• GlyConnect
  •     |    
  • Search
  •     |    
  • Browse :
  • Structures
  • Compositions
  • Proteins
  • Tissues
  • Taxonomy
  • Diseases
  • References
  • Help
  • Contact
  • GlyConnect >
  • Compositions >
  • Hex:6 HexNAc:5 dHex:1 NeuAc:1

Hex:6 HexNAc:5 dHex:1 NeuAc:1

SNFG, Text, Oxford
Taxonomy (8) Protein (146) Source (17) Structure (20) Composition (1) Disease (5) Site (218) Peptide (193)

    Taxonomy

  • Sus scrofa (Pig)
  • Rattus norvegicus (Norway rat)
  • Desmodus rotundus (Common vampire bat)
  • Homo sapiens (Human)
  • Columba livia (Domestic pigeon)
  • Friend murine leukemia virus (F-mulv)
  • Mus musculus (House mouse)
  • Bos taurus (Bovine)

    Protein

  • Homeobox protein Hox-B3 / Homo sapiens    P14651
  • Phospholipid transfer protein / Homo sapiens    P55058
  • Laminin subunit alpha-4 / Homo sapiens    Q16363
  • Thrombospondin-1 / Homo sapiens    P07996
  • Membrane primary amine oxidase / Homo sapiens    Q16853
  • Epidermal growth factor receptor / Homo sapiens    P00533
  • Complement C1q subcomponent subunit A / Homo sapiens    P02745
  • Metal transporter CNNM4 / Homo sapiens    Q6P4Q7
  • Biglycan / Homo sapiens    P21810
  • Clusterin / Homo sapiens    P10909
  • Fibulin-1 / Homo sapiens    P23142
  • Extracellular serine/threonine protein kinase FAM20C / Homo sapiens    Q8IXL6
  • Interleukin-6 receptor subunit beta / Homo sapiens    P40189
  • Desmoglein-2 / Homo sapiens    Q14126
  • Leptin receptor / Homo sapiens    P48357
  • Acetylcholinesterase / Bos taurus    P23795
  • Endothelin-converting enzyme 1 / Homo sapiens    P42892
  • Ectopic P granules protein 5 homolog / Homo sapiens    Q9HCE0
  • Coagulation factor VIII / Homo sapiens    P00451
  • G-protein coupled receptor 126 / Homo sapiens    Q86SQ4
  • Prosaposin / Homo sapiens    P07602
  • Biotinidase / Homo sapiens    P43251
  • Beta-2-glycoprotein 1 / Homo sapiens    P02749
  • Laminin subunit gamma-1 / Homo sapiens    P11047
  • Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
  • Ecto-ADP-ribosyltransferase 4 / Homo sapiens    Q93070
  • Complement c1r subcomponent / Homo sapiens    P00736
  • Plasma kallikrein / Homo sapiens    P03952
  • Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens    P78536
  • Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
  • Cadherin-5 / Homo sapiens    P33151
  • Complement C2 / Homo sapiens    P06681
  • Erythropoietin - tetra / Homo sapiens    P01588
  • Ig alpha-2 chain c region / Homo sapiens    P01877
  • Mimecan / Homo sapiens    P20774
  • Adhesion G-protein coupled receptor D1 / Homo sapiens    Q6QNK2
  • Collagen alpha-2(VI) chain / Homo sapiens    P12110
  • Prostate-specific antigen (psa-1) / Homo sapiens    P07288
  • Periostin / Homo sapiens    Q15063
  • Von willebrand factor / Homo sapiens    P04275
  • CD166 antigen / Homo sapiens    Q13740
  • Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
  • Alpha-1-antitrypsin / Homo sapiens    P01009
  • Extracellular matrix protein 1 / Homo sapiens    Q16610
  • Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens    Q6GTX8
  • Sortilin-related receptor / Homo sapiens    Q92673
  • Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens    P05186
  • Dipeptidyl peptidase 1 / Homo sapiens    P53634
  • Complement factor h / Homo sapiens    P08603
  • Apolipoprotein d / Homo sapiens    P05090
  • Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
  • Adhesion G protein-coupled receptor L4 / Homo sapiens    Q9HBW9
  • Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
  • Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
  • Collagen alpha-3(VI) chain / Homo sapiens    P12111
  • Phosphatidylcholine-sterol acyltransferase / Homo sapiens    P04180
  • HLA class II histocompatibility antigen, DRB1-11 beta chain / Homo sapiens    P20039
  • Lumican / Homo sapiens    P51884
  • Neuroligin 1 / Rattus norvegicus    Q62765
  • Cholinesterase / Homo sapiens    P06276
  • Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
  • Tubulin epsilon chain / Homo sapiens    Q9UJT0
  • Insulin-like growth factor-binding protein 3 / Homo sapiens    P17936
  • Asporin / Homo sapiens    Q9BXN1
  • Haptoglobin / Homo sapiens    P00738
  • Catalase / Homo sapiens    P04040
  • Integrin alpha-6 / Homo sapiens    P23229
  • Attractin / Homo sapiens    O75882
  • Ribonuclease, brain / Bos taurus    P39873
  • Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
  • Vitronectin / Homo sapiens    P04004
  • Fetal antigen 1 / Mus musculus    Q09163
  • Decorin / Homo sapiens    P07585
  • Fibromodulin / Homo sapiens    Q06828
  • Gamma-glutamyltranspeptidase 1 / Homo sapiens    P19440
  • Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
  • Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
  • Metalloproteinase inhibitor 1 / Homo sapiens    P01033
  • Tyrosine-protein kinase receptor UFO / Homo sapiens    P30530
  • Thrombospondin-3 / Homo sapiens    P49746
  • Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
  • 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
  • Thrombospondin-2 / Homo sapiens    P35442
  • Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
  • Receptor-type tyrosine-protein phosphatase mu / Homo sapiens    P28827
  • Thrombopoietin / Homo sapiens    P40225
  • Galectin-3-binding protein / Homo sapiens    Q08380
  • Carboxypeptidase D / Homo sapiens    O75976
  • Prolactin-inducible protein / Homo sapiens    P12273
  • Integrin alpha-5 / Homo sapiens    P08648
  • Thyroglobulin / Sus scrofa
  • Kininogen-1 / Homo sapiens    P01042
  • Macrophage colony-stimulating factor 1 receptor / Homo sapiens    P07333
  • Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
  • CD59 glycoprotein / Homo sapiens    P13987
  • Knob protein gp70 / Friend murine leukemia virus    P03395
  • Cadherin-related family member 2 / Homo sapiens    Q9BYE9
  • Epithelial cell adhesion molecule / Homo sapiens    P16422
  • Pantetheinase / Homo sapiens    O95497
  • Fibronectin / Homo sapiens    P02751
  • Uromodulin / Homo sapiens    P07911
  • Maltase-glucoamylase, intestinal / Homo sapiens    O43451
  • HLA class II histocompatibility antigen, DRB1-3 chain / Homo sapiens    P01912
  • Zona pellucida sperm-binding protein matrix / Mus musculus    P20239    P10761    Q62005
  • Endothelial cell-selective adhesion molecule / Homo sapiens    Q96AP7
  • C-type mannose receptor 2 / Homo sapiens    Q9UBG0
  • Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
  • CD109 antigen / Homo sapiens    Q6YHK3
  • HLA class II histocompatibility antigen, DRB1-13 beta chain / Homo sapiens    Q5Y7A7
  • Alpha-2-macroglobulin / Homo sapiens    P01023
  • Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
  • Midasin / Homo sapiens    Q9NU22
  • Oncoprotein-induced transcript 3 protein / Homo sapiens    Q8WWZ8
  • Tissue-type plasminogen activator / Homo sapiens    P00750
  • Apolipoprotein f / Homo sapiens    Q13790
  • Hemopexin / Homo sapiens    P02790
  • Fibroleukin / Homo sapiens    Q14314
  • CD97 antigen / Homo sapiens    P48960
  • Plexin-B2 / Homo sapiens    O15031
  • Ig alpha-1 chain c region / Homo sapiens    P01876
  • Ceruloplasmin / Homo sapiens    P00450
  • Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
  • Macrosialin / Homo sapiens    P34810
  • Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
  • Laminin subunit alpha-2 / Homo sapiens    P24043
  • Interferon alpha/beta receptor 1 / Homo sapiens    P17181
  • Lactotransferrin / Homo sapiens    P02788
  • Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
  • Matrilin-4 / Homo sapiens    O95460
  • Tenascin / Homo sapiens    P24821
  • Signal transducer CD24 / Homo sapiens    P25063
  • Laminin subunit alpha-5 / Homo sapiens    O15230
  • Probable lysosomal cobalamin transporter / Homo sapiens    Q9NUN5
  • Laminin subunit beta-1 / Homo sapiens    P07942
  • Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
  • Contactin-4 / Homo sapiens    Q8IWV2
  • Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
  • Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
  • Coagulation factor x / Homo sapiens    P00742
  • Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens    P54289
  • Immunoglobulin heavy constant mu / Homo sapiens    P01871
  • Ig epsilon chain c region / Homo sapiens    P01854
  • Insulin receptor / Homo sapiens    P06213
  • Immunoglobulin gamma / Columba livia
  • HLA class II histocompatibility antigen, DRB1-14 beta chain / Homo sapiens    Q9GIY3
  • Cation-independent mannose-6-phosphate receptor / Homo sapiens    P11717

