taxonomy (12)
protein (100)
source (49)
structure (29)
composition (1)
disease (13)
reference (61)
site (132)
peptide (77)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Desmodus rotundus (Common vampire bat)
- Mesocricetus auratus (Golden hamster)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Columba livia (Domestic pigeon)
- Friend mink cell focus-forming virus
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Marburg virus (strain musoke)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alkaline phosphatase, intestinal / Homo sapiens P09923
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-S1-casein / Homo sapiens P47710
- Aminopeptidase n / Homo sapiens P15144
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein D / Homo sapiens P05090
- Asporin / Homo sapiens Q9BXN1
- Attractin / Homo sapiens O75882
- Beta-secretase-fc fusion protein / Homo sapiens P56817
- C4b-binding protein alpha chain / Homo sapiens P04003
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Carnitine O-acetyltransferase / Homo sapiens P43155
- CD166 antigen / Homo sapiens Q13740
- CD44 antigen / Homo sapiens P16070
- CD59 glycoprotein / Homo sapiens P13987
- Chordin-like protein 2 / Homo sapiens Q6WN34
- Clusterin / Homo sapiens P10909
- Complement c3 / Homo sapiens P01024
- Decorin / Homo sapiens P07585
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Erythropoietin / Homo sapiens P01588
- Fibrillin-1 / Homo sapiens P35555
- Fibronectin / Homo sapiens P02751
- Galectin-3-binding protein / Homo sapiens Q08380
- Glucosylceramidase / Homo sapiens P04062
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- Heparin cofactor 2 / Homo sapiens P05546
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Inositol monophosphatase 3 / Homo sapiens Q9NX62
- Integrin alpha-5/beta-1 / Homo sapiens P05556 P08648
- Integrin beta-1 / Homo sapiens P05556
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Intercellular adhesion molecule-3 (CD50) / Homo sapiens P32942
- Interferon gamma / Homo sapiens P01579
- Interleukin-1 receptor accessory protein / Homo sapiens Q9NPH3
- Kininogen-1 / Homo sapiens P01042
- L-selectin / Homo sapiens P14151
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-5 / Homo sapiens O15230
- Laminin subunit beta-1 / Homo sapiens P07942
- Laminin subunit gamma-1 / Homo sapiens P11047
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Lumican / Homo sapiens P51884
- Lymphotoxin-alpha / Homo sapiens P01374
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Macrophage mannose receptor 1 / Homo sapiens P22897
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Myeloperoxidase / Homo sapiens P05164
- Phosphatidylcholine-sterol acyltransferase / Homo sapiens P04180
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prothrombin / Homo sapiens P00734
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens P15941 Q99102
- Secretogranin-3 / Homo sapiens Q8WXD2
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- Sialic acid-binding Ig-like lectin 8 / Homo sapiens Q9NYZ4
- T-cell surface antigen cd2 / Homo sapiens P06729
- T-cell surface glycoprotein CD5 / Homo sapiens P06127
- Tenascin / Homo sapiens P24821
- Tigger transposable element-derived protein 6 / Homo sapiens Q17RP2
- Tissue factor pathway inhibitor / Homo sapiens P10646
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens O00300
- Uncharacterized protein from Pleura / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Vitronectin / Homo sapiens P04004
- Von willebrand factor / Homo sapiens P04275
- VWFA and cache domain-containing protein 1 / Homo sapiens Q5VU97
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Acetylcholinesterase / Bos taurus P23795
- Platelet glycoprotein IV / Bos taurus P26201
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Serotransferrin / Mus musculus Q921I1
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Zona pellucida sperm-binding protein 3 / Sus scrofa P42098
- Zona pellucida sperm-binding proteins 3 and 4 / Sus scrofa P42098 Q07287
- Immunoglobulin gamma / Columba livia
- Envelope glycoprotein / Friend mink cell focus-forming virus
- Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Structural glycoprotein / Marburg virus (strain musoke) P35253
