Hex:7 HexNAc:6 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Mesocricetus auratus (Golden hamster)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Columba livia (Domestic pigeon)
• Friend mink cell focus-forming virus
• Human immunodeficiency virus type 1 (lw12.3 isolate)
• Marburg virus (strain musoke)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alkaline phosphatase, intestinal / Homo sapiens    P09923
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Aminopeptidase n / Homo sapiens    P15144
• Apolipoprotein d / Homo sapiens    P05090
• Asporin / Homo sapiens    Q9BXN1
• Attractin / Homo sapiens    O75882
• Beta-secretase-fc fusion protein / Homo sapiens    P56817
• C4b-binding protein alpha chain / Homo sapiens    P04003
• Carnitine O-acetyltransferase / Homo sapiens    P43155
• CD166 antigen / Homo sapiens    Q13740
• CD44 antigen / Homo sapiens    P16070
• CD59 glycoprotein / Homo sapiens    P13987
• Complement c3 / Homo sapiens    P01024
• Decorin / Homo sapiens    P07585
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Erythropoietin / Homo sapiens    P01588
• Erythropoietin - bi / Homo sapiens    P01588
• Erythropoietin - tetra / Homo sapiens    P01588
• Fibrillin-1 / Homo sapiens    P35555
• Fibronectin / Homo sapiens    P02751
• Galectin-3-binding protein / Homo sapiens    Q08380
• Glucosylceramidase / Homo sapiens    P04062
• Golgi apparatus protein 1 / Homo sapiens    Q92896
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Heparin cofactor 2 / Homo sapiens    P05546
• Inositol monophosphatase 3 / Homo sapiens    Q9NX62
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Integrin beta-1 / Homo sapiens    P05556
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens    P32942
• Interferon gamma / Homo sapiens    P01579
• Interleukin-1 receptor accessory protein / Homo sapiens    Q9NPH3
• Kininogen-1 / Homo sapiens    P01042
• L-selectin / Homo sapiens    P14151
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit beta-1 / Homo sapiens    P07942
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Lumican / Homo sapiens    P51884
• Lymphotoxin-alpha / Homo sapiens    P01374
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Myeloperoxidase / Homo sapiens    P05164
• Phosphatidylcholine-sterol acyltransferase / Homo sapiens    P04180
• Prolactin-inducible protein / Homo sapiens    P12273
• Prorenin / Homo sapiens    P00797
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prothrombin / Homo sapiens    P00734
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Secretogranin-3 / Homo sapiens    Q8WXD2
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens    O15389
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens    Q9Y286
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens    Q9NYZ4
• T-cell surface antigen cd2 / Homo sapiens    P06729
• T-cell surface glycoprotein CD5 / Homo sapiens    P06127
• Tenascin / Homo sapiens    P24821
• Tigger transposable element-derived protein 6 / Homo sapiens    Q17RP2
• Tissue factor pathway inhibitor / Homo sapiens    P10646
• Uncharacterized protein from Fluid / Homo sapiens
• Uromodulin / Homo sapiens    P07911
• Vitronectin / Homo sapiens    P04004
• Von willebrand factor / Homo sapiens    P04275
• VWFA and cache domain-containing protein 1 / Homo sapiens    Q5VU97
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Acetylcholinesterase / Bos taurus    P23795
• Platelet glycoprotein IV / Bos taurus    P26201
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Serotransferrin / Mus musculus    Q921I1
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
• Zona pellucida sperm-binding protein 3 / Sus scrofa    P42098
• Zona pellucida sperm-binding proteins 3 and 4 / Sus scrofa    P42098    Q07287
• Immunoglobulin gamma / Columba livia
• Knob protein gp70 / Friend mink cell focus-forming virus
• Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)    Q70626
• Structural glycoprotein / Marburg virus (strain musoke)    P35253
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amnion (UBERON_0000305)   FL (CVCL_1905)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   BHK21/13/Py6 (CVCL_LM74)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   COS-1 (CVCL_0223)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO B8-300 (CVCL_VU03)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Ovary (UBERON_0000992)   IM4 (CVCL_VT63)  
• Ovary (UBERON_0000992)   IM4/IV (CVCL_VT64)  
• Ovary (UBERON_0000992)   IM4/V/IV (CVCL_VT67)  
• Ovary (UBERON_0000992)   IM4/Vh (CVCL_VT65)  
• Ovary (UBERON_0000992)   IM4/Vm (CVCL_VT66)  
• Ovary (UBERON_0000992)  
• Placenta (UBERON_0001987)  
• Pleura (UBERON_0000977)   K-562 (CVCL_0004)  
• Seminal Fluid (UBERON_0006530)  
• Spleen (UBERON_0002106)  
• Urine (UBERON_0001088)  
• Zona Pellucida (UBERON_0000086)  
• 3Y1-B clone 1 (CVCL_4563)  
• FreeStyle 293-F (CVCL_D603)  
• H9 (CVCL_1240)   Lymphocyte (CL_0000542)  
• HEK293 (CVCL_0045)  
• Jurkat (CVCL_0065)  
• NIH 3T3 (CVCL_0594)   Fibroblast (CL_0000057)  
• Namalwa (CVCL_0067)   B-Lymphocyte (CL_0000236)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  
• Leukocyte (CL_0000738)  
• T-Lymphocyte (CL_0000084)  
• Microsome (GO_0005792)  