    Source

  • Prostate Gland (UBERON_0002367)  
  • BHK570 (CVCL_6370)   Kidney (UBERON_0002113)   Fibroblast (CL_0000057)  
  • C127 (CVCL_6550)   Mammary Gland (UBERON_0001911)  
  • HEK293-EBNA (CVCL_6974)   Kidney (UBERON_0002113)  
  • HUVEC-C (CVCL_2959)   Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
  • Thyroid (UBERON_0002046)  
  • Amniotic Fluid (UBERON_0000173)  
  • Microsome (GO_0005792)  
  • HEK293 (CVCL_0045)   Kidney (UBERON_0002113)  
  • Urine (UBERON_0001088)  
  • Brain (UBERON_0000955)  
  • Blood Serum (UBERON_0001977)  
  • CHO (CVCL_0213)   Ovary (UBERON_0000992)  
  • Mammary Gland (UBERON_0001911)  
  • CHO-DG44 (CVCL_7180)   Ovary (UBERON_0000992)  
  • Blood Plasma (UBERON_0001969)  
  • Zona Pellucida (UBERON_0000086)  

    Reported structure

  • N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ NeuAc(a2-?)"
  • N-Linked / Complex / Structure 587
  • N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ NeuAc(a2-3)"
  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
  • N-Linked / Complex / Structure 2089
  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
  • N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
  • N-Linked / Complex / Structure 2271
  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc(a2-6)"
  • N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
  • N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-6)"
  • N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ Hex + HexNAc"
  • N-Linked / Complex / Gal(a1-4)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
  • N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc"
  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
  • N-Linked / Hybrid / Structure 225

    Composition

  • Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )

    Disease

  • Cancer, breast (DOID:1612)
  • Healthy
  • IgE myeloma (DOID:9538)
  • Prostate cancer (DOID:10283)
  • Hyperimmune condition