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amnion (UBERON_0000305) FL (CVCL_1905)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) COS-1 (CVCL_0223)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO B8-300 (CVCL_VU03)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) IM4 (CVCL_VT63)
- Ovary (UBERON_0000992) IM4/IV (CVCL_VT64)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/Vh (CVCL_VT65)
- Ovary (UBERON_0000992) IM4/Vm (CVCL_VT66)
- Ovary (UBERON_0000992)
- Placenta (UBERON_0001987)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Urine (UBERON_0001088)
- Zona Pellucida (UBERON_0000086)
- 3Y1-B clone 1 (CVCL_4563)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- Jurkat (CVCL_0065)
- LS174T (CVCL_1384)
- NIH 3T3 (CVCL_0594) Fibroblast (CL_0000057)
- Namalwa (CVCL_0067) B-Lymphocyte (CL_0000236)
- RPMI-1788 (CVCL_2710) B-Lymphocyte (CL_0000236)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Leukocyte (CL_0000738)
- T-Lymphocyte (CL_0000084)
- Microsome (GO_0005792)
Source
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-3)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(a1-3)Gal(b1-4) + 2 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(a1-4)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(?1-4)"
- N-Linked / Complex / Structure 3126
- N-Linked / Complex / Structure 9285
- N-Linked / Complex / Structure 9443
- N-Linked / Complex / Structure 9691
- N-Linked / Complex / Structure 10059
- N-Linked / Complex / Structure 10514
Reported structure
- Hex:7 HexNAc:6 dHex:1 (avg mass : 2518.3251 )
Composition
- Anemia, Aplastic (DOID:12449)
- Cancer, breast (DOID:1612)
- Carcinoma (DOID:305)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- COVID-19 (DOID:0080600)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Leukemia, Myloid, Chronic (DOID:8552)
- Lymphoma, Burkitt (DOID:8584)
- Prostate cancer (DOID:10283)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
Disease
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena DomÃnguez-Vega) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Protein and Site Specificity of Fucosylation in Liver-Secreted Glycoproteins (2014 - Pompach P, Ashline DJ, Brnakova Z, Benicky J, Sanda M, Goldman R.) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
- N-glycan structures of pigeon IgG: a major serum glycoprotein containing Galalpha1-4 Gal termini.. (2003 - Suzuki N, Khoo KH, Chen CM, Chen HC, Lee YC) / Status : Reviewed
- Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50). (2001 - Funatsu O, Sato T, Kotovuori P, Gahmberg CG, Ikekita M, Furukawa K) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Structural analysis of trisialylated biantennary glycans isolated from mouse serum transferrin. Characterization of the sequence Neu5Gc(alpha 2-3)Gal(beta 1-3)[Neu5Gc(alpha 2-6)]GlcNAc(beta 1-2)Man. (2000 - Coddeville B, Regoeczi E, Strecker G, Plancke Y, Spik G) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Localization of neutral N-linked carbohydrate chains in pig zona pellucida glycoprotein ZPC. (1999 - Yonezawa N, Fukui N, Kudo K, Nakano M) / Status : Reviewed
- Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
- Characterization of recombinant human plasma lecithin: cholesterol acyltransferase (LCAT): N-linked carbohydrate structures and catalytic properties. (1998 - Lacko A, Reason A, Nuckolls C, Kudchodkar B, Nair M, Sundarrajan G, Pritchard P, Morris H, Dell A) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Amino acid sequence and carbohydrate structure of a recombinant human tissue factor pathway inhibitor expressed in Chinese hamster ovary cells: one N-and two O-linked carbohydrate chains are located between Kunitz domains 2 and 3 and one N-linked carbohydrate chain is in Kunitz domain 2. (1996 - Nakahara Y, Miyata T, Hamuro T, Funatsu A, Miyagi M, Tsunasawa S, Kato H) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- N-linked sugar chain structure of recombinant human lymphotoxin produced by CHO cells: the functional role of carbohydrate as to its lectin-like character and clearance velocity. (1993 - Fukushima K, Watanabe H, Takeo K, Nomura M, Asahi T, Yamashita K) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Structural analysis of the N-linked carbohydrate chains of the 55-kDa glycoprotein family (PZP3) from porcine zona pellucida. (1992 - Noguchi S, Hatanaka Y, Tobita T, Nakano M) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