Reported structure

• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-3)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(a1-3)Gal(b1-4) + 2 x Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(a1-4)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(?1-4)"
• N-Linked / Complex / Structure 3126

Composition

• Hex:7 HexNAc:6 dHex:1 (avg mass : 2518.3251 )

Disease

• Anemia, Aplastic (DOID:12449)
• Cancer, breast (DOID:1612)
• Carcinoma (DOID:305)
• Carcinoma, Hepatocellular (DOID:684)
• COVID-19 (DOID:0080600)
• Gangliosidosis GM1 (DOID:3322)
• Gaucher Disease (DOID:1926)
• Leukemia, Acute lymphoblastic (DOID:9952)
• Leukemia, Myloid, Chronic (DOID:8552)
• Lymphoma, Burkitt (DOID:8584)
• Prostate cancer (DOID:10283)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)

Reference

• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Protein and Site Specificity of Fucosylation in Liver-Secreted Glycoproteins (2014 - Pompach P, Ashline DJ, Brnakova Z, Benicky J, Sanda M, Goldman R.) / Status : Reviewed
• Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
• N-glycan structures of pigeon IgG: a major serum glycoprotein containing Galalpha1-4 Gal termini.. (2003 - Suzuki N, Khoo KH, Chen CM, Chen HC, Lee YC) / Status : Reviewed
• Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50). (2001 - Funatsu O, Sato T, Kotovuori P, Gahmberg CG, Ikekita M, Furukawa K) / Status : Reviewed
• A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
• Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Structural analysis of trisialylated biantennary glycans isolated from mouse serum transferrin. Characterization of the sequence Neu5Gc(alpha 2-3)Gal(beta 1-3)[Neu5Gc(alpha 2-6)]GlcNAc(beta 1-2)Man. (2000 - Coddeville B, Regoeczi E, Strecker G, Plancke Y, Spik G) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Localization of neutral N-linked carbohydrate chains in pig zona pellucida glycoprotein ZPC. (1999 - Yonezawa N, Fukui N, Kudo K, Nakano M) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Characterization of recombinant human plasma lecithin: cholesterol acyltransferase (LCAT): N-linked carbohydrate structures and catalytic properties. (1998 - Lacko A, Reason A, Nuckolls C, Kudchodkar B, Nair M, Sundarrajan G, Pritchard P, Morris H, Dell A) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Amino acid sequence and carbohydrate structure of a recombinant human tissue factor pathway inhibitor expressed in Chinese hamster ovary cells: one N-and two O-linked carbohydrate chains are located between Kunitz domains 2 and 3 and one N-linked carbohydrate chain is in Kunitz domain 2. (1996 - Nakahara Y, Miyata T, Hamuro T, Funatsu A, Miyagi M, Tsunasawa S, Kato H) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
• N-linked sugar chain structure of recombinant human lymphotoxin produced by CHO cells: the functional role of carbohydrate as to its lectin-like character and clearance velocity. (1993 - Fukushima K, Watanabe H, Takeo K, Nomura M, Asahi T, Yamashita K) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
• Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Structural analysis of the N-linked carbohydrate chains of the 55-kDa glycoprotein family (PZP3) from porcine zona pellucida. (1992 - Noguchi S, Hatanaka Y, Tobita T, Nakano M) / Status : Reviewed
• Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
• Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
• Recombinant human erythropoietin produced by Namalwa cells. (1989 - Yanagi H, Yoshima T, Ogawa I, Okamoto M) / Status : Reviewed
• Relationship between sugar chain structure and biological activity of recombinant human erythropoietin produced in Chinese hamster ovary cells. (1989 - Takeuchi M, Inoue N, Strickland T, Kubota M, Wada M, Shimizu R, Hoshi S, Kozutsumi H, Takasaki S, Kobata A) / Status : Reviewed
• Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
• Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
• Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
• The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
• Characterization of the microheterogeneity in glycoproteins by 500-MHz 1H-NMR spectroscopy of glycopeptide preparations. Application to a monofucosylated tetra-antennary glycopeptide fraction from human plasma alpha 1-acid glycoprotein. (1981 - van Halbeek H, Dorland L, Vliegenthart J, Montreuil J, Fournet B, Schmid K) / Status : Reviewed
• Determination of the primary structures of 16 asialo-carbohydrate units derived from human plasma alpha 1-acid glycoprotein by 360-MHZ 1H NMR spectroscopy and permethylation analysis. (1978 - Fournet B, Montreuil J, Strecker G, Dorland L, Haverkamp J, Vliegenthart F, Binette J, Schmid K) / Status : Reviewed