    Reported glycosite

  • Laminin subunit alpha-5 / Homo sapiens :
    •        Asn-2568
  • Neuroligin 1 / Rattus norvegicus :
    •        Undefined site
  • HLA class II histocompatibility antigen, DRB1-13 beta chain / Homo sapiens :
    •        Asn-48
  • Epithelial cell adhesion molecule / Homo sapiens :
    •        Asn-74
  • Uromodulin / Homo sapiens :
    •        Asn-513
  • Matrilin-4 / Homo sapiens :
    •        Asn-69
  • Oncoprotein-induced transcript 3 protein / Homo sapiens :
    •        Asn-109
  • CD109 antigen / Homo sapiens :
    •        Asn-118
    •        Asn-419
  • Phosphatidylcholine-sterol acyltransferase / Homo sapiens :
    •        Asn-296
  • Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens :
    •        Asn-101
    •        Asn-455
  • Mimecan / Homo sapiens :
    •        Asn-214
  • Alpha-1-acid glycoprotein 2 / Homo sapiens :
    •        Asn-33
  • Prosaposin / Homo sapiens :
    •        Asn-215
    •        Asn-332
  • Integrin alpha-6 / Homo sapiens :
    •        Asn-770
  • Macrophage colony-stimulating factor 1 receptor / Homo sapiens :
    •        Asn-153
  • CD59 glycoprotein / Homo sapiens :
    •        Asn-43
  • HLA class II histocompatibility antigen, DRB1-3 chain / Homo sapiens :
    •        Asn-48
  • Apolipoprotein d / Homo sapiens :
    •        Asn-65
    •        Asn-98
  • Fibromodulin / Homo sapiens :
    •        Asn-166
  • Knob protein gp70 / Friend murine leukemia virus :
    •        Asn-334 and/or Asn-341
    •        Asn-341 and/or Asn-334
    •        Asn-266
    •        Asn-302
    •        Asn-374
    •        Asn-410
  • Adipocyte enhancer-binding protein 1 / Homo sapiens :
    •        Asn-528
  • Fibulin-1 / Homo sapiens :
    •        Asn-98
  • Alpha-n-acetylgalactosaminidase / Homo sapiens :
    •        Undefined site
  • Insulin-like growth factor-binding protein 3 / Homo sapiens :
    •        Asn-116
  • Macrosialin / Homo sapiens :
    •        Asn-199
  • Midasin / Homo sapiens :
    •        Asn-602
  • Thrombopoietin / Homo sapiens :
    •        Undefined site
  • HLA class II histocompatibility antigen, DRB1-14 beta chain / Homo sapiens :
    •        Asn-48
  • Metalloproteinase inhibitor 1 / Homo sapiens :
    •        Asn-53
  • Tyrosine-protein kinase receptor UFO / Homo sapiens :
    •        Asn-345
  • Prolactin-inducible protein / Homo sapiens :
    •        Asn-105
  • Galectin-3-binding protein / Homo sapiens :
    •        Asn-69
    •        Asn-398
    •        Asn-551
  • Lumican / Homo sapiens :
    •        Asn-88
    •        Asn-124
    •        Asn-127
    •        Asn-160
  • Alpha-2-macroglobulin / Homo sapiens :
    •        Asn-1424
  • Alpha-1-antitrypsin / Homo sapiens :
    •        Asn-271
  • Ectopic P granules protein 5 homolog / Homo sapiens :
    •        Asn-137
  • Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens :
    •        Asn-69
  • Complement C2 / Homo sapiens :
    •        Asn-333
  • Phospholipid transfer protein / Homo sapiens :
    •        Asn-64
  • Receptor-type tyrosine-protein phosphatase mu / Homo sapiens :
    •        Asn-121
  • Fetal antigen 1 / Mus musculus :
    •        Asn-100
  • Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens :
    •        Asn-539
  • Laminin subunit alpha-2 / Homo sapiens :
    •        Asn-1810
  • Tubulin epsilon chain / Homo sapiens :
    •        Asn-401
  • Haptoglobin / Homo sapiens :
    •        Asn-241
  • Maltase-glucoamylase, intestinal / Homo sapiens :
    •        Asn-135
  • Zinc-alpha-2-glycoprotein / Homo sapiens :
    •        Asn-128
  • Contactin-4 / Homo sapiens :
    •        Asn-858
    •        Asn-929
  • Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens :
    •        Asn-675
  • Prostate-specific antigen (psa-1) / Homo sapiens :
    •        Asn-69 in UniProt (Asn-45 in publication)
    •        Asn-69
  • Ig alpha-1 chain c region / Homo sapiens :
    •        Asn-340
  • HLA class II histocompatibility antigen, DRB1-11 beta chain / Homo sapiens :
    •        Asn-48
  • Low density lipoprotein receptor-related protein 2 / Rattus norvegicus :
    •        Undefined site
  • Lysosome-associated membrane glycoprotein 1 / Homo sapiens :
    •        Asn-84
    •        Asn-249
    •        Asn-261
    •        Asn-322
  • Zona pellucida sperm-binding protein matrix / Mus musculus :
    •        Undefined site
  • Interleukin-6 receptor subunit beta / Homo sapiens :
    •        Asn-131
  • Gamma-glutamyltranspeptidase 1 / Homo sapiens :
    •        Asn-162
  • Olfactomedin-like protein 3 / Homo sapiens :
    •        Asn-177
    •        Asn-248
  • Alpha-1-acid glycoprotein 1 / Homo sapiens :
    •        Asn-33
    •        Asn-93
  • Fibroleukin / Homo sapiens :
    •        Asn-179
    •        Asn-336
  • Immunoglobulin heavy constant mu / Homo sapiens :
    •        Undefined site
    •        Asn-209
  • Attractin / Homo sapiens :
    •        Asn-383
  • Complement C1q subcomponent subunit A / Homo sapiens :
    •        Asn-146
  • Cholinesterase / Homo sapiens :
    •        Asn-509
  • Homeobox protein Hox-B3 / Homo sapiens :
    •        Asn-223
  • Decorin / Homo sapiens :
    •        Asn-262
    •        Asn-303
  • Immunoglobulin gamma / Columba livia :
    •        Undefined site
  • Ig epsilon chain c region / Homo sapiens :
    •        Asn-21
    •        Asn-49
    •        Asn-99
    •        Asn-146
    •        Asn-252
  • Salivary plasminogen activator alpha 1 / Desmodus rotundus :
    •        Asn-398
  • Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens :
    •        Asn-294
  • Thrombospondin-2 / Homo sapiens :
    •        Asn-330
  • Cadherin-related family member 2 / Homo sapiens :
    •        Asn-300
  • Fibronectin / Homo sapiens :
    •        Asn-7
    •        Asn-430
    •        Asn-528
    •        Asn-1038
  • Sortilin-related receptor / Homo sapiens :
    •        Asn-1068
  • Receptor-type tyrosine-protein phosphatase C / Homo sapiens :
    •        Asn-234
    •        Asn-335
  • Membrane primary amine oxidase / Homo sapiens :
    •        Asn-592
    •        Asn-618
  • Thrombospondin-3 / Homo sapiens :
    •        Asn-407
  • Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens :
    •        Asn-517
    •        Asn-577
  • Endothelial cell-selective adhesion molecule / Homo sapiens :
    •        Asn-213
  • CD97 antigen / Homo sapiens :
    •        Asn-453
  • Clusterin / Homo sapiens :
    •        Asn-86
    •        Asn-103
  • Ribonuclease, brain / Bos taurus :
    •        Asn-88
  • Leucine-rich alpha-2-glycoprotein / Homo sapiens :
    •        Asn-325
  • Plasma kallikrein / Homo sapiens :
    •        Asn-164
  • Tenascin / Homo sapiens :
    •        Asn-166
    •        Asn-1392
    •        Asn-1485
    •        Asn-1809
  • Lactotransferrin / Homo sapiens :
    •        Asn-497
  • Beta-2-glycoprotein 1 / Homo sapiens :
    •        Asn-162
  • Hypoxia up-regulated protein 1 / Homo sapiens :
    •        Asn-827
    •        Asn-862
  • Complement c1r subcomponent / Homo sapiens :
    •        Asn-122
  • Cation-independent mannose-6-phosphate receptor / Homo sapiens :
    •        Asn-626
  • Acetylcholinesterase / Bos taurus :
    •        Undefined site
  • Cadherin-5 / Homo sapiens :
    •        Undefined site
  • Epidermal growth factor receptor / Homo sapiens :
    •        Asn-816
  • Coagulation factor x / Homo sapiens :
    •        Asn-221
    •        Asn-231
  • Prostaglandin F2 receptor negative regulator / Homo sapiens :
    •        Asn-286
    •        Asn-300
    •        Asn-413
  • Laminin subunit beta-1 / Homo sapiens :
    •        Asn-677
    •        Asn-1279
    •        Asn-1336
  • Hemopexin / Homo sapiens :
    •        Asn-187
  • Lysosome-associated membrane glycoprotein 2 / Homo sapiens :
    •        Asn-32
    •        Asn-49
    •        Asn-58
    •        Asn-101
    •        Asn-253
    •        Asn-257
    •        Asn-275
    •        Asn-356
  • Leptin receptor / Homo sapiens :
    •        Asn-624
  • CD166 antigen / Homo sapiens :
    •        Asn-265
    •        Asn-306
    •        Asn-361
    •        Asn-480
  • Metal transporter CNNM4 / Homo sapiens :
    •        Asn-127
  • Inactive tyrosine-protein kinase 7 / Homo sapiens :
    •        Asn-116
    •        Asn-405
  • Prostaglandin-h2 d-isomerase / Homo sapiens :
    •        Asn-51
    •        Asn-78
  • Extracellular matrix protein 1 / Homo sapiens :
    •        Asn-353
  • Erythropoietin - tetra / Homo sapiens :
    •        Asn-110
  • Adhesion G-protein coupled receptor D1 / Homo sapiens :
    •        Asn-394
  • Von willebrand factor / Homo sapiens :
    •        Asn-2223
  • Collagen alpha-2(VI) chain / Homo sapiens :
    •        Asn-785
  • Complement factor h / Homo sapiens :
    •        Asn-882
    •        Asn-911
  • Thrombospondin-1 / Homo sapiens :
    •        Asn-248
    •        Asn-360
    •        Asn-1067
  • Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens :
    •        Asn-430
  • Catalase / Homo sapiens :
    •        Asn-481
  • Target of Nesh-SH3 / Homo sapiens :
    •        Asn-313
  • Biotinidase / Homo sapiens :
    •        Asn-150
  • Desmoglein-2 / Homo sapiens :
    •        Asn-462
  • Biglycan / Homo sapiens :
    •        Asn-270
    •        Asn-311
  • Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens :
    •        Asn-729
    •        Asn-1575
    •        Asn-1825
    •        Asn-2942
    •        Asn-3662
  • Ecto-ADP-ribosyltransferase 4 / Homo sapiens :
    •        Asn-178
  • Apolipoprotein f / Homo sapiens :
    •        Asn-118
  • Extracellular serine/threonine protein kinase FAM20C / Homo sapiens :
    •        Asn-335
    •        Asn-470
  • Periostin / Homo sapiens :
    •        Asn-599
  • Pantetheinase / Homo sapiens :
    •        Asn-130
  • Collagen alpha-3(VI) chain / Homo sapiens :
    •        Asn-2677
  • Laminin subunit alpha-4 / Homo sapiens :
    •        Asn-531
    •        Asn-742
  • C-type mannose receptor 2 / Homo sapiens :
    •        Asn-492
  • Dipeptidyl peptidase 1 / Homo sapiens :
    •        Asn-276
  • Probable lysosomal cobalamin transporter / Homo sapiens :
    •        Asn-78
  • 4F2 cell-surface antigen heavy chain / Homo sapiens :
    •        Asn-365
  • Coagulation factor VIII / Homo sapiens :
    •        Undefined site
  • G-protein coupled receptor 126 / Homo sapiens :
    •        Asn-504
  • Carboxypeptidase D / Homo sapiens :
    •        Asn-522
  • Adhesion G protein-coupled receptor L4 / Homo sapiens :
    •        Asn-249
  • Interferon alpha/beta receptor 1 / Homo sapiens :
    •        Asn-254
  • Integrin alpha-5 / Homo sapiens :
    •        Asn-771
  • Plexin-B2 / Homo sapiens :
    •        Asn-1099
  • Signal transducer CD24 / Homo sapiens :
    •        Asn-52
  • Ig alpha-2 chain c region / Homo sapiens :
    •        Undefined site
    •        Asn-205
  • Endothelin-converting enzyme 1 / Homo sapiens :
    •        Asn-187
  • Ceruloplasmin / Homo sapiens :
    •        Asn-138
    •        Asn-762
  • Asporin / Homo sapiens :
    •        Asn-282
  • Tissue-type plasminogen activator / Homo sapiens :
    •        Undefined site
  • Kininogen-1 / Homo sapiens :
    •        Asn-205
    •        Asn-294
  • Vitronectin / Homo sapiens :
    •        Asn-86
    •        Asn-169
    •        Asn-242
  • Thyroglobulin / Sus scrofa :
    •        Undefined site
  • Laminin subunit gamma-1 / Homo sapiens :
    •        Asn-1223
    •        Asn-1241
  • Insulin receptor / Homo sapiens :
    •        Asn-445