- Relationship between sugar chain structure and biological activity of recombinant human erythropoietin produced in Chinese hamster ovary cells. (1989 - Takeuchi M, Inoue N, Strickland T, Kubota M, Wada M, Shimizu R, Hoshi S, Kozutsumi H, Takasaki S, Kobata A) / Status : Reviewed
- Recombinant human erythropoietin produced by Namalwa cells. (1989 - Yanagi H, Yoshima T, Ogawa I, Okamoto M) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
- Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
- The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
- Characterization of the microheterogeneity in glycoproteins by 500-MHz 1H-NMR spectroscopy of glycopeptide preparations. Application to a monofucosylated tetra-antennary glycopeptide fraction from human plasma alpha 1-acid glycoprotein. (1981 - van Halbeek H, Dorland L, Vliegenthart J, Montreuil J, Fournet B, Schmid K) / Status : Reviewed
- Determination of the primary structures of 16 asialo-carbohydrate units derived from human plasma alpha 1-acid glycoprotein by 360-MHZ 1H NMR spectroscopy and permethylation analysis. (1978 - Fournet B, Montreuil J, Strecker G, Dorland L, Haverkamp J, Vliegenthart F, Binette J, Schmid K) / Status : Reviewed
Reference
-
Alkaline phosphatase, intestinal / Homo sapiens
- Undefined site
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
- Asn-103
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Alpha-S1-casein / Homo sapiens
- Aminopeptidase n / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein D / Homo sapiens
- Asporin / Homo sapiens
- Attractin / Homo sapiens
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
- C4b-binding protein alpha chain / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Carnitine O-acetyltransferase / Homo sapiens
- CD166 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
-
CD59 glycoprotein / Homo sapiens
- Undefined site
- Chordin-like protein 2 / Homo sapiens
- Clusterin / Homo sapiens
- Complement c3 / Homo sapiens
- Decorin / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Inositol monophosphatase 3 / Homo sapiens
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
- Integrin beta-1 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
Intercellular adhesion molecule-3 (CD50) / Homo sapiens
- Undefined site
-
Interferon gamma / Homo sapiens
- Undefined site
- Interleukin-1 receptor accessory protein / Homo sapiens
- Kininogen-1 / Homo sapiens
-
L-selectin / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lumican / Homo sapiens
- Lymphotoxin-alpha / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Macrophage mannose receptor 1 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
-
Phosphatidylcholine-sterol acyltransferase / Homo sapiens
- Undefined site
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
- Asn-101
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prothrombin / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Asn-234
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Secretogranin-3 / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
-
T-cell surface antigen cd2 / Homo sapiens
- Undefined site
-
T-cell surface glycoprotein CD5 / Homo sapiens
- Undefined site
- Tenascin / Homo sapiens
- Tigger transposable element-derived protein 6 / Homo sapiens
-
Tissue factor pathway inhibitor / Homo sapiens
- Undefined site
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
-
Uncharacterized protein from Pleura / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
- Vitronectin / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
- VWFA and cache domain-containing protein 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Serotransferrin / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
- Zona pellucida sperm-binding protein 3 / Sus scrofa
-
Zona pellucida sperm-binding proteins 3 and 4 / Sus scrofa
- Undefined site
-
Immunoglobulin gamma / Columba livia
- Undefined site
-
Envelope glycoprotein / Friend mink cell focus-forming virus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- WFSAGLASNSSWLR (14aa)
- AFNSTLPTMAQMEK (14aa)
- YETTNK (6aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RNESTQNCVVAEPEKM (16aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- ENTSDPSIVIAFGR (14aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- KKEDALNETRESETKL (16aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- TCDWIPKPNMSASCK (15aa)