Reported glycosite

• Alkaline phosphatase, intestinal / Homo sapiens
  •        Undefined site
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-103
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Aminopeptidase n / Homo sapiens
  •        Asn-735
  •        Asn-818
• Apolipoprotein d / Homo sapiens
  •        Asn-98
• Asporin / Homo sapiens
  •        Asn-282
• Attractin / Homo sapiens
  •        Asn-1043
• Beta-secretase-fc fusion protein / Homo sapiens
  •        Undefined site
• C4b-binding protein alpha chain / Homo sapiens
  •        Asn-506
• Carnitine O-acetyltransferase / Homo sapiens
  •        Asn-238
• CD166 antigen / Homo sapiens
  •        Asn-265
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD59 glycoprotein / Homo sapiens
  •        Undefined site
• Complement c3 / Homo sapiens
  •        Asn-939
• Decorin / Homo sapiens
  •        Asn-262
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-294
  •        Asn-378
• Erythropoietin / Homo sapiens
  •        Undefined site
  •        Asn-51
  •        Asn-110
• Erythropoietin - bi / Homo sapiens
  •        Undefined site
• Erythropoietin - tetra / Homo sapiens
  •        Undefined site
• Fibrillin-1 / Homo sapiens
  •        Asn-1581
• Fibronectin / Homo sapiens
  •        Asn-528
  •        Asn-1236
• Galectin-3-binding protein / Homo sapiens
  •        Asn-551
• Glucosylceramidase / Homo sapiens
  •        Asn-185
• Golgi apparatus protein 1 / Homo sapiens
  •        Asn-210
  •        Asn-786
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
• Heparin cofactor 2 / Homo sapiens
  •        Asn-188
• Inositol monophosphatase 3 / Homo sapiens
  •        Asn-259
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Integrin beta-1 / Homo sapiens
  •        Asn-212
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens
  •        Undefined site
• Interferon gamma / Homo sapiens
  •        Undefined site
• Interleukin-1 receptor accessory protein / Homo sapiens
  •        Asn-118
• Kininogen-1 / Homo sapiens
  •        Asn-169
• L-selectin / Homo sapiens
  •        Undefined site
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-2707
• Laminin subunit beta-1 / Homo sapiens
  •        Asn-1279
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1241
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
• Lymphotoxin-alpha / Homo sapiens
  •        Asn-96
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-249
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-58
  •        Asn-257
  •        Asn-356
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
• Myeloperoxidase / Homo sapiens
  •        Asn-323
• Phosphatidylcholine-sterol acyltransferase / Homo sapiens
  •        Undefined site
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prorenin / Homo sapiens
  •        Undefined site
• Prosaposin / Homo sapiens
  •        Undefined site
  •        Asn-101
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prothrombin / Homo sapiens
  •        Asn-416
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
  •        Asn-234
• Secretogranin-3 / Homo sapiens
  •        Asn-346
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens
  •        Undefined site
• T-cell surface antigen cd2 / Homo sapiens
  •        Undefined site
• T-cell surface glycoprotein CD5 / Homo sapiens
  •        Undefined site
• Tenascin / Homo sapiens
  •        Asn-166
• Tigger transposable element-derived protein 6 / Homo sapiens
  •        Asn-444
• Tissue factor pathway inhibitor / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Fluid / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-322
• Vitronectin / Homo sapiens
  •        Asn-169
• Von willebrand factor / Homo sapiens
  •        Undefined site
• VWFA and cache domain-containing protein 1 / Homo sapiens
  •        Asn-587
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Serotransferrin / Mus musculus
  •        Undefined site
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Zona pellucida sperm-binding protein 3 / Sus scrofa
  •        Asn-271
• Zona pellucida sperm-binding proteins 3 and 4 / Sus scrofa
  •        Undefined site
• Immunoglobulin gamma / Columba livia
  •        Undefined site
• Knob protein gp70 / Friend mink cell focus-forming virus
  •        Undefined site
• Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)
  •        Undefined site
• Structural glycoprotein / Marburg virus (strain musoke)
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-615
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-657
  •        Asn-1074