    Mass spectrometry validated peptide

  • WTPINSSTIIGYR (13aa)
    •    P02751    Asn-1038
  • WTPINSSTIIGYR (13aa)
    •    P02751    Asn-7
  • LELNLTDSENATCLYAK (17aa)
    •    P13473    Asn-32
  • LVPVPITNATLDR (13aa)
    •    P19652    Asn-33
  • LVPVPITNATLDQITGK (17aa)
    •    P02763    Asn-33
  • TAVNCSSDFDACLITK (16aa)
    •    P13987    Asn-43
  • TAVNCSSDFDACIITK (16aa)
    •    P13987    Asn-43
  • FIEYSTSECHFFNGTER (17aa)
    •    Q5Y7A7    Asn-48
  • FIEYSTSECHFFNGTER (17aa)
    •    P01912    Asn-48
  • FIEYSTSECHFFNGTER (17aa)
    •    Q9GIY3    Asn-48
  • FIEYSTSECHFFNGTER (17aa)
    •    P20039    Asn-48
  • WQMNFTVR (8aa)
    •    P13473    Asn-49
  • WFSAGLASNSSWLR (14aa)
    •    P41222    Asn-51
  • APNPTNATTK (10aa)
    •    P25063    Asn-52
  • YETTNK (6aa)
    •    P13473    Asn-58
  • EGHFYYNISEVK (12aa)
    •    P55058    Asn-64
  • CIQANYSIMENGK (13aa)
    •    P05090    Asn-65
  • SVVAPATDGGLNLTSTFLR (19aa)
    •    P41222    Asn-78
  • AIGFENATQAIGR (13aa)
    •    Q08380    Asn-69
  • GLNVGPNATR (10aa)
    •    O95460    Asn-69
  • STYNDTEDVSQASPSESEAR (20aa)
    •    Q6GTX8    Asn-69
  • AEMNGSK (7aa)
    •    P16422    Asn-74
  • NQNGTFK (7aa)
    •    Q9NUN5    Asn-78
  • SSCGKENTSDPSIVIAFGR (19aa)
    •    P11279    Asn-84
  • NNATVHEQVGGPSLTSDLQAQSK (23aa)
    •    P04004    Asn-86
  • KEDALNETR (9aa)
    •    P10909    Asn-86
  • ADGTVNQIEGEATPVNLTEPAK (22aa)
    •    P05090    Asn-98
  • AFENVTDLQWLILDHNLLENSK (22aa)
    •    P51884    Asn-88
  • QDQCIYNTTYLNVQR (15aa)
    •    P02763    Asn-93
  • ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
    •    P05090    Asn-98
  • CATPHGDNASIEATFVK (17aa)
    •    P23142    Asn-98
  • IAVQFGPGFSWIANFTK (17aa)
    •    P13473    Asn-101
  • ENDTHCIDFSYLLYSQK (17aa)
    •    Q15262    Asn-101
  • LPGVCNETMMALWEECKPCLK (21aa)
    •    P10909    Asn-103
  • ELPGVCNETMMALWEECKPCLK (22aa)
    •    P10909    Asn-103
  • TFYWDFYTNR (10aa)
    •    P12273    Asn-105
  • QACASFNGNCCLWNTTVEVK (20aa)
    •    Q8WWZ8    Asn-109
  • SANASFNIK (9aa)
    •    Q13308    Asn-116
  • GLCVNASAVSR (11aa)
    •    P17936    Asn-116
  • QGGVNATQVLIQHLR (15aa)
    •    Q13790    Asn-118
  • TQDEIIFSNSTR (12aa)
    •    Q6YHK3    Asn-118
  • VNNGPLGNPIWNISGDPTR (19aa)
    •    P28827    Asn-121
  • MLLTFHTDFSNEENGTIMFYK (21aa)
    •    P00736    Asn-122
  • LHINHNNLTESVGPLPK (17aa)
    •    P51884    Asn-124
  • LHINHNNLTESVGPLPK (17aa)
    •    P51884    Asn-127
  • KLHINHNNLTESVGPLPK (18aa)
    •    P51884    Asn-127
  • HINHNNLTESVGPLPK (16aa)
    •    P51884    Asn-127
  • GNTSGVIVVITK (12aa)
    •    Q6P4Q7    Asn-127
  • FGCEIENNR (9aa)
    •    P25311    Asn-128
  • NNSIYVVANIGDK (13aa)
    •    O95497    Asn-130
  • NLSCIVNEGK (10aa)
    •    P40189    Asn-131
  • NHSYHVEGNLVNTNAGFTAR (20aa)
    •    O43451    Asn-135
  • NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
    •    Q9HCE0    Asn-137
  • EHEGAIYPDNTTDFQR (16aa)
    •    P00450    Asn-138
  • VVIFDTVITNQEEPYQNHSGR (21aa)
    •    P02745    Asn-146
  • RNPPMGGNVVIFDTVITNQEEPYQNHSGR (29aa)
    •    P02745    Asn-146
  • FNDTEVLQR (9aa)
    •    P43251    Asn-150
  • HTNYSFSPWHGFTIHR (16aa)
    •    P07333    Asn-153
  • IGSFEGIVNITFIHIQHNR (19aa)
    •    P51884    Asn-160
  • VYKPSAGNNSLYR (13aa)
    •    P02749    Asn-162
  • LHNQLLPNVTTVER (14aa)
    •    P19440    Asn-162
  • NNCLLK (6aa)
    •    P03952    Asn-164
  • IYIDHNNITR (10aa)
    •    Q06828    Asn-166
  • GNFSTEGCGCVCEPGWK (17aa)
    •    P24821    Asn-166
  • NGSLFAFR (8aa)
    •    P04004    Asn-169
  • IYVIDGTQNDTAFVFPR (17aa)
    •    Q9NRN5    Asn-177
  • DSIMENGTLCYEVHYR (16aa)
    •    Q93070    Asn-178
  • VANITFVVNSIDGK (14aa)
    •    Q14314    Asn-179
  • SWPAVGNCSSALR (13aa)
    •    P02790    Asn-187
  • ACMNETR (7aa)
    •    P42892    Asn-187
  • VMYTTQGGGEAWGISVLNPNK (21aa)
    •    P34810    Asn-199
  • AWGISVLNPNK (11aa)
    •    P34810    Asn-199
  • TPLTANITK (9aa)
    •    P01877    Asn-205
  • ITYSIVQTNCSK (12aa)
    •    P01042    Asn-205
  • GLTFQQNASSMCGPDQDTAIR (21aa)
    •    P01871    Asn-209
    •    VAR_003904   215:V→G   dbSNP:rs12365
  • GLTFQQNASSMCVPDQDTAIR (21aa)
    •    P01871    Asn-209
  • GITFQQNASSMCVPDQDTAIR (21aa)
    •    P01871    Asn-209
  • GSLSLTNLSSSMAGVYVCK (19aa)
    •    Q96AP7    Asn-213
  • KLNNLTFLYLDHNALESVPLNLPESLR (27aa)
    •    P20774    Asn-214
  • LNNLTFLYLDHNALESVPLNLPESLR (26aa)
    •    P20774    Asn-214
  • TNSTFVQALVEHVK (14aa)
    •    P07602    Asn-215
  • VEMANLLNLSER (12aa)
    •    P14651    Asn-223
  • YANITVDYLYNK (12aa)
    •    P08575    Asn-234
  • VVLHPNYSQVDIGLIK (16aa)
    •    P00738    Asn-241
  • GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
    •    P07996    Asn-248
  • LTLDNNVVNGSSPAIR (16aa)
    •    P07996    Asn-248
  • FHLANR (6aa)
    •    Q9NRN5    Asn-248
  • KDNTTVTR (8aa)
    •    P11279    Asn-249
  • TTEFDTNSTDIALK (14aa)
    •    Q9HBW9    Asn-249
  • VASVININPNTTHSTGSCR (19aa)
    •    P13473    Asn-253
  • VASVININPNTTHSTGSCR (19aa)
    •    P13473    Asn-257
  • WDYTYANMTFQVQWLHAFLK (20aa)
    •    P17181    Asn-254
  • IININPNK (8aa)
    •    P11279    Asn-261
  • GLSFNSISAVDNGSLANTPHLR (22aa)
    •    P07585    Asn-262
  • IGISFNSISAVDNGSIANTPHIR (23aa)
    •    P07585    Asn-262
  • LGLSFNSISAVDNGSLANTPH (21aa)
    •    P07585    Asn-262
  • EGDNITIK (8aa)
    •    Q13740    Asn-265
  • NAIKEGDNITIK (12aa)
    •    Q13740    Asn-265
  • MIENGSISFIPTIR (14aa)
    •    P21810    Asn-270
  • YIGNATAIFFIPDEGK (16aa)
    •    P01009    Asn-271
  • LNSSTIK (7aa)
    •    P13473    Asn-275
  • IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
    •    P53634    Asn-276
  • ITDIENGSIANIPR (14aa)
    •    Q9BXN1    Asn-282
  • NVSVAEGK (8aa)
    •    Q9P2B2    Asn-286
  • LNAENNATFYFK (12aa)
