiens
  •    Q5Y7A7    Asn-48     HLA class II histocompatibility antigen, DRB1-13 beta chain / Homo sapiens
• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• EAENITTGC (9aa)
  •    P01588    Asn-51     Erythropoietin / Homo sapiens
• APNPTNATTK (10aa)
  •    P25063    Asn-52     Signal transducer CD24 / Homo sapiens
• RLSPNASAEHLELRW (15aa)
  •    Q13410    Asn-55     Butyrophilin subfamily 1 member A1 / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• EGHFYYNISEVK (12aa)
  •    P55058    Asn-64     Phospholipid transfer protein / Homo sapiens
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• STYNDTEDVSQASPSESEAR (20aa)
  •    Q6GTX8    Asn-69     Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
• GLNVGPNATR (10aa)
  •    O95460    Asn-69     Matrilin-4 / Homo sapiens
• AIGFENATQAIGR (13aa)
  •    Q08380    Asn-69     Galectin-3-binding protein / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT (32aa)
  •    P06858    Asn-70     Lipoprotein lipase / Homo sapiens
• AEMNGSK (7aa)
  •    P16422    Asn-74     Epithelial cell adhesion molecule / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• NQNGTFK (7aa)
  •    Q9NUN5    Asn-78     Probable lysosomal cobalamin transporter / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• KEDALNETR (9aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• NNATVHEQVGGPSLTSDLQAQSK (23aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• KKKEDALNETRE (12aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KKKEDALNETRESETKL (17aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRESETKL (15aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KKEDALNETRESETKL (16aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRE (10aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• CATPHGDNASIEATFVK (17aa)
  •    P23142    Asn-98     Fibulin-1 / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• IAVQFGPGFSWIANFTK (17aa)
  •    P13473    Asn-101     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• ENDTHCIDFSYLLYSQK (17aa)
  •    Q15262    Asn-101     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• RSHNRSEEFLIAGKL (15aa)
  •    P01033    Asn-101     Metalloproteinase inhibitor 1 / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• LPGVCNETMMALWEECKPCLK (21aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• GQALLVNSSQPWEPLQLHVDK (21aa)
  •    P01588    Asn-110     Erythropoietin / Homo sapiens
• KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
  •    Q6WN34    Asn-114     Chordin-like protein 2 / Homo sapiens
• QACASFNGNCCLWNTTVEVK (20aa)
  •    Q8WWZ8    Asn-116     Oncoprotein-induced transcript 3 protein / Homo sapiens
• SANASFNIK (9aa)
  •    Q13308    Asn-116     Inactive tyrosine-protein kinase 7 / Homo sapiens
• GLCVNASAVSR (11aa)
  •    P17936    Asn-116     Insulin-like growth factor-binding protein 3 / Homo sapiens
• QGGVNATQVLIQHLR (15aa)
  •    Q13790    Asn-118     Apolipoprotein F / Homo sapiens
• TQDEIIFSNSTR (12aa)
  •    Q6YHK3    Asn-118     CD109 antigen / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MLLTFHTDFSNEENGTIMFYK (21aa)
  •    P00736    Asn-125     Complement c1r subcomponent / Homo sapiens
• HINHNNLTESVGPLPK (16aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• GNTSGVIVVITK (12aa)
  •    Q6P4Q7    Asn-127     Metal transporter CNNM4 / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• KLHINHNNLTESVGPLPKS (19aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• RTLNQSSDELQLSMGNAMFVKE (22aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NNSIYVVANIGDK (13aa)