Mass spectrometry observed peptide

• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57
• YETTNK (6aa)
  •    P13473    Asn-58
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• ENTSDPSIVIAFGR (14aa)
  •    P11279    Asn-84
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88
• TCDWIPKPNMSASCK (15aa)
  •    P07602    Asn-101
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105
• NTTYCSK (7aa)
  •    Q9NPH3    Asn-118
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• GWIFGTTLDSKTQSLLIVNNATNVVIK (27aa)
  •    P0DTC2    Asn-122
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• VYSSANNCTFEYVSQPFLMDLEGK (24aa)
  •    P0DTC2    Asn-165
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• GNFSTEGCGCVCEPGWK (17aa)
  •    P24821    Asn-166
• NGSLFAFR (8aa)
  •    P04004    Asn-169
• TYTYADTPDDFQIHNFSIPEEDTK (24aa)
  •    P04062    Asn-185
• SWPAVGNCSSAIR (13aa)
  •    P02790    Asn-187
• DFVNASSK (8aa)
  •    P05546    Asn-188
• GNITEYQCHQYITK (14aa)
  •    Q92896    Asn-210
• NPCTSEQNCTSPFSYK (16aa)
  •    P05556    Asn-212
• YANITVDYLYNKETK (15aa)
  •    P08575    Asn-234
• NSSLQTNK (8aa)
  •    P43155    Asn-238
• KDNTTVTR (8aa)
  •    P11279    Asn-249
• VASVININPNTTHSTGSCR (19aa)
  •    P13473    Asn-257
• QVAIQTFGNQTTIIPAGGAGYK (22aa)
  •    Q9NX62    Asn-259
• IININPNK (8aa)
  •    P11279    Asn-261
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262
• EGDNITIK (8aa)
  •    Q13740    Asn-265
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
  •    Q9Y5L3    Asn-294
• SCPACPGSNITIR (13aa)
  •    P05164    Asn-323
• MFSQNDTR (8aa)
  •    P02750    Asn-325
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• RFPNIT (6aa)
  •    P0DTC2    Asn-331
• NATDNISK (8aa)
  •    Q8WXD2    Asn-346
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
  •    Q9Y5L3    Asn-378
• NFTENDLLVR (10aa)
  •    P00734    Asn-416
• DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa)
  •    Q17RP2    Asn-444
• LSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNR (36aa)
  •    P04003    Asn-506
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551
• NVSYAWK (7aa)
  •    Q5VU97    Asn-587
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• NNTNNWR (7aa)
  •    P15144    Asn-735
• VDVVICLSTTVRNDTLQEAK (20aa)
  •    Q92896    Asn-786
• NATLVNEADK (10aa)
  •    P15144    Asn-818
• VVPEGIRMNK (10aa)
  •    P01024    Asn-939
• CIEGSYKGPVKMPSQAPTGNFYPQPLLNSSMCLEDSR (37aa)
  •    O75882    Asn-1043
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236
• NISQDLEK (8aa)
  •    P11047    Asn-1241
• LSDTTSQSNSTAK (13aa)
  •    P07942    Asn-1279
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581
• NASLALSASIGR (12aa)
  •    O15230    Asn-2707