    •    P01042    Asn-294
  • GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
    •    Q9Y5L3    Asn-294
  • MAWPEDHVFISTPSFNYTGR (20aa)
    •    P04180    Asn-296
  • ELDLTCNITTDR (12aa)
    •    Q9P2B2    Asn-300
  • VNGSLDR (7aa)
    •    Q9BYE9    Asn-300
  • YIQVVYLHNNNISVVGSSDFCPPGHNTK (28aa)
    •    P07585    Asn-303
  • NATGDYK (7aa)
    •    Q13740    Asn-306
  • LQVVYLHSNNITK (13aa)
    •    P21810    Asn-311
  • LHSNNITK (8aa)
    •    P21810    Asn-311
  • IIQVVYIHSNNITK (14aa)
    •    P21810    Asn-311
  • NETLALPAESK (11aa)
    •    Q7Z7G0    Asn-313
  • AANGSLR (7aa)
    •    P11279    Asn-322
  • MFSQNDTR (8aa)
    •    P02750    Asn-325
  • FFAENETWVVDSCTTCTCK (19aa)
    •    P35442    Asn-330
  • IIDNNKTEK (9aa)
    •    P07602    Asn-332
  • DHENGTGTNTYAALNSVYLMMNNQMR (26aa)
    •    P06681    Asn-333
  • NIETFTCDTQNITYR (15aa)
    •    P08575    Asn-335
  • MVNMTK (6aa)
    •    Q8IXL6    Asn-335
  • IHVGNYNGTAGDAIR (15aa)
    •    Q14314    Asn-336
  • LAGKPTHVNVSVVMAEVDGTC (21aa)
    •    P01876    Asn-340
  • LAGKPTHVNVSVVMAEVDGTCY (22aa)
    •    P01876    Asn-340
  • NGSQAFVHWQEPR (13aa)
    •    P30530    Asn-345
  • QGNNHTCTWK (10aa)
    •    Q16610    Asn-353
  • VQPFNVTQGK (10aa)
    •    P13473    Asn-356
  • KVSCPIMPCSNATVPDGECCPR (22aa)
    •    P07996    Asn-360
  • NATVVWMK (8aa)
    •    Q13740    Asn-361
  • DASSFIAEWQNITK (14aa)
    •    P08195    Asn-365
  • EWIPINR (7aa)
    •    O75882    Asn-383
  • TVNSSHYR (8aa)
    •    Q6QNK2    Asn-394
  • GLNLTEDTYKPR (12aa)
    •    Q08380    Asn-398
  • NNTCVK (6aa)
    •    Q9UJT0    Asn-401
  • NNTCVK (6aa)
    •    Q92673    Asn-1068
  • RQDVNITVATVPSWIK (16aa)
    •    Q13308    Asn-405
  • IGFIGNQSQGCIPAR (15aa)
    •    P49746    Asn-407
  • VAEAVSSPAGVGVTWIEPDYQVYINASK (28aa)
    •    Q9P2B2    Asn-413
  • INYTVPQSGTFK (12aa)
    •    Q6YHK3    Asn-419
  • GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
    •    P02751    Asn-430
  • ENVSMVDYAHNNYQAQSAVPLR (22aa)
    •    P05186    Asn-430
  • HNLTITQGK (9aa)
    •    P06213    Asn-445
  • ISAVNSIFISHNNTK (15aa)
    •    P48960    Asn-453
  • APQHVVNHLPPYTNVSLK (18aa)
    •    Q15262    Asn-455
  • YVQNGTYTVK (10aa)
    •    Q14126    Asn-462
  • FGNETFIIHLDNGR (14aa)
    •    Q8IXL6    Asn-470
  • IIISPEENVTITCTAENQIER (21aa)
    •    Q13740    Asn-480
  • NFTEVHPDYGSHIQALLDK (19aa)
    •    P04040    Asn-481
  • WNDSPCNQSLPSICK (15aa)
    •    Q9UBG0    Asn-492
  • TAGWNIPMGIIFNQTGSCK (19aa)
    •    P02788    Asn-497
  • NNESLDEGLR (10aa)
    •    Q86SQ4    Asn-504
  • FALLMTNCYATPSSNATDPLK (21aa)
    •    P07911    Asn-513
  • YGNPNETQNNSTSWPVFK (18aa)
    •    P06276    Asn-509
  • FANEYPNITR (10aa)
    •    O75976    Asn-522
  • DQCIVDDITYNVNDTFHK (18aa)
    •    P02751    Asn-528
  • IYPITWNGSICMR (13aa)
    •    Q8IUX7    Asn-528
  • EQMEVVNMSLSTSADSLTTPR (21aa)
    •    Q16363    Asn-531
  • CQEAINATCK (10aa)
    •    P78536    Asn-539
  • AAIPSAIDTNSSK (13aa)
    •    Q08380    Asn-551
  • YIYIASNHSNK (11aa)
    •    Q16853    Asn-592
  • EVNDTLLVNELK (12aa)
    •    Q15063    Asn-599
  • MAEVIGSKLNISR (13aa)
    •    Q9NU22    Asn-602
  • IQMISFAGEPIPQNSSMAR (19aa)
    •    Q16853    Asn-618
  • LDGLGYWSNWSNPAYTVVMDIK (22aa)
    •    P48357    Asn-624
  • TEGENCTVFDSQAGFSFDLSPLTK (24aa)
    •    P11717    Asn-626
  • ISDNNTEFLLNFNEFIDR (18aa)
    •    P54289    Asn-675
  • GTNYTVR (7aa)
    •    P07942    Asn-677
  • IETILLNGTDR (11aa)
    •    Q07954    Asn-729
  • LITEEANR (8aa)
    •    Q16363    Asn-742
  • ELHHLQEQNVSNAFLDK (17aa)
    •    P00450    Asn-762
  • QISCVANQNGSQADCEIGNPFKR (23aa)
    •    P23229    Asn-770
  • NLNNSQSDVVSFR (13aa)
    •    P08648    Asn-771
  • NMTLFSDLVAEK (12aa)
    •    P12110    Asn-785
  • DNIGSQYLLNWCVQIAK (17aa)
    •    P00533    Asn-816
  • LSALDNLLNHSSMFLK (16aa)
    •    Q9Y4L1    Asn-827
  • TVGNQTSTK (9aa)
    •    Q8IWV2    Asn-858
  • VINETWAWK (9aa)
    •    Q9Y4L1    Asn-862
  • IPCSQPPQIEHGTINSSR (18aa)
    •    P08603    Asn-882
  • ISEENETTCYMGK (13aa)
    •    P08603    Asn-911
  • ALDNESEVK (9aa)
    •    Q8IWV2    Asn-929
  • VVNSTTGPGEHIR (13aa)
    •    P07996    Asn-1067
  • TEAGAFEYVPDPTFENFTGGVK (22aa)
    •    O15031    Asn-1099
  • TIAGENQTAFEIEEINR (17aa)
    •    P11047    Asn-1223
  • NISQDLEK (8aa)
    •    P11047    Asn-1241
  • LSDTTSQSNSTAK (13aa)
    •    P07942    Asn-1279
  • VNASTTEPNSTVEQSALMR (19aa)
    •    P07942    Asn-1336
  • VEAAQNLTLPGSLR (14aa)
    •    P24821    Asn-1392
  • VEAAQNITIPGSIR (14aa)
    •    P24821    Asn-1392
  • VSNQTLSLFFTVLQDVPVR (19aa)
    •    P01023    Asn-1424
  • IIETVEYNISGAER (14aa)
    •    P24821    Asn-1485
  • DNTTCYEFK (9aa)
    •    Q07954    Asn-1575
  • GFEESEPVSGSFTTAIDGPSGIVTANITDSEAIAR (35aa)
    •    P24821    Asn-1809
  • NMTALEK (7aa)
    •    P24043    Asn-1810
  • NSTTLVMHMK (10aa)
    •    Q07954    Asn-1825
  • HCDGNVSSCGDHPSEGCFCPPDK (23aa)
    •    P04275    Asn-2223
  • AQQIIANSTAIEEAMIQEQQR (21aa)
    •    O15230    Asn-2568
  • VAVVQHAPSESVDNASMPPVK (21aa)
    •    P12111    Asn-2677
  • GCHINECLSR (10aa)
    •    Q07954    Asn-2942
  • TCPIDEFQCNNTICKPIAWK (20aa)
    •    Q07954    Asn-3662
  • No image
    • N-Linked / Hybrid (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Prostate-specific antigen (psa-1) / Homo sapiens :
        •        Asn-69
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Metalloproteinase inhibitor 1 / Homo sapiens :
        •        Asn-53
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Acetylcholinesterase / Bos taurus :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Thyroglobulin / Sus scrofa :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Vitronectin / Homo sapiens :
        •        Asn-242
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (2)