- RSHNRSEEFLIAGKL (15aa)
- TFYWDFYTNR (10aa)
- GQALLVNSSQPWEPLQLHVDK (21aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- NTTYCSK (7aa)
- TQSLLIVNNATNVVIK (16aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- VYSSANNCTFE (11aa)
- GNFSTEGCGCVCEPGWK (17aa)
- NGSLFAFR (8aa)
- TYTYADTPDDFQIHNFSIPEEDTK (24aa)
- SWPAVGNCSSAIR (13aa)
- DFVNASSK (8aa)
- GNITEYQCHQYITK (14aa)
- NPCTSEQNCTSPFSYK (16aa)
- YANITVDYLYNKETK (15aa)
- NSSLQTNK (8aa)
- SPLNTS (6aa)
- KDNTTVTR (8aa)
- GENLN (5aa)
- VASVININPNTTHSTGSCR (19aa)
- QVAIQTFGNQTTIIPAGGAGYK (22aa)
- IININPNK (8aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- EGDNITIK (8aa)
- NGTITDAVDCALDPLSE (17aa)
- ITDIENGSIANIPR (14aa)
- IPNIT (5aa)
- RHIGHANLTFEQLRS (15aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- SCPACPGSNITIR (13aa)
- MFSQNDTR (8aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- GEVFNATR (8aa)
- NATDNISK (8aa)
- VQPFNVTQGK (10aa)
- NNQSLP (6aa)
- NQSLP (5aa)
- TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- NFTENDLLVR (10aa)
- RPGVNLS (7aa)
- DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- LSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNR (36aa)
- DQCIVDDITYNVNDTFHK (18aa)
- AAIPSAIDTNSSK (13aa)
- NVSYAWK (7aa)
- LYQDVNCT (8aa)
- NNTNNWR (7aa)
- VDVVICLSTTVRNDTLQEAK (20aa)
- NATLVNEADK (10aa)
- VVPEGIRMNK (10aa)
- CIEGSYKGPVKMPSQAPTGNFYPQPLLNSSMCLEDSR (37aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- KTAHCNESFYFLCKR (15aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- NISQDLEK (8aa)
- LSDTTSQSNSTAK (13aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- KRNDQLPSNFTPVFYSQLQKN (21aa)
- NASLALSASIGR (12aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Blood Plasma (UBERON_0001969)
- Alpha-1-acid glycoprotein 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Blood Plasma (UBERON_0001969)
- Characterization of the microheterogeneity in glycoproteins by 500-MHz 1H-NMR spectroscopy of glycopeptide preparations. Application to a monofucosylated tetra-antennary glycopeptide fraction from human plasma alpha 1-acid glycoprotein. (1981 - van Halbeek H, Dorland L, Vliegenthart J, Montreuil J, Fournet B, Schmid K) / Status : Reviewed
- Determination of the primary structures of 16 asialo-carbohydrate units derived from human plasma alpha 1-acid glycoprotein by 360-MHZ 1H NMR spectroscopy and permethylation analysis. (1978 - Fournet B, Montreuil J, Strecker G, Dorland L, Haverkamp J, Vliegenthart F, Binette J, Schmid K) / Status : Reviewed
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
- Asn-103
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Blood Plasma (UBERON_0001969)
- Alpha-1-acid glycoprotein 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- CHO (CVCL_0213)
- HEK293T (CVCL_0063)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena DomÃnguez-Vega) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Immunoglobulin epsilon chain c region / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
-
L-selectin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Amnion (UBERON_0000305) FL (CVCL_1905)
- Blood Plasma (UBERON_0001969)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) COS-1 (CVCL_0223)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO B8-300 (CVCL_VU03)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) IM4 (CVCL_VT63)
- Ovary (UBERON_0000992) IM4/IV (CVCL_VT64)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/Vh (CVCL_VT65)
- Ovary (UBERON_0000992) IM4/Vm (CVCL_VT66)
- Ovary (UBERON_0000992)
- Placenta (UBERON_0001987)
- Spleen (UBERON_0002106)
- Urine (UBERON_0001088)
- Zona Pellucida (UBERON_0000086)
- 3Y1-B clone 1 (CVCL_4563)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- NIH 3T3 (CVCL_0594) Fibroblast (CL_0000057)
- Namalwa (CVCL_0067) B-Lymphocyte (CL_0000236)
- Anemia, Aplastic (DOID:12449)
- Carcinoma, Hepatocellular (DOID:684)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Lymphoma, Burkitt (DOID:8584)
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
- Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
- Structural analysis of trisialylated biantennary glycans isolated from mouse serum transferrin. Characterization of the sequence Neu5Gc(alpha 2-3)Gal(beta 1-3)[Neu5Gc(alpha 2-6)]GlcNAc(beta 1-2)Man. (2000 - Coddeville B, Regoeczi E, Strecker G, Plancke Y, Spik G) / Status : Reviewed