  •    O95497    Asn-130     Pantetheinase / Homo sapiens
• KNNHTASILDRM (12aa)
  •    P08962    Asn-130     CD63 antigen / Homo sapiens
• KNNHTASILDRMQADFKC (18aa)
  •    P08962    Asn-130     CD63 antigen / Homo sapiens
• NLSCIVNEGK (10aa)
  •    P40189    Asn-131     Interleukin-6 receptor subunit beta / Homo sapiens
• VNNGPLGNPIWNISGDPTR (19aa)
  •    P28827    Asn-131     Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
• NHSYHVEGNLVNTNAGFTAR (20aa)
  •    O43451    Asn-135     Maltase-glucoamylase, intestinal / Homo sapiens
• NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
  •    Q9HCE0    Asn-137     Ectopic P granules protein 5 homolog / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• VVIFDTVITNQEEPYQNHSGR (21aa)
  •    P02745    Asn-146     Complement C1q subcomponent subunit A / Homo sapiens
• RNPPMGGNVVIFDTVITNQEEPYQNHSGR (29aa)
  •    P02745    Asn-146     Complement C1q subcomponent subunit A / Homo sapiens
• FNDTEVLQR (9aa)
  •    P43251    Asn-150     Biotinidase / Homo sapiens
• HTNYSFSPWHGFTIHR (16aa)
  •    P07333    Asn-153     Macrophage colony-stimulating factor 1 receptor / Homo sapiens
• RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• IGSFEGIVNITFIHIQHNR (19aa)
  •    P51884    Asn-160     Lumican / Homo sapiens
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• NNCLLK (6aa)
  •    P03952    Asn-164     Plasma kallikrein / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• GNFSTEGCGCVCEPGWK (17aa)
  •    P24821    Asn-166     Tenascin / Homo sapiens
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• DSIMENGTLCYEVHYR (16aa)
  •    Q93070    Asn-178     Ecto-ADP-ribosyltransferase 4 / Homo sapiens
• VANITFVVNSIDGK (14aa)
  •    Q14314    Asn-179     Fibroleukin / Homo sapiens
• KGPNCSEPECPGNCHLRG (18aa)
  •    P24821    Asn-184     Tenascin / Homo sapiens
• KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• ACMNETR (7aa)
  •    P42892    Asn-187     Endothelin-converting enzyme 1 / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• VMYTTQGGGEAWGISVLNPNK (21aa)
  •    P34810    Asn-199     Macrosialin / Homo sapiens
• AWGISVLNPNK (11aa)
  •    P34810    Asn-199     Macrosialin / Homo sapiens
• ITYSIVQTNCSK (12aa)
  •    P01042    Asn-205     Kininogen-1 / Homo sapiens
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• GLTFQQNASSMCGPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
  •    VAR_003904   215:V→G   dbSNP:rs12365
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
• GSLSLTNLSSSMAGVYVCK (19aa)
  •    Q96AP7    Asn-213     Endothelial cell-selective adhesion molecule / Homo sapiens
• KLNNLTFLYLDHNALESVPLNLPESLR (27aa)
  •    P20774    Asn-214     Mimecan / Homo sapiens
• LNNLTFLYLDHNALESVPLNLPESLR (26aa)
  •    P20774    Asn-214     Mimecan / Homo sapiens
• TNSTFVQALVEHVK (14aa)
  •    P07602    Asn-215     Prosaposin / Homo sapiens
• KNVSCYIQNLLLGQEKK (17aa)
  •    Q13410    Asn-215     Butyrophilin subfamily 1 member A1 / Homo sapiens
• VEMANLLNLSER (12aa)
  •    P14651    Asn-226     Homeobox protein Hox-B3 / Homo sapiens
• YANITVDYLYNK (12aa)
  •    P08575    Asn-234     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• YANITVDYLYNKETK (15aa)
  •    P08575    Asn-234     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• KVVLHPNYSQVDIGLIKL (18aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
  •    P07996    Asn-248     Thrombospondin-1 / Homo sapiens
• LTLDNNVVNGSSPAIR (16aa)
  •    P07996    Asn-248     Thrombospondin-1 / Homo sapiens
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• TTEFDTNSTDIALK (14aa)
