GlyConnect

Export CSV

taxonomy (2) protein (13) source (17) structure (18) composition (1) disease (10) reference (15) site (15) peptide (6)

Taxonomy

Homo sapiens (Human)
Collocalia sp (Glossy swiftlet)

Protein

Source

Reported structure

Composition

Hex:3 HexNAc:3 NeuAc:1 (avg mass : 1405.2854 )

Disease

Reference

Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
Novel O-linked sialoglycan structures in human urinary glycoproteins (2020 - Adam Pap, Ervin Tasnadi, Katalin F. Medzihradszky, Zsuzsanna Darula ) / Status : Reviewed
A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
Structures of monosialyl oligosaccharides isolated from the respiratory mucins of a non-secretor (O, Lea+b-) patient suffering from chronic bronchitis. Characterization of a novel type of mucin carbohydrate core structure. (1994 - van Halbeek H, Strang A, Lhermitte M, Rahmoune H, Lamblin G, Roussel P) / Status : Reviewed
Isolation and structural characterization of novel sialylated oligosaccharide-alditols from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1993 - Klein A, Carnoy C, Lamblin G, Roussel P, van Kuik J, Vliegenthart J) / Status : Reviewed
1H and 13C-NMR assignments for sialylated oligosaccharide-alditols related to mucins. Study of thirteen components from hen ovomucin and swallow nest mucin. (1992 - Strecker G, Wieruszeski J, Cuvillier O, Michalski J, Montreuil J) / Status : Reviewed
Structures of acidic O-linked polylactosaminoglycans on human skim milk mucins. (1990 - Hanisch F, Peter-Katalinic J, Egge H, Dabrowski U, Uhlenbruck G) / Status : Reviewed
Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
Structure of the monosialyl oligosaccharides derived from salivary gland mucin glycoproteins of the Chinese swiftlet (genus Collocalia). Characterization of novel types of extended core structure, Gal beta(1----3)[GlcNAc beta(1----6)] GalNAc alpha(1----3)GalNAc(-ol), and of chain termination, [Gal a (1987 - Wieruszeski J, Michalski J, Montreuil J, Strecker G, Peter-Katalinic J, Egge H, van Halbeek H, Mutsaers J, Vliegenthart J) / Status : Reviewed
Investigations on the oligosaccharide units of an A myeloma globulin. (1968 - Dawson G, Clamp JR) / Status : Reviewed

Reported glycosite

Hepatitis a virus cellular receptor 2 / Homo sapiens
- Thr-145
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Ser-105
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
- Thr-675
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
Prostaglandin-h2 d-isomerase / Homo sapiens
- Thr-73
- Thr-80
Unspecified mucin / Homo sapiens
- Undefined site
Uromodulin / Homo sapiens
- Thr-504
Mucin / Collocalia sp
- Undefined site

Mass spectrometry observed peptide

SVVAPATDGGLNLTSTFLR (19aa)
- P41222 Thr-73 Prostaglandin-h2 d-isomerase / Homo sapiens
SVVAPATDGGLNLTSTFLRKNQCETR (26aa)
- P41222 Thr-80 Prostaglandin-h2 d-isomerase / Homo sapiens
HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR (38aa)
- P01876 Ser-105 Immunoglobulin heavy constant alpha 1 / Homo sapiens
DFTAAFPR (8aa)
- Q8TDQ0 Thr-145 Hepatitis a virus cellular receptor 2 / Homo sapiens
FALLMTNCYATPSSNATDPLKYFIIQDR (28aa)
- P07911 Thr-504 Uromodulin / Homo sapiens
VVPDSTPSWANPSPTPVISMLAQGSQVLESTPPPHVMR (38aa)
- P19823 Thr-675 Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens

- N-Linked / Complex (avg mass : 1405.2854)
- N-Linked / Complex (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 2 (avg mass : 1405.2854)
- O-Linked / Core 5 (avg mass : 1405.2854)
- O-Linked / Undefined core (avg mass : 1405.2854)

- Hex:3 HexNAc:3 NeuAc:1 / O-Linked (avg mass : 1405.2854)