GlyConnect

Export CSV

taxonomy (2) protein (9) source (12) structure (9) composition (1) disease (5) reference (16) site (13) peptide (9)

Taxonomy

Homo sapiens (Human)
Gallus gallus (Chicken)

Protein

Source

Reported structure

Composition

Hex:8 HexNAc:7 dHex:1 NeuAc:4 (avg mass : 4048.6941 )

Disease

Reference

Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
Determination of the branch location of extra N-acetyllactosamine units in sialo N-linked tetraantennary oligosaccharides. (1991 - Hokke C, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed

Reported glycosite

4F2 cell-surface antigen heavy chain / Homo sapiens
- Asn-381
Alpha-1-acid glycoprotein 1 / Homo sapiens
- Undefined site
Epidermal growth factor receptor / Homo sapiens
- Undefined site
Erythropoietin / Homo sapiens
- Undefined site
- Asn-51
- Asn-65
- Asn-110
Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Asn-56
- Asn-92
Lumican / Homo sapiens
- Asn-252
Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
- Asn-265
Thrombopoietin / Homo sapiens
- Undefined site
Uromodulin / Homo sapiens
- Asn-322

Mass spectrometry observed peptide

EAENITTGC (9aa)
- P01588 Asn-51 Erythropoietin / Homo sapiens
KCQGAYSPEDNSTQW (15aa)
- P08637 Asn-56 Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
SLNENITVPDTK (12aa)
- P01588 Asn-65 Erythropoietin / Homo sapiens
RCQTNLSTLSDPVQLE (16aa)
- P08637 Asn-92 Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
GQALLVNSSQPWEPLQLHVDK (21aa)
- P01588 Asn-110 Erythropoietin / Homo sapiens
ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
- P51884 Asn-252 Lumican / Homo sapiens
YIQPIIAVQFTNITMDTEIR (20aa)
- P05026 Asn-265 Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
QDFNITDISLLEHR (14aa)
- P07911 Asn-322 Uromodulin / Homo sapiens
IIIAGTNSSDIQQIISIIESNK (22aa)
- P08195 Asn-381 4F2 cell-surface antigen heavy chain / Homo sapiens

- N-Linked / Complex (avg mass : 4048.6941)
- N-Linked / Complex (avg mass : 4048.6941)
- N-Linked / Complex (avg mass : 4048.6941)
- N-Linked / Complex (avg mass : 4048.6941)
- N-Linked / Complex (avg mass : 4048.6941)
- N-Linked / Complex (avg mass : 4048.6941)
- N-Linked / Complex (avg mass : 4048.6941)
- N-Linked / Complex (avg mass : 4048.6941)
- N-Linked / Complex (avg mass : 4048.6941)

- Hex:8 HexNAc:7 dHex:1 NeuAc:4 / N-Linked (avg mass : 4048.6941)