  •    Q9HBW9    Asn-249     Adhesion G protein-coupled receptor L4 / Homo sapiens
• WDYTYANMTFQVQWLHAFLK (20aa)
  •    P17181    Asn-254     Interferon alpha/beta receptor 1 / Homo sapiens
• VASVININPNTTHSTGSCR (19aa)
  •    P13473    Asn-257     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• LGLSFNSISAVDNGSLANTPH (21aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• GLSFNSISAVDNGSLANTPHLR (22aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• NAIKEGDNITIK (12aa)
  •    Q13740    Asn-265     CD166 antigen / Homo sapiens
• EGDNITIK (8aa)
  •    Q13740    Asn-265     CD166 antigen / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• KYTGNASALFILPDQDKM (18aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NVSVAEGK (8aa)
  •    Q9P2B2    Asn-286     Prostaglandin F2 receptor negative regulator / Homo sapiens
• RHIGHANLTFEQLRS (15aa)
  •    O00300    Asn-289     Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
• REIRHNSTGCLRM (13aa)
  •    P10909    Asn-291     Clusterin / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
  •    Q9Y5L3    Asn-294     Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
• MAWPEDHVFISTPSFNYTGR (20aa)
  •    P04180    Asn-296     Phosphatidylcholine-sterol acyltransferase / Homo sapiens
• ELDLTCNITTDR (12aa)
  •    Q9P2B2    Asn-300     Prostaglandin F2 receptor negative regulator / Homo sapiens
• VNGSLDR (7aa)
  •    Q9BYE9    Asn-300     Cadherin-related family member 2 / Homo sapiens
• YIQVVYLHNNNISVVGSSDFCPPGHNTK (28aa)
  •    P07585    Asn-303     Decorin / Homo sapiens
• NATGDYK (7aa)
  •    Q13740    Asn-306     CD166 antigen / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LQVVYLHSNNITK (13aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LHSNNITK (8aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• NETLALPAESK (11aa)
  •    Q7Z7G0    Asn-313     Target of Nesh-SH3 / Homo sapiens
• KNCTSYGVLDISKC (14aa)
  •    P16671    Asn-321     Platelet glycoprotein 4 / Homo sapiens
• AANGSLR (7aa)
  •    P11279    Asn-322     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• MFSQNDTR (8aa)
  •    P02750    Asn-325     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• KVAYSNDSANWTEYQDPRT (19aa)
  •    Q08431    Asn-325     Lactadherin / Homo sapiens
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330     Thrombospondin-2 / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IIDNNKTEK (9aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• DHENGTGTNTYAALNSVYLMMNNQMR (26aa)
  •    P06681    Asn-333     Complement C2 / Homo sapiens
• MVNMTK (6aa)
  •    Q8IXL6    Asn-335     Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
• IHVGNYNGTAGDAIR (15aa)
  •    Q14314    Asn-336     Fibroleukin / Homo sapiens
• NIETFTCDTQNITYR (15aa)
  •    P08575    Asn-337     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGSQAFVHWQEPR (13aa)
  •    P30530    Asn-345     Tyrosine-protein kinase receptor UFO / Homo sapiens
• QGNNHTCTWK (10aa)
  •    Q16610    Asn-354     Extracellular matrix protein 1 / Homo sapiens
• KMLNTSSLLEQLNEQFNWVSRL (22aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• NATVVWMK (8aa)
  •    Q13740    Asn-361     CD166 antigen / Homo sapiens
• DASSFIAEWQNITK (14aa)
  •    P08195    Asn-365     4F2 cell-surface antigen heavy chain / Homo sapiens
• KMNDTIFGFTMEERS (15aa)
  •    P20061    Asn-369     Transcobalamin-1 / Homo sapiens
• RLANLTQGEDQYYLRV (16aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• EWIPINR (7aa)
  •    O75882    Asn-383     Attractin / Homo sapiens
• TVNSSHYR (8aa)