- Localization of neutral N-linked carbohydrate chains in pig zona pellucida glycoprotein ZPC. (1999 - Yonezawa N, Fukui N, Kudo K, Nakano M) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Characterization of recombinant human plasma lecithin: cholesterol acyltransferase (LCAT): N-linked carbohydrate structures and catalytic properties. (1998 - Lacko A, Reason A, Nuckolls C, Kudchodkar B, Nair M, Sundarrajan G, Pritchard P, Morris H, Dell A) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Amino acid sequence and carbohydrate structure of a recombinant human tissue factor pathway inhibitor expressed in Chinese hamster ovary cells: one N-and two O-linked carbohydrate chains are located between Kunitz domains 2 and 3 and one N-linked carbohydrate chain is in Kunitz domain 2. (1996 - Nakahara Y, Miyata T, Hamuro T, Funatsu A, Miyagi M, Tsunasawa S, Kato H) / Status : Reviewed
- N-linked sugar chain structure of recombinant human lymphotoxin produced by CHO cells: the functional role of carbohydrate as to its lectin-like character and clearance velocity. (1993 - Fukushima K, Watanabe H, Takeo K, Nomura M, Asahi T, Yamashita K) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structural analysis of the N-linked carbohydrate chains of the 55-kDa glycoprotein family (PZP3) from porcine zona pellucida. (1992 - Noguchi S, Hatanaka Y, Tobita T, Nakano M) / Status : Reviewed
- Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Recombinant human erythropoietin produced by Namalwa cells. (1989 - Yanagi H, Yoshima T, Ogawa I, Okamoto M) / Status : Reviewed
- Relationship between sugar chain structure and biological activity of recombinant human erythropoietin produced in Chinese hamster ovary cells. (1989 - Takeuchi M, Inoue N, Strickland T, Kubota M, Wada M, Shimizu R, Hoshi S, Kozutsumi H, Takasaki S, Kobata A) / Status : Reviewed
- Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
-
Alkaline phosphatase, intestinal / Homo sapiens
- Undefined site
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
-
Erythropoietin / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
Interferon gamma / Homo sapiens
- Undefined site
-
L-selectin / Homo sapiens
- Undefined site
- Lymphotoxin-alpha / Homo sapiens
-
Phosphatidylcholine-sterol acyltransferase / Homo sapiens
- Undefined site
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
T-cell surface antigen cd2 / Homo sapiens
- Undefined site
-
T-cell surface glycoprotein CD5 / Homo sapiens
- Undefined site
-
Tissue factor pathway inhibitor / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Serotransferrin / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
- Zona pellucida sperm-binding protein 3 / Sus scrofa
-
Zona pellucida sperm-binding proteins 3 and 4 / Sus scrofa
- Undefined site
-
Envelope glycoprotein / Friend mink cell focus-forming virus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Zona Pellucida (UBERON_0000086)
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Mammary Gland (UBERON_0001911)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Leukocyte (CL_0000738)
- T-Lymphocyte (CL_0000084)
- Leukemia, Myloid, Chronic (DOID:8552)
- Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50). (2001 - Funatsu O, Sato T, Kotovuori P, Gahmberg CG, Ikekita M, Furukawa K) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
-
Intercellular adhesion molecule-3 (CD50) / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Uncharacterized protein from Pleura / Homo sapiens
- Undefined site
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- T-Lymphocyte (CL_0000084)
-
Intercellular adhesion molecule-3 (CD50) / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Zona Pellucida (UBERON_0000086)
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
-
Prorenin / Homo sapiens
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Blood Plasma (UBERON_0001969)
-
Von willebrand factor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
Tissue factor pathway inhibitor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
CD59 glycoprotein / Homo sapiens
- Undefined site
-
T-cell surface glycoprotein CD5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
Tissue factor pathway inhibitor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Microsome (GO_0005792)
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
-
Immunoglobulin gamma / Columba livia