        Reported glycosite

      • Ribonuclease, brain / Bos taurus :
        •        Asn-88
      • Tissue-type plasminogen activator / Homo sapiens :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (4)

        Reported glycosite

      • Salivary plasminogen activator alpha 1 / Desmodus rotundus :
        •        Asn-398
      • Tissue-type plasminogen activator / Homo sapiens :
        •        Undefined site
      • Alpha-n-acetylgalactosaminidase / Homo sapiens :
        •        Undefined site
      • Coagulation factor VIII / Homo sapiens :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Fetal antigen 1 / Mus musculus :
        •        Asn-100
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (6)

        Reported glycosite

      • Knob protein gp70 / Friend murine leukemia virus :
        •        Asn-334 and/or Asn-341
        •        Asn-341 and/or Asn-334
        •        Asn-266
        •        Asn-302
        •        Asn-374
        •        Asn-410
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Zona pellucida sperm-binding protein matrix / Mus musculus :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Immunoglobulin gamma / Columba livia :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (7)

        Reported glycosite

      • Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens :
        •        Asn-517
        •        Asn-577
      • Ig epsilon chain c region / Homo sapiens :
        •        Asn-21
        •        Asn-49
        •        Asn-99
        •        Asn-146
        •        Asn-252
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Low density lipoprotein receptor-related protein 2 / Rattus norvegicus :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Erythropoietin - tetra / Homo sapiens :
        •        Asn-110
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Cadherin-5 / Homo sapiens :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Thrombopoietin / Homo sapiens :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (6)

        Reported glycosite

      • Knob protein gp70 / Friend murine leukemia virus :
        •        Asn-334 and/or Asn-341
        •        Asn-341 and/or Asn-334
        •        Asn-266
        •        Asn-302
        •        Asn-374
        •        Asn-410
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (3)

        Reported glycosite

      • Ribonuclease, brain / Bos taurus :
        •        Asn-88
      • Coagulation factor x / Homo sapiens :
        •        Asn-221
        •        Asn-231
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (2)

        Reported glycosite

      • Salivary plasminogen activator alpha 1 / Desmodus rotundus :
        •        Asn-398
      • Alpha-n-acetylgalactosaminidase / Homo sapiens :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2444.2456 )
    • Site (1)

        Reported glycosite

      • Neuroligin 1 / Rattus norvegicus :
        •        Undefined site
  • 6 x 5 x 1 x 1 x
    • Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )
    • Site (1) Suggested Structure (19)

        Suggested structure

      • N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ Hex + HexNAc"
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ NeuAc(a2-3)"
      • N-Linked / Hybrid / Structure 225
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
      • N-Linked / Complex / Structure 587
      • N-Linked / Complex / Gal(a1-4)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc(a2-6)"
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
      • N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-6)"
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
      • N-Linked / Complex / Structure 2089
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
      • N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc"
      • N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / Structure 2271

        Reported glycosite

      • Prostate-specific antigen (psa-1) / Homo sapiens :
        •        Asn-69 in UniProt (Asn-45 in publication)
  • 6 x 5 x 1 x 1 x
    • Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )
    • Site (184) Suggested Structure (19)

        Suggested structure

      • N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ Hex + HexNAc"
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ NeuAc(a2-3)"
      • N-Linked / Hybrid / Structure 225
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
      • N-Linked / Complex / Structure 587
      • N-Linked / Complex / Gal(a1-4)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc(a2-6)"
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
      • N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-6)"
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
      • N-Linked / Complex / Structure 2089
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
      • N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc"
      • N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / Structure 2271