  •    Q6QNK2    Asn-394     Adhesion G-protein coupled receptor D1 / Homo sapiens
• GLNLTEDTYKPR (12aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• NNTCVK (6aa)
  •    Q9UJT0    Asn-401     Tubulin epsilon chain / Homo sapiens
  •    Q92673    Asn-1068     Sortilin-related receptor / Homo sapiens
• RQDVNITVATVPSWIK (16aa)
  •    Q13308    Asn-405     Inactive tyrosine-protein kinase 7 / Homo sapiens
• IGFIGNQSQGCIPAR (15aa)
  •    P49746    Asn-407     Thrombospondin-3 / Homo sapiens
• VAEAVSSPAGVGVTWIEPDYQVYINASK (28aa)
  •    Q9P2B2    Asn-413     Prostaglandin F2 receptor negative regulator / Homo sapiens
• INYTVPQSGTFK (12aa)
  •    Q6YHK3    Asn-419     CD109 antigen / Homo sapiens
• RLSLLEEPGNGTFTVILNQLTSRD (24aa)
  •    P01833    Asn-421     Polymeric immunoglobulin receptor / Homo sapiens
• ENVSMVDYAHNNYQAQSAVPLR (22aa)
  •    P05186    Asn-430     Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens
• GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• HNLTITQGK (9aa)
  •    P06213    Asn-445     Insulin receptor / Homo sapiens
• ISAVNSIFISHNNTK (15aa)
  •    P48960    Asn-453     CD97 antigen / Homo sapiens
• YVQNGTYTVK (10aa)
  •    Q14126    Asn-462     Desmoglein-2 / Homo sapiens
• APQHVVNHLPPYTNVSLK (18aa)
  •    Q15262    Asn-462     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• KVPGNVTAVLGETLKV (16aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• FGNETFIIHLDNGR (14aa)
  •    Q8IXL6    Asn-470     Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480     CD166 antigen / Homo sapiens
• NFTEVHPDYGSHIQALLDK (19aa)
  •    P04040    Asn-481     Catalase / Homo sapiens
• WNDSPCNQSLPSICK (15aa)
  •    Q9UBG0    Asn-492     C-type mannose receptor 2 / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• NNESLDEGLR (10aa)
  •    Q86SQ4    Asn-505     G-protein coupled receptor 126 / Homo sapiens
• YGNPNETQNNSTSWPVFK (18aa)
  •    P06276    Asn-509     Cholinesterase / Homo sapiens
• LHNQLLPNVTTVER (14aa)
  •    P19440    Asn-511     Gamma-glutamyltranspeptidase 1 / Homo sapiens
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens
• FANEYPNITR (10aa)
  •    O75976    Asn-522     Carboxypeptidase D / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• IYPITWNGSICMR (13aa)
  •    Q8IUX7    Asn-528     Adipocyte enhancer-binding protein 1 / Homo sapiens
• EQMEVVNMSLSTSADSLTTPR (21aa)
  •    Q16363    Asn-531     Laminin subunit alpha-4 / Homo sapiens
• CQEAINATCK (10aa)
  •    P78536    Asn-539     Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• KAAIPSALDTNSSKS (15aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• YIYIASNHSNK (11aa)
  •    Q16853    Asn-592     Membrane primary amine oxidase / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• MAEVIGSKLNISR (13aa)
  •    Q9NU22    Asn-602     Midasin / Homo sapiens
• IQMISFAGEPIPQNSSMAR (19aa)
  •    Q16853    Asn-618     Membrane primary amine oxidase / Homo sapiens
• LDGLGYWSNWSNPAYTVVMDIK (22aa)
  •    P48357    Asn-624     Leptin receptor / Homo sapiens
• TEGENCTVFDSQAGFSFDLSPLTK (24aa)
  •    P11717    Asn-626     Cation-independent mannose-6-phosphate receptor / Homo sapiens
• KFGRNGSDCPDKF (13aa)
  •    P02788    Asn-642     Lactotransferrin / Homo sapiens
• RNGSDCPDKF (10aa)
  •    P02788    Asn-642     Lactotransferrin / Homo sapiens
• NNSYECDIPI (10aa)
  •    P0DTC2    Asn-657     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ISDNNTEFLLNFNEFIDR (18aa)
  •    P54289    Asn-675     Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
• GTNYTVR (7aa)
  •    P07942    Asn-677     Laminin subunit beta-1 / Homo sapiens
