taxonomy (8)
protein (51)
source (14)
structure (15)
composition (1)
disease (9)
reference (25)
site (66)
peptide (36)
- Homo sapiens (Human)
- Canis lupus familiaris (Dog)
- Equus caballus (Domestic horse)
- Felis catus (Cat)
- Rattus norvegicus (Norway rat)
- Torpedo californica (Pacific electric ray)
- Friend murine leukemia virus (F-mulv)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein D / Homo sapiens P05090
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Biglycan / Homo sapiens P21810
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Decorin / Homo sapiens P07585
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Fibromodulin / Homo sapiens Q06828
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens P01215
- Haptoglobin / Homo sapiens P00738
- Hepatitis a virus cellular receptor 2 / Homo sapiens Q8TDQ0
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens P01880
- Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens P01854
- Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens P01854
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Kininogen-1 / Homo sapiens P01042
- Lactotransferrin / Homo sapiens P02788
- Lumican / Homo sapiens P51884
- Lutropin beta chain / Homo sapiens P01229
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prominin-1 / Homo sapiens O43490
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Uromodulin / Homo sapiens P07911
- Immunoglobulin gamma / Canis lupus familiaris
- Choriogonadotropin beta chain / Equus caballus P08751
- Immunoglobulin gamma / Felis catus
- Uncharacterized protein from Liver / Rattus norvegicus
- Acetylcholine receptor protein / Torpedo californica P02718 P02712 P02710 P02714
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Electric Organ (UBERON_0006869)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Pituitary Gland (UBERON_0000007)
- Seminal Fluid (UBERON_0006530)
- Urine (UBERON_0001088)
- C10 (CVCL_5245)
- Eveline (CVCL_A1LI)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
Source
- N-Linked / Complex / Structure 432
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9466
- N-Linked / Complex / Structure 9596
- N-Linked / Complex / Structure 10005
- N-Linked / Complex / Structure 10185
- N-Linked / Complex / Structure 10239
- N-Linked / Complex / Structure 10978
- O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 9434
- O-Linked / Core 2 / Structure 11078
Reported structure
- Hex:5 HexNAc:5 NeuAc:2 (avg mass : 2427.2181 )
Composition
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Multiple myeloma (DOID:9538)
- Prostate cancer (DOID:10283)
- Systemic lupus erythematosus (DOID:9074)
- Zajdela Hepatocarcinoma (DOID:686)
Disease
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Novel O-linked sialoglycan structures in human urinary glycoproteins (2020 - Adam Pap, Ervin Tasnadi, Katalin F. Medzihradszky, Zsuzsanna Darula ) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Structural differences between complex-type Asn-linked glycan chains of glycoproteins in rat hepatocytes and Zajdela hepatoma cells. (1995 - Goulut-Chassaing C, Bourrillon R) / Status : Reviewed
- Structure determination of the disialylated poly-(N-acetyllactosamine)-containing O-linked carbohydrate chains of equine chorionic gonadotropin. (1994 - Hokke C, Roosenboom M, Thomas-Oates J, Kamerling J, Vliegenthart J) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. (1991 - Weisshaar G, Hiyama J, Renwick A, Nimtz M) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Structure of the carbohydrate units of IgA1 immunoglobulin. I. Composition, glycopeptide isolation, and structure of the asparagine-linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed
Reference
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein D / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Decorin / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Fibromodulin / Homo sapiens
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Haptoglobin / Homo sapiens
- Hepatitis a virus cellular receptor 2 / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Asn-144
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Asn-131
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-367
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant mu / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Lumican / Homo sapiens
- Lutropin beta chain / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prominin-1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Uromodulin / Homo sapiens
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Choriogonadotropin beta chain / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- WQMNFTVR (8aa)
- YETTNK (6aa)
- CIQANYSIMENGK (13aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKC (34aa)
- TFYWDFYTNR (10aa)
- TQSLLIVNNATNVVIK (16aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- DFTAAFPR (8aa)
- VYKPSAGNNSLYR (13aa)
- IYIDHNNITR (10aa)
- KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- VVLHPNYSQVDIGLIK (16aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- YIGNATAIFFIPDEGK (16aa)
- EALENMNSTLK (11aa)
- LNSSTIK (7aa)
- LNAENNATFYFK (12aa)
- LQVVYLHSNNITK (13aa)
- TLLNASR (7aa)
- TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- VPGNVTAVIGETIK (14aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- FALLMTNCYATPSSNATDPLK (21aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2427.2181)
- Blood Serum (UBERON_0001977)
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2427.2181)
- Electric Organ (UBERON_0006869)
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 2427.2181)
- Eveline (CVCL_A1LI)
- Envelope glycoprotein / Friend murine leukemia virus
-
- N-Linked / Complex
(avg mass : 2427.2181)
- NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. (1991 - Weisshaar G, Hiyama J, Renwick A, Nimtz M) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Lutropin beta chain / Homo sapiens
- Envelope glycoprotein / Friend murine leukemia virus
-
- N-Linked / Complex
(avg mass : 2427.2181)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Structure of the carbohydrate units of IgA1 immunoglobulin. I. Composition, glycopeptide isolation, and structure of the asparagine-linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2427.2181)
- Liver (UBERON_0002107)
- Zajdela Hepatocarcinoma (DOID:686)
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2427.2181)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKC (34aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
-
- N-Linked / Complex
(avg mass : 2427.2181)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2427.2181)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
-
- N-Linked / Complex
(avg mass : 2427.2181)
- Blood Serum (UBERON_0001977)
- Control/Healthy
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2427.2181)
- Blood Serum (UBERON_0001977)
- Control/Healthy
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2427.2181)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
-
- O-Linked / Core 2
(avg mass : 2427.2181)
- Blood Serum (UBERON_0001977)
-
Choriogonadotropin beta chain / Equus caballus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 2427.2181)
- Urine (UBERON_0001088)
- Hepatitis a virus cellular receptor 2 / Homo sapiens
- DFTAAFPR (8aa)
-
- O-Linked / Core 2
(avg mass : 2427.2181)
- C10 (CVCL_5245)
- Colon adenocarcinoma (DOID:234)
-
- Hex:5 HexNAc:5 NeuAc:2 / N-Linked
(avg mass : 2427.2181)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- LS174T (CVCL_1384)
- N-Linked / Complex / Structure 432
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9466
- N-Linked / Complex / Structure 9596
- N-Linked / Complex / Structure 10005
- N-Linked / Complex / Structure 10185
- N-Linked / Complex / Structure 10239
- N-Linked / Complex / Structure 10978
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Alpha-1-antitrypsin / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Decorin / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Fibromodulin / Homo sapiens
- Haptoglobin / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant delta / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prominin-1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Uromodulin / Homo sapiens
- WQMNFTVR (8aa)
- YETTNK (6aa)
- CIQANYSIMENGK (13aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- TFYWDFYTNR (10aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- VYKPSAGNNSLYR (13aa)
- IYIDHNNITR (10aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- VVLHPNYSQVDIGLIK (16aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- YIGNATAIFFIPDEGK (16aa)
- EALENMNSTLK (11aa)
- LNSSTIK (7aa)
- LNAENNATFYFK (12aa)
- LQVVYLHSNNITK (13aa)
- TLLNASR (7aa)
- TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- VPGNVTAVIGETIK (14aa)
- FALLMTNCYATPSSNATDPLK (21aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:5 NeuAc:2 / N-Linked
(avg mass : 2427.2181)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 2427.2181)
Source
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / Core 2
(avg mass : 2427.2181)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 2427.2181)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2427.2181)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2427.2181)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2427.2181)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2427.2181)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2427.2181)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2427.2181)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2427.2181)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2427.2181)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2427.2181)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2427.2181)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2427.2181)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2427.2181)