        Reported glycosite

      • Laminin subunit alpha-5 / Homo sapiens :
        •        Asn-2568
      • Epithelial cell adhesion molecule / Homo sapiens :
        •        Asn-74
      • HLA class II histocompatibility antigen, DRB1-13 beta chain / Homo sapiens :
        •        Asn-48
      • Uromodulin / Homo sapiens :
        •        Asn-513
      • Matrilin-4 / Homo sapiens :
        •        Asn-69
      • Oncoprotein-induced transcript 3 protein / Homo sapiens :
        •        Asn-109
      • CD109 antigen / Homo sapiens :
        •        Asn-118
        •        Asn-419
      • Phosphatidylcholine-sterol acyltransferase / Homo sapiens :
        •        Asn-296
      • Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens :
        •        Asn-101
        •        Asn-455
      • Mimecan / Homo sapiens :
        •        Asn-214
      • Alpha-1-acid glycoprotein 2 / Homo sapiens :
        •        Asn-33
      • Prosaposin / Homo sapiens :
        •        Asn-215
        •        Asn-332
      • Integrin alpha-6 / Homo sapiens :
        •        Asn-770
      • Macrophage colony-stimulating factor 1 receptor / Homo sapiens :
        •        Asn-153
      • CD59 glycoprotein / Homo sapiens :
        •        Asn-43
      • HLA class II histocompatibility antigen, DRB1-3 chain / Homo sapiens :
        •        Asn-48
      • Apolipoprotein d / Homo sapiens :
        •        Asn-65
        •        Asn-98
      • Fibromodulin / Homo sapiens :
        •        Asn-166
      • Adipocyte enhancer-binding protein 1 / Homo sapiens :
        •        Asn-528
      • Fibulin-1 / Homo sapiens :
        •        Asn-98
      • Insulin-like growth factor-binding protein 3 / Homo sapiens :
        •        Asn-116
      • Macrosialin / Homo sapiens :
        •        Asn-199
      • Midasin / Homo sapiens :
        •        Asn-602
      • HLA class II histocompatibility antigen, DRB1-14 beta chain / Homo sapiens :
        •        Asn-48
      • Tyrosine-protein kinase receptor UFO / Homo sapiens :
        •        Asn-345
      • Prolactin-inducible protein / Homo sapiens :
        •        Asn-105
      • Galectin-3-binding protein / Homo sapiens :
        •        Asn-69
        •        Asn-398
        •        Asn-551
      • Lumican / Homo sapiens :
        •        Asn-88
        •        Asn-124
        •        Asn-127
        •        Asn-160
      • Alpha-2-macroglobulin / Homo sapiens :
        •        Asn-1424
      • Alpha-1-antitrypsin / Homo sapiens :
        •        Asn-271
      • Ectopic P granules protein 5 homolog / Homo sapiens :
        •        Asn-137
      • Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens :
        •        Asn-69
      • Complement C2 / Homo sapiens :
        •        Asn-333
      • Phospholipid transfer protein / Homo sapiens :
        •        Asn-64
      • Receptor-type tyrosine-protein phosphatase mu / Homo sapiens :
        •        Asn-121
      • Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens :
        •        Asn-539
      • Laminin subunit alpha-2 / Homo sapiens :
        •        Asn-1810
      • Tubulin epsilon chain / Homo sapiens :
        •        Asn-401
      • Haptoglobin / Homo sapiens :
        •        Asn-241
      • Maltase-glucoamylase, intestinal / Homo sapiens :
        •        Asn-135
      • Zinc-alpha-2-glycoprotein / Homo sapiens :
        •        Asn-128
      • Contactin-4 / Homo sapiens :
        •        Asn-858
        •        Asn-929
      • Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens :
        •        Asn-675
      • Ig alpha-1 chain c region / Homo sapiens :
        •        Asn-340
      • HLA class II histocompatibility antigen, DRB1-11 beta chain / Homo sapiens :
        •        Asn-48
      • Lysosome-associated membrane glycoprotein 1 / Homo sapiens :
        •        Asn-84
        •        Asn-249
        •        Asn-261
        •        Asn-322
      • Interleukin-6 receptor subunit beta / Homo sapiens :
        •        Asn-131
      • Gamma-glutamyltranspeptidase 1 / Homo sapiens :
        •        Asn-162
      • Olfactomedin-like protein 3 / Homo sapiens :
        •        Asn-177
        •        Asn-248
      • Alpha-1-acid glycoprotein 1 / Homo sapiens :
        •        Asn-33
        •        Asn-93
      • Fibroleukin / Homo sapiens :
        •        Asn-179
        •        Asn-336
      • Immunoglobulin heavy constant mu / Homo sapiens :
        •        Undefined site
        •        Asn-209
      • Vitronectin / Homo sapiens :
        •        Asn-86
        •        Asn-169
      • Attractin / Homo sapiens :
        •        Asn-383
      • Complement C1q subcomponent subunit A / Homo sapiens :
        •        Asn-146
      • Cholinesterase / Homo sapiens :
        •        Asn-509
      • Homeobox protein Hox-B3 / Homo sapiens :
        •        Asn-223
      • Decorin / Homo sapiens :
        •        Asn-262
        •        Asn-303
      • Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens :
        •        Asn-294
      • Thrombospondin-2 / Homo sapiens :
        •        Asn-330
      • Cadherin-related family member 2 / Homo sapiens :
        •        Asn-300
      • Fibronectin / Homo sapiens :
        •        Asn-7
        •        Asn-430
        •        Asn-528
        •        Asn-1038
      • Sortilin-related receptor / Homo sapiens :
        •        Asn-1068
      • Receptor-type tyrosine-protein phosphatase C / Homo sapiens :
        •        Asn-234
        •        Asn-335
      • Membrane primary amine oxidase / Homo sapiens :
        •        Asn-592
        •        Asn-618
      • Thrombospondin-3 / Homo sapiens :
        •        Asn-407
      • Endothelial cell-selective adhesion molecule / Homo sapiens :
        •        Asn-213
      • CD97 antigen / Homo sapiens :
        •        Asn-453
      • Clusterin / Homo sapiens :
        •        Asn-86
        •        Asn-103
      • Leucine-rich alpha-2-glycoprotein / Homo sapiens :
        •        Asn-325
      • Plasma kallikrein / Homo sapiens :
        •        Asn-164
      • Tenascin / Homo sapiens :
        •        Asn-166
        •        Asn-1392
        •        Asn-1485
        •        Asn-1809
      • Lactotransferrin / Homo sapiens :
        •        Asn-497
      • Beta-2-glycoprotein 1 / Homo sapiens :
        •        Asn-162
      • Hypoxia up-regulated protein 1 / Homo sapiens :
        •        Asn-827
        •        Asn-862
      • Complement c1r subcomponent / Homo sapiens :
        •        Asn-122
      • Cation-independent mannose-6-phosphate receptor / Homo sapiens :
        •        Asn-626
      • Epidermal growth factor receptor / Homo sapiens :
        •        Asn-816
      • Prostaglandin F2 receptor negative regulator / Homo sapiens :
        •        Asn-286
        •        Asn-300
        •        Asn-413
      • Laminin subunit beta-1 / Homo sapiens :
        •        Asn-677
        •        Asn-1279
        •        Asn-1336
      • Hemopexin / Homo sapiens :
        •        Asn-187
      • Lysosome-associated membrane glycoprotein 2 / Homo sapiens :
        •        Asn-32
        •        Asn-49
        •        Asn-58
        •        Asn-101
        •        Asn-253
        •        Asn-257
        •        Asn-275
        •        Asn-356
      • Leptin receptor / Homo sapiens :
        •        Asn-624
      • CD166 antigen / Homo sapiens :
        •        Asn-265
        •        Asn-306
        •        Asn-361
        •        Asn-480
      • Metal transporter CNNM4 / Homo sapiens :
        •        Asn-127
      • Inactive tyrosine-protein kinase 7 / Homo sapiens :
        •        Asn-116
        •        Asn-405
      • Prostaglandin-h2 d-isomerase / Homo sapiens :
        •        Asn-51
        •        Asn-78
      • Extracellular matrix protein 1 / Homo sapiens :
        •        Asn-353
      • Adhesion G-protein coupled receptor D1 / Homo sapiens :
        •        Asn-394
      • Von willebrand factor / Homo sapiens :
        •        Asn-2223
      • Collagen alpha-2(VI) chain / Homo sapiens :
        •        Asn-785
      • Complement factor h / Homo sapiens :
        •        Asn-882
        •        Asn-911
      • Thrombospondin-1 / Homo sapiens :
        •        Asn-248
        •        Asn-360
        •        Asn-1067
      • Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens :
        •        Asn-430
      • Catalase / Homo sapiens :
        •        Asn-481
      • Target of Nesh-SH3 / Homo sapiens :
        •        Asn-313
      • Biotinidase / Homo sapiens :
        •        Asn-150
      • Desmoglein-2 / Homo sapiens :
        •        Asn-462
      • Biglycan / Homo sapiens :
        •        Asn-270
        •        Asn-311
      • Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens :
        •        Asn-729
        •        Asn-1575
        •        Asn-1825
        •        Asn-2942
        •        Asn-3662
      • Ecto-ADP-ribosyltransferase 4 / Homo sapiens :
        •        Asn-178
      • Apolipoprotein f / Homo sapiens :
        •        Asn-118
      • Extracellular serine/threonine protein kinase FAM20C / Homo sapiens :
        •        Asn-335
        •        Asn-470
      • Periostin / Homo sapiens :
        •        Asn-599
      • Pantetheinase / Homo sapiens :
        •        Asn-130
      • Collagen alpha-3(VI) chain / Homo sapiens :
        •        Asn-2677
      • Laminin subunit alpha-4 / Homo sapiens :
        •        Asn-531
        •        Asn-742
      • C-type mannose receptor 2 / Homo sapiens :
        •        Asn-492
      • Dipeptidyl peptidase 1 / Homo sapiens :
        •        Asn-276
      • Probable lysosomal cobalamin transporter / Homo sapiens :
        •        Asn-78
      • 4F2 cell-surface antigen heavy chain / Homo sapiens :
        •        Asn-365
      • G-protein coupled receptor 126 / Homo sapiens :
        •        Asn-504
      • Carboxypeptidase D / Homo sapiens :
        •        Asn-522
      • Adhesion G protein-coupled receptor L4 / Homo sapiens :
        •        Asn-249
      • Interferon alpha/beta receptor 1 / Homo sapiens :
        •        Asn-254
      • Integrin alpha-5 / Homo sapiens :
        •        Asn-771
      • Plexin-B2 / Homo sapiens :
        •        Asn-1099
      • Signal transducer CD24 / Homo sapiens :
        •        Asn-52
      • Ig alpha-2 chain c region / Homo sapiens :
        •        Undefined site
        •        Asn-205
      • Endothelin-converting enzyme 1 / Homo sapiens :
        •        Asn-187
      • Ceruloplasmin / Homo sapiens :
        •        Asn-138
        •        Asn-762
      • Asporin / Homo sapiens :
        •        Asn-282
      • Kininogen-1 / Homo sapiens :
        •        Asn-205
        •        Asn-294
      • Laminin subunit gamma-1 / Homo sapiens :
        •        Asn-1223
        •        Asn-1241
      • Insulin receptor / Homo sapiens :
        •        Asn-445

Composition mass

Average mass : 2444.2456 Da

Monoisotopic mass : 2442.8777 Da

References (29)

Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018)
Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang
Pubmed : 29671580   DOI : 10.1021/acs.analchem.8b01051
Status : Unreviewed

Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018)
Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang
Pubmed : 29741879   DOI : 10.1021/acs.analchem.8b01137
Status : Unreviewed

Distinct urinary glycoprotein signatures in prostate cancer patients (2018)
Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano
Pubmed : 30237853   DOI : 10.18632/oncotarget.26005
Status : Unreviewed

Large-scale intact glycopeptide identification by Mascot database search (2018)
Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede
Pubmed : 29391424   DOI : 10.1038/s41598-018-20331-2
Status : Unreviewed

Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014)
Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P
Pubmed : 24766575   DOI : 10.1021/pr500238v
Status : Reviewed

In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014)
Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.
Pubmed : 25374123   DOI : 10.1007/s00216-014-8226-5
Status : Reviewed

Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014)
Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.
Pubmed : 24884609   DOI : 10.1021/pr500394z
Status : Reviewed

Site-specific N-glycosylation analysis of human immunoglobulin E. (2014)
Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M
Pubmed : 24308486   DOI : 10.1021/pr400714w
Status : Reviewed

Glycan analysis of Prostate Specific Antigen (PSA) directly from the intact glycoprotein by HR-ESI/TOF-MS (2014)
Behnken HN1, Ruthenbeck A, Schulz JM, Meyer B.
Pubmed : 24393138   DOI : 10.1021/pr400999y
Status : Reviewed

Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014)
Song E, Mayampurath A, Yu CY, Tang H, Mechref Y
Pubmed : 25327667   DOI : 10.1021/pr500575r
Status : Reviewed

Determination of site-specific glycan heterogeneity on glycoproteins (2012)
Kolarich D1, Jensen PH, Altmann F, Packer NH.
Pubmed : 22678432   DOI : 10.1038/nprot.2012.062
Status : Reviewed

Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004)
Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P
Pubmed : 14769026   DOI : 10.1021/bi035278t
Status : Reviewed

N-glycan structures of pigeon IgG: a major serum glycoprotein containing Galalpha1-4 Gal termini.. (2003)
Suzuki N, Khoo KH, Chen CM, Chen HC, Lee YC
Pubmed : 12966096   DOI : 10.1074/jbc.M307132200
Status : Reviewed

Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000)
Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A
Pubmed : 10867010   DOI : 10.1074/jbc.M004298200
Status : Reviewed

Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000)
Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R
Pubmed : 10704524  
Status : Reviewed

Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000)
Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A
Pubmed : 10704528  
Status : Reviewed

Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000)
Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A
Pubmed : 10713085  
Status : Reviewed

Characterization of human vascular endothelial cadherin glycans. (1999)
Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H
Pubmed : 10460833  
Status : Reviewed

Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997)
Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P
Pubmed : 9118998  
Status : Reviewed

Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997)
Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W
Pubmed : 9061366  
Status : Reviewed

Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996)
Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D
Pubmed : 8969451  
Status : Reviewed

Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996)
Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG
Pubmed : 8942648   DOI : 10.1021/bi961075b
Status : Reviewed

Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995)
Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K
Pubmed : 7620335  
Status : Reviewed

Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994)
Sutton C, O'Neill J, Cottrell J
Pubmed : 8053566  
Status : Reviewed

Structure determination by 1H NMR spectroscopy of (sulfated) sialylated N-linked carbohydrate chains released from porcine thyroglobulin by peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase-F. (1991)
de Waard P, Koorevaar A, Kamerling J, Vliegenthart J
Pubmed : 1999416  
Status : Reviewed

Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990)
Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S
Pubmed : 2298213  
Status : Reviewed

The structure of the asparagine-linked sugar chains of bovine brain ribonuclease. (1990)
Katoh H, Ohgi K, Irie M, Endo T, Kobata A
Pubmed : 2331705  
Status : Reviewed

Carbohydrate structures of a human tissue plasminogen activator variant expressed in recombinant Chinese hamster ovary cells. (1990)
Nimtz M, Noll G, Pques E, Conradt H
Pubmed : 2226797  
Status : Reviewed

Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989)
Pfeiffer G, Schmidt M, Strube K, Geyer R
Pubmed : 2513186  
Status : Reviewed

GlyConnect Creative Commons License

Supported by SIB ExPASy