• IETILLNGTDR (11aa)
  •    Q07954    Asn-729     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• LITEEANR (8aa)
  •    Q16363    Asn-742     Laminin subunit alpha-4 / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• KELHHLQEQNVSNAFLDKG (19aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• QISCVANQNGSQADCEIGNPFKR (23aa)
  •    P23229    Asn-770     Integrin alpha-6 / Homo sapiens
• NLNNSQSDVVSFR (13aa)
  •    P08648    Asn-773     Integrin alpha-5 / Homo sapiens
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• DNIGSQYLLNWCVQIAK (17aa)
  •    P00533    Asn-816     Epidermal growth factor receptor / Homo sapiens
• LSALDNLLNHSSMFLK (16aa)
  •    Q9Y4L1    Asn-830     Hypoxia up-regulated protein 1 / Homo sapiens
• TVGNQTSTK (9aa)
  •    Q8IWV2    Asn-858     Contactin-4 / Homo sapiens
• VINETWAWK (9aa)
  •    Q9Y4L1    Asn-862     Hypoxia up-regulated protein 1 / Homo sapiens
• IPCSQPPQIEHGTINSSR (18aa)
  •    P08603    Asn-882     Complement factor h / Homo sapiens
• ISEENETTCYMGK (13aa)
  •    P08603    Asn-911     Complement factor h / Homo sapiens
• ALDNESEVK (9aa)
  •    Q8IWV2    Asn-929     Contactin-4 / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TEAGAFEYVPDPTFENFTGGVK (22aa)
  •    O15031    Asn-1099     Plexin-B2 / Homo sapiens
• KTAHCNESFYFLCKR (15aa)
  •    P22897    Asn-1205     Macrophage mannose receptor 1 / Homo sapiens
• TIAGENQTAFEIEEINR (17aa)
  •    P11047    Asn-1223     Laminin subunit gamma-1 / Homo sapiens
• NISQDLEK (8aa)
  •    P11047    Asn-1241     Laminin subunit gamma-1 / Homo sapiens
• LSDTTSQSNSTAK (13aa)
  •    P07942    Asn-1279     Laminin subunit beta-1 / Homo sapiens
• WTPINSSTIIGYR (13aa)
  •    P02751    Asn-1291     Fibronectin / Homo sapiens
• RGLNVTLSSTGRN (13aa)
  •    P0C0L4    Asn-1328     Complement c4-a / Homo sapiens
  •    P0C0L5    Asn-1328     Complement C4-B / Homo sapiens
• VNASTTEPNSTVEQSALMR (19aa)
  •    P07942    Asn-1336     Laminin subunit beta-1 / Homo sapiens
• VEAAQNLTLPGSLR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• VEAAQNITIPGSIR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• KVEAAQNLTLPGSLRA (16aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• VSNQTLSLFFTVLQDVPVR (19aa)
  •    P01023    Asn-1424     Alpha-2-macroglobulin / Homo sapiens
• RLLETVEYNISGAERT (16aa)
  •    P24821    Asn-1485     Tenascin / Homo sapiens
• IIETVEYNISGAER (14aa)
  •    P24821    Asn-1485     Tenascin / Homo sapiens
• DNTTCYEFK (9aa)
  •    Q07954    Asn-1575     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• KRNDQLPSNFTPVFYSQLQKN (21aa)
  •    Q99102    Asn-1647     Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
  •    P15941    Asn-1647     Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
• GFEESEPVSGSFTTAIDGPSGIVTANITDSEAIAR (35aa)
  •    P24821    Asn-1809     Tenascin / Homo sapiens
• NMTALEK (7aa)
  •    P24043    Asn-1810     Laminin subunit alpha-2 / Homo sapiens
• NSTTLVMHMK (10aa)
  •    Q07954    Asn-1825     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• HCDGNVSSCGDHPSEGCFCPPDK (23aa)
  •    P04275    Asn-2223     Von willebrand factor / Homo sapiens
• AQQIIANSTAIEEAMIQEQQR (21aa)
  •    O15230    Asn-2568     Laminin subunit alpha-5 / Homo sapiens
• VAVVQHAPSESVDNASMPPVK (21aa)
  •    P12111    Asn-2677     Collagen alpha-3(VI) chain / Homo sapiens
• GCHINECLSR (10aa)
  •    Q07954    Asn-2942     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• TCPIDEFQCNNTICKPIAWK (20aa)
  •    Q07954    Asn-3662     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens