Hex:5 HexNAc:5 NeuAc:2

Taxonomy

• Homo sapiens (Human)
• Canis lupus familiaris (Dog)
• Equus caballus (Domestic horse)
• Felis catus (Cat)
• Rattus norvegicus (Norway rat)
• Torpedo californica (Pacific electric ray)
• Friend murine leukemia virus (F-mulv)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-S1-casein / Homo sapiens    P47710
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein D / Homo sapiens    P05090
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Biglycan / Homo sapiens    P21810
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Decorin / Homo sapiens    P07585
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Fibromodulin / Homo sapiens    Q06828
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Haptoglobin / Homo sapiens    P00738
• Hepatitis a virus cellular receptor 2 / Homo sapiens    Q8TDQ0
• Immunoglobulin alpha (non secretory) / Homo sapiens    P01877    P01876
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens    P0DOX2
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin gamma-1 heavy chain / Homo sapiens    P0DOX5
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens    P01877
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens    P01880
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens    P01859
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Kininogen-1 / Homo sapiens    P01042
• Lactotransferrin / Homo sapiens    P02788
• Lumican / Homo sapiens    P51884
• Lutropin beta chain / Homo sapiens    P01229
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Prominin-1 / Homo sapiens    O43490
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Uromodulin / Homo sapiens    P07911
• Immunoglobulin gamma / Canis lupus familiaris    
• Choriogonadotropin beta chain / Equus caballus    P08751
• Immunoglobulin gamma / Felis catus    
• Uncharacterized protein from Liver / Rattus norvegicus    
• Acetylcholine receptor protein / Torpedo californica    P02710    P02714    P02712    P02718
• Envelope glycoprotein / Friend murine leukemia virus    P03395
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Colon (UBERON_0001155)  
• Electric Organ (UBERON_0006869)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Pituitary Gland (UBERON_0000007)  
• Seminal Fluid (UBERON_0006530)  
• Urine (UBERON_0001088)  
• Eveline (CVCL_A1LI)  
• HEK293 (CVCL_0045)  
• LS174T (CVCL_1384)  

Reported structure

• N-Linked / Complex / Structure 432
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 9466
• N-Linked / Complex / Structure 9596
• N-Linked / Complex / Structure 10005
• N-Linked / Complex / Structure 10185
• N-Linked / Complex / Structure 10239
• N-Linked / Complex / Structure 10978
• O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Structure 9434

Composition

• Hex:5 HexNAc:5 NeuAc:2 (avg mass : 2427.2181 )

Disease

• Cancer, breast (DOID:1612)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Gastritis (DOID:4029)
• Myeloma, Multiple (DOID:9538)
• Prostate cancer (DOID:10283)
• Systemic lupus erythematosus (DOID:9074)
• Zajdela Hepatocarcinoma (DOID:686)

Reference

• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Novel O-linked sialoglycan structures in human urinary glycoproteins (2020 - Adam Pap, Ervin Tasnadi, Katalin F. Medzihradszky, Zsuzsanna Darula ) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
• Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
• Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
• The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
• Structural differences between complex-type Asn-linked glycan chains of glycoproteins in rat hepatocytes and Zajdela hepatoma cells. (1995 - Goulut-Chassaing C, Bourrillon R) / Status : Reviewed
• Structure determination of the disialylated poly-(N-acetyllactosamine)-containing O-linked carbohydrate chains of equine chorionic gonadotropin. (1994 - Hokke C, Roosenboom M, Thomas-Oates J, Kamerling J, Vliegenthart J) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. (1991 - Weisshaar G, Hiyama J, Renwick A, Nimtz M) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
• Structure of the carbohydrate units of IgA1 immunoglobulin. I. Composition, glycopeptide isolation, and structure of the asparagine-linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed

Reported glycosite

• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-271
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein D / Homo sapiens
  •        Asn-65
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
• Biglycan / Homo sapiens
  •        Asn-311
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Decorin / Homo sapiens
  •        Asn-262
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-378
• Fibromodulin / Homo sapiens
  •        Asn-166
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Asn-76
  •        Asn-102
• Haptoglobin / Homo sapiens
  •        Asn-241
• Hepatitis a virus cellular receptor 2 / Homo sapiens
  •        Thr-145
• Immunoglobulin alpha (non secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-1 heavy chain / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Asn-144
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Undefined site
  •        Asn-131
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
  •        Asn-367
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-209
• Kininogen-1 / Homo sapiens
  •        Asn-294
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Lumican / Homo sapiens
  •        Asn-127
• Lutropin beta chain / Homo sapiens
  •        Asn-50
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-49
  •        Asn-58
  •        Asn-275
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-186
  •        Asn-469
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prominin-1 / Homo sapiens
  •        Asn-274
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Uromodulin / Homo sapiens
  •        Asn-232
  •        Asn-513
• Immunoglobulin gamma / Canis lupus familiaris
  •        Undefined site
• Choriogonadotropin beta chain / Equus caballus
  •        Undefined site
• Immunoglobulin gamma / Felis catus
  •        Undefined site
• Uncharacterized protein from Liver / Rattus norvegicus
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-334 and/or Asn-341
  •        Asn-341 and/or Asn-334
  •        Asn-266
  •        Asn-302
  •        Asn-374
  •        Asn-410
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122

Mass spectrometry observed peptide

• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• AVCGGVLVHPQWVLTAAHCIRNK (23aa)
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• KYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKC (34aa)
  •    P01833    Asn-83     Polymeric immunoglobulin receptor / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •    P01877    Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• PALEDLLLGSEANLTCTLTGLR (22aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• DFTAAFPR (8aa)
  •    Q8TDQ0    Thr-145     Hepatitis a virus cellular receptor 2 / Homo sapiens
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• EALENMNSTLK (11aa)
  •    O43490    Asn-274     Prominin-1 / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• LQVVYLHSNNITK (13aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• TLLNASR (7aa)
  •    P01880    Asn-367     Immunoglobulin heavy constant delta / Homo sapiens
• TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
  •    Q9Y5L3    Asn-378     Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• KVPGNVTAVLGETLKV (16aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens