GlyConnect

taxonomy (5) protein (27) source (6) structure (7) composition (1) disease (4) reference (11) site (38) peptide (23)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:5 HexNAc:5 NeuAc:2 (avg mass : 2427.2181 )

Disease

Reference

Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
Structural differences between complex-type Asn-linked glycan chains of glycoproteins in rat hepatocytes and Zajdela hepatoma cells. (1995 - Goulut-Chassaing C, Bourrillon R) / Status : Reviewed
Structure determination of the disialylated poly-(N-acetyllactosamine)-containing O-linked carbohydrate chains of equine chorionic gonadotropin. (1994 - Hokke C, Roosenboom M, Thomas-Oates J, Kamerling J, Vliegenthart J) / Status : Reviewed
Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. (1991 - Weisshaar G, Hiyama J, Renwick A, Nimtz M) / Status : Reviewed
Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
Structure of the carbohydrate units of IgA1 immunoglobulin. I. Composition, glycopeptide isolation, and structure of the asparagine-linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed

Reported glycosite

Alpha-1-antitrypsin / Homo sapiens
- Asn-271
Apolipoprotein d / Homo sapiens
- Asn-65
Beta-2-glycoprotein 1 / Homo sapiens
- Asn-162
Biglycan / Homo sapiens
- Asn-311
Decorin / Homo sapiens
- Asn-262
Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Asn-378
Fibromodulin / Homo sapiens
- Asn-166
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Asn-76
- Asn-102
Haptoglobin / Homo sapiens
- Asn-241
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Asn-144
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Asn-131
Immunoglobulin heavy constant delta / Homo sapiens
- Asn-367
Immunoglobulin heavy constant mu / Homo sapiens
- Asn-46
- Asn-209
Kininogen-1 / Homo sapiens
- Asn-294
Lumican / Homo sapiens
- Asn-127
Lutropin beta chain / Homo sapiens
- Asn-50
Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Asn-49
- Asn-58
- Asn-275
Polymeric immunoglobulin receptor / Homo sapiens
- Asn-469
Prolactin-inducible protein / Homo sapiens
- Asn-105
Prominin-1 / Homo sapiens
- Asn-274
Prostaglandin-h2 d-isomerase / Homo sapiens
- Asn-78
Prostate-specific antigen (psa-1) / Homo sapiens
- Asn-69
Uromodulin / Homo sapiens
- Asn-232
- Asn-513
Choriogonadotropin beta chain / Equus caballus
- Undefined site
Uncharacterized protein from Zajdela Hepatocarcinoma Cell / Rattus norvegicus
- Undefined site
Acetylcholine receptor protein / Torpedo californica
- Undefined site
Knob protein gp70 / Friend murine leukemia virus
- Asn-334 and/or Asn-341
- Asn-341 and/or Asn-334
- Asn-266
- Asn-302
- Asn-374
- Asn-410

Mass spectrometry observed peptide

WQMNFTVR (8aa)
- P13473 Asn-49
YETTNK (6aa)
- P13473 Asn-58
CIQANYSIMENGK (13aa)
- P05090 Asn-65
SVVAPATDGGLNLTSTFLR (19aa)
- P41222 Asn-78
TFYWDFYTNR (10aa)
- P12273 Asn-105
LHINHNNLTESVGPLPK (17aa)
- P51884 Asn-127
KLHINHNNLTESVGPLPK (18aa)
- P51884 Asn-127
LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- P01877 Asn-131
LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- P01876 Asn-144
VYKPSAGNNSLYR (13aa)
- P02749 Asn-162
IYIDHNNITR (10aa)
- Q06828 Asn-166
GITFQQNASSMCVPDQDTAIR (21aa)
- P01871 Asn-209
CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- P07911 Asn-232
VVLHPNYSQVDIGLIK (16aa)
- P00738 Asn-241
IGISFNSISAVDNGSIANTPHIR (23aa)
- P07585 Asn-262
YIGNATAIFFIPDEGK (16aa)
- P01009 Asn-271
EALENMNSTLK (11aa)
- O43490 Asn-274
LNSSTIK (7aa)
- P13473 Asn-275
LNAENNATFYFK (12aa)
- P01042 Asn-294
LQVVYLHSNNITK (13aa)
- P21810 Asn-311
TLLNASR (7aa)
- P01880 Asn-367
TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- Q9Y5L3 Asn-378
VPGNVTAVIGETIK (14aa)
- P01833 Asn-469
FALLMTNCYATPSSNATDPLK (21aa)
- P07911 Asn-513

- N-Linked / Complex (avg mass : 2427.2181)
- N-Linked / Complex (avg mass : 2427.2181)
- N-Linked / Complex (avg mass : 2427.2181)
- N-Linked / Complex (avg mass : 2427.2181)
- O-Linked / Core 2 (avg mass : 2427.2181)
- N-Linked / Complex (avg mass : 2427.2181)
- N-Linked / Complex (avg mass : 2427.2181)

- Hex:5 HexNAc:5 NeuAc:2 / N-Linked (avg mass : 2427.2181)