- Undefined site
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Blood Serum (UBERON_0001977)
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Kininogen-1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Erythropoietin / Homo sapiens
- GQALLVNSSQPWEPLQLHVDK (21aa)
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
- Clusterin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Macrophage mannose receptor 1 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
- RNESTQNCVVAEPEKM (16aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- KKEDALNETRESETKL (16aa)
- RSHNRSEEFLIAGKL (15aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- RHIGHANLTFEQLRS (15aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KTAHCNESFYFLCKR (15aa)
- KRNDQLPSNFTPVFYSQLQKN (21aa)
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
-
- N-Linked / Complex
(avg mass : 2518.3251)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Ascitic fluid (UBERON_0007795)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- Hex:7 HexNAc:6 dHex:1 / N-Linked
(avg mass : 2518.3251)
- Ascitic fluid (UBERON_0007795)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- Jurkat (CVCL_0065)
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-3)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(a1-3)Gal(b1-4) + 2 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(a1-4)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(?1-4)"
- N-Linked / Complex / Structure 3126
- N-Linked / Complex / Structure 9285
- N-Linked / Complex / Structure 9443
- N-Linked / Complex / Structure 9691
- N-Linked / Complex / Structure 10059
- N-Linked / Complex / Structure 10514
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena DomÃnguez-Vega) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
- Aminopeptidase n / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Asporin / Homo sapiens
- Attractin / Homo sapiens
- C4b-binding protein alpha chain / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Carnitine O-acetyltransferase / Homo sapiens
- CD166 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- Complement c3 / Homo sapiens
- Decorin / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Inositol monophosphatase 3 / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prothrombin / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Tenascin / Homo sapiens
- Tigger transposable element-derived protein 6 / Homo sapiens
- Uromodulin / Homo sapiens
- Vitronectin / Homo sapiens
- VWFA and cache domain-containing protein 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- WFSAGLASNSSWLR (14aa)
- AFNSTLPTMAQMEK (14aa)
- YETTNK (6aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- ENTSDPSIVIAFGR (14aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- TCDWIPKPNMSASCK (15aa)
- TFYWDFYTNR (10aa)
- NTTYCSK (7aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- GNFSTEGCGCVCEPGWK (17aa)
- NGSLFAFR (8aa)
- TYTYADTPDDFQIHNFSIPEEDTK (24aa)
- SWPAVGNCSSAIR (13aa)
- DFVNASSK (8aa)
- GNITEYQCHQYITK (14aa)
- NPCTSEQNCTSPFSYK (16aa)
- YANITVDYLYNKETK (15aa)
- NSSLQTNK (8aa)
- SPLNTS (6aa)
- KDNTTVTR (8aa)
- GENLN (5aa)
- VASVININPNTTHSTGSCR (19aa)
- QVAIQTFGNQTTIIPAGGAGYK (22aa)
- IININPNK (8aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- EGDNITIK (8aa)
- ITDIENGSIANIPR (14aa)
- IPNIT (5aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- SCPACPGSNITIR (13aa)
- MFSQNDTR (8aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- GEVFNATR (8aa)
- NATDNISK (8aa)
- VQPFNVTQGK (10aa)
- NNQSLP (6aa)
- NQSLP (5aa)
- TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- NFTENDLLVR (10aa)
- RPGVNLS (7aa)
- DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa)
- LSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNR (36aa)
- DQCIVDDITYNVNDTFHK (18aa)
- AAIPSAIDTNSSK (13aa)
- NVSYAWK (7aa)
- LYQDVNCT (8aa)
- NNTNNWR (7aa)
- VDVVICLSTTVRNDTLQEAK (20aa)
- NATLVNEADK (10aa)
- VVPEGIRMNK (10aa)
- CIEGSYKGPVKMPSQAPTGNFYPQPLLNSSMCLEDSR (37aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- NISQDLEK (8aa)
- LSDTTSQSNSTAK (13aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- NASLALSASIGR (12aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:7 HexNAc:6 dHex:1 / N-Linked
(avg mass : 2518.3251)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2518.3251)
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2518.3251)