taxonomy (2)
protein (13)
source (12)
structure (9)
composition (1)
disease (5)
reference (16)
site (21)
peptide (9)
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- CD16A-NK08-V/F genotype / Homo sapiens P08637
- CD16A-NK09-V/F genotype / Homo sapiens P08637
- CD16A-NK11-F/F genotype / Homo sapiens P08637
- CD16A-NK12-V/F genotype / Homo sapiens P08637
- CD16A-NK13-V/F genotype / Homo sapiens P08637
- Epidermal growth factor receptor / Homo sapiens P00533
- Erythropoietin / Homo sapiens P01588
- Lumican / Homo sapiens P51884
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens P05026
- Thrombopoietin / Homo sapiens P40225
- Uromodulin / Homo sapiens P07911
Protein
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Urine (UBERON_0001088)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b-4)GlcNAc + 2 x NeuAc(a2-3)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2165
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9299
- N-Linked / Complex / Structure 9819
- N-Linked / Complex / Structure 10807
- N-Linked / Complex / Structure 11201
Reported structure
- Cancer, breast (DOID:1612)
- Carcinoma, Squamous cell (DOID:1749)
- Control/Healthy
- Familial hepatic adenoma (DOID:111366)
- Prostate cancer (DOID:10283)
Disease
- Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
- Determination of the branch location of extra N-acetyllactosamine units in sialo N-linked tetraantennary oligosaccharides. (1991 - Hokke C, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
Reference
- 4F2 cell-surface antigen heavy chain / Homo sapiens
-
Alpha-1-acid glycoprotein 1 / Homo sapiens
- Undefined site
- CD16A-NK08-V/F genotype / Homo sapiens
- CD16A-NK09-V/F genotype / Homo sapiens
- CD16A-NK11-F/F genotype / Homo sapiens
- CD16A-NK12-V/F genotype / Homo sapiens
- CD16A-NK13-V/F genotype / Homo sapiens
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
- Erythropoietin / Homo sapiens
- Lumican / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
-
Thrombopoietin / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
Reported glycosite
- EAENITTGC (9aa)
- KCQGAYSPEDNSTQW (15aa)
- P08637 Asn-56     CD16A-NK08-V/F genotype / Homo sapiens
- P08637 Asn-56     CD16A-NK11-F/F genotype / Homo sapiens
- P08637 Asn-56     CD16A-NK13-V/F genotype / Homo sapiens
- P08637 Asn-56     CD16A-NK09-V/F genotype / Homo sapiens
- P08637 Asn-56     CD16A-NK12-V/F genotype / Homo sapiens
- SLNENITVPDTK (12aa)
- RCQTNLSTLSDPVQLE (16aa)
- P08637 Asn-92     CD16A-NK11-F/F genotype / Homo sapiens
- P08637 Asn-92     CD16A-NK08-V/F genotype / Homo sapiens
- P08637 Asn-92     CD16A-NK09-V/F genotype / Homo sapiens
- P08637 Asn-92     CD16A-NK13-V/F genotype / Homo sapiens
- P08637 Asn-92     CD16A-NK12-V/F genotype / Homo sapiens
- GQALLVNSSQPWEPLQLHVDK (21aa)
- ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
- YIQPIIAVQFTNITMDTEIR (20aa)
- QDFNITDISLLEHR (14aa)
- IIIAGTNSSDIQQIISIIESNK (22aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 4048.6941)
-
Thrombopoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 4048.6941)
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
- Determination of the branch location of extra N-acetyllactosamine units in sialo N-linked tetraantennary oligosaccharides. (1991 - Hokke C, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 4048.6941)
- Carcinoma, Squamous cell (DOID:1749)
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
- Determination of the branch location of extra N-acetyllactosamine units in sialo N-linked tetraantennary oligosaccharides. (1991 - Hokke C, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 4048.6941)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 4048.6941)
- Carcinoma, Squamous cell (DOID:1749)
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 4048.6941)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- CD16A-NK08-V/F genotype / Homo sapiens
- CD16A-NK09-V/F genotype / Homo sapiens
- CD16A-NK11-F/F genotype / Homo sapiens
- CD16A-NK12-V/F genotype / Homo sapiens
- CD16A-NK13-V/F genotype / Homo sapiens
- Erythropoietin / Homo sapiens
- EAENITTGC (9aa)
- KCQGAYSPEDNSTQW (15aa)
- P08637 Asn-56     CD16A-NK08-V/F genotype / Homo sapiens
- P08637 Asn-56     CD16A-NK11-F/F genotype / Homo sapiens
- P08637 Asn-56     CD16A-NK13-V/F genotype / Homo sapiens
- P08637 Asn-56     CD16A-NK09-V/F genotype / Homo sapiens
- P08637 Asn-56     CD16A-NK12-V/F genotype / Homo sapiens
- SLNENITVPDTK (12aa)
- RCQTNLSTLSDPVQLE (16aa)
- P08637 Asn-92     CD16A-NK11-F/F genotype / Homo sapiens
- P08637 Asn-92     CD16A-NK08-V/F genotype / Homo sapiens
- P08637 Asn-92     CD16A-NK09-V/F genotype / Homo sapiens
- P08637 Asn-92     CD16A-NK13-V/F genotype / Homo sapiens
- P08637 Asn-92     CD16A-NK12-V/F genotype / Homo sapiens
- GQALLVNSSQPWEPLQLHVDK (21aa)
-
- N-Linked / Complex
(avg mass : 4048.6941)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
-
- N-Linked / Complex
(avg mass : 4048.6941)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 4048.6941)
- Colon (UBERON_0001155)
-
- Hex:8 HexNAc:7 dHex:1 NeuAc:4 / N-Linked
(avg mass : 4048.6941)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b-4)GlcNAc + 2 x NeuAc(a2-3)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2165
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9299
- N-Linked / Complex / Structure 9819
- N-Linked / Complex / Structure 10807
- N-Linked / Complex / Structure 11201
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- Lumican / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
- Uromodulin / Homo sapiens
- ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
- YIQPIIAVQFTNITMDTEIR (20aa)
- QDFNITDISLLEHR (14aa)
- IIIAGTNSSDIQQIISIIESNK (22aa)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:8 HexNAc:7 dHex:1 NeuAc:4 / N-Linked
(avg mass : 4048.6941)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 4048.6941)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 4048.6941)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 4048.6941)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 4048.6941)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 4048.6941)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 4048.6941)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 4048.6941)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 4048.6941)
Reported glycosite
- N-Linked / Complex
(avg mass : 4048.6941)