Hex:4 HexNAc:5 dHex:2

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Mesocricetus auratus (Golden hamster)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Human immunodeficiency virus type 1 (HIV-1)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Aminopeptidase n / Homo sapiens    P15144
• Asporin / Homo sapiens    Q9BXN1
• Biglycan / Homo sapiens    P21810
• Calumenin / Homo sapiens    O43852
• CD166 antigen / Homo sapiens    Q13740
• Chymotrypsin-like elastase family member 3B / Homo sapiens    P08861
• Clusterin / Homo sapiens    P10909
• Coagulation factor V / Homo sapiens    P12259
• Cysteine-rich secretory protein 3 / Homo sapiens    P54108
• Decorin / Homo sapiens    P07585
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Fibrillin-1 / Homo sapiens    P35555
• Glycodelin-a / Homo sapiens    P09466
• High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens    P12314-2
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interstitial collagenase / Homo sapiens    P03956
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens    P12318-1
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens    P31994-3
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens    O75015
• Lumican / Homo sapiens    P51884
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Prominin-1 / Homo sapiens    O43490
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Reticulocalbin-3 / Homo sapiens    Q96D15
• Thrombospondin-1 / Homo sapiens    P07996
• Unspecified mucin / Homo sapiens    
• Vitronectin / Homo sapiens    P04004
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Corticotropin - lipotropin, npp peptide / Bos taurus    P01190
• Major prion protein / Mesocricetus auratus    P04273
• Ciliary neurotrophic factor receptor subunit alpha / Mus musculus    O88507
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries    Q712V9
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries    Q712V9
• Uncharacterized protein from Epithelium of Stomach / Sus scrofa    
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Acetabular Part of Hip Bone (UBERON_0001269)   HT-1080 (CVCL_0317)   Fibroblast (CL_0000057)  
• Amniotic Fluid (UBERON_0000173)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Cerebellum (UBERON_0002037)  
• Cerebrospinal Fluid (UBERON_0001359)  
• Colon (UBERON_0001155)  
• Epithelium of Stomach (UBERON_0001276)  
• Frontal Cortex (UBERON_0001870)  
• Hippocampul formation (UBERON:0002421)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• neocortex (UBERON:0001950)  
• Neurohypophysis (UBERON_0002198)  
• Pancreas (UBERON_0001264)  
• Prefrontal Cortex (UBERON:0000451)  
• Stomach (UBERON_0000945)  
• Striatum (UBERON_0002345)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293-F (CVCL_6642)  
• HEK293SF-3F6 (CVCL_4V95)  
• HEK293T (CVCL_0063)  

Reported structure

• N-Linked / Complex / Fuc(?1-3)[GalNAc(?1-4)]GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(?1-4)GlcNAc(?1-?)"
• N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 3125
• N-Linked / Complex / Fuc(?1-3)[Gal(?1-4)]GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc"
• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Fuc(a1-3)"
• N-Linked / Complex / Structure 9481
• N-Linked / Complex / Structure 9978
• N-Linked / Complex / Structure 9983
• N-Linked / Complex / Structure 10105
• N-Linked / Complex / Structure 10206
• N-Linked / Complex / Structure 11135
• N-Linked / Complex / Structure 11152
• N-Linked / Complex / Structure 11182
• N-Linked / Complex / Structure 11418
• N-Linked / Complex / Structure 11574
• N-Linked / Complex / Structure 11644
• N-Linked / Complex / Structure 11674
• N-Linked / Complex / Structure 11719
• N-Linked / Complex / Structure 11842
• N-Linked / Complex / Structure 11848
• N-Linked / Complex / Structure 11903
• N-Linked / Complex / Structure 11942
• O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-?)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(a1-?)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-?)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(b1-?)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc

Composition

• Hex:4 HexNAc:5 dHex:2 (avg mass : 1974.8459 )

Disease

• Alzheimer's disease (DOID:10652)
• Cancer, breast (DOID:1612)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Fibrosarcoma (DOID:3355)
• Mild Cognitive Impairment (DOID:0080832)
• Prostate cancer (DOID:10283)
• Scrapie (DOID:5434)

Reference

• Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
• Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
• Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
• Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
• N-Glycosylation in isolated rat nerve terminals (2021 - Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR) / Status : Reviewed
• Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
• Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• CSF N-glycoproteomics for early diagnosis in Alzheimer's disease (2016 - Palmigiano A, Barone R, Sturiale L, Sanfilippo C, Bua RO, Romeo DA, Messina A, Capuana ML, Maci T, Le Pira F, Zappia M, Garozzo D) / Status : Reviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
• Neutral N-glycans in adult rat brain tissue--complete characterisation reveals fucosylated hybrid and complex structures (1998 - Chen YJ, Wing DR, Guile GR, Dwek RA, Harvey DJ, Zamze S) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
• The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
• Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
• Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
• Structures of the neutral oligosaccharides isolated from A-active human gastric mucin. (1984 - Slomiany A, Zdebska E, Slomiany BL) / Status : Reviewed
• Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed

Reported glycosite

• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-186
• Aminopeptidase n / Homo sapiens
  •        Asn-42
• Asporin / Homo sapiens
  •        Asn-282
• Biglycan / Homo sapiens
  •        Asn-270
• Calumenin / Homo sapiens
  •        Asn-131
• CD166 antigen / Homo sapiens
  •        Asn-480
• Chymotrypsin-like elastase family member 3B / Homo sapiens
  •        Asn-114
• Clusterin / Homo sapiens
  •        Asn-103
  •        Asn-354
  •        Asn-374
• Coagulation factor V / Homo sapiens
  •        Asn-382
  •        Asn-1559
• Cysteine-rich secretory protein 3 / Homo sapiens
  •        Asn-239
• Decorin / Homo sapiens
  •        Asn-211
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-276
• Fibrillin-1 / Homo sapiens
  •        Asn-1703
  •        Asn-1902
• Glycodelin-a / Homo sapiens
  •        Asn-46
  •        Asn-81
• High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens
  •        Undefined site
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-252
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-440
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-207
  •        Asn-517
• Interstitial collagenase / Homo sapiens
  •        Asn-120
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
  •        Undefined site
• Lumican / Homo sapiens
  •        Asn-127
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
  •        Asn-248
• Prominin-1 / Homo sapiens
  •        Asn-274
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Reticulocalbin-3 / Homo sapiens
  •        Asn-140
• Thrombospondin-1 / Homo sapiens
  •        Asn-1067
• Unspecified mucin / Homo sapiens
  •        Undefined site
• Vitronectin / Homo sapiens
  •        Asn-169
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Corticotropin - lipotropin, npp peptide / Bos taurus
  •        Asn-91
• Major prion protein / Mesocricetus auratus
  •        Undefined site
• Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
  •        Asn-142
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •        Asn-184
  •        Asn-200
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •        Asn-184
  •        Asn-200
• Uncharacterized protein from Epithelium of Stomach / Sus scrofa
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-331
  •        Asn-343
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Undefined site
  •        Asn-331
  •        Asn-343

Mass spectrometry observed peptide

• NSGALTSGVHTFPAVLQSSGLY (22aa)
  •    P01857        Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
  •       177:L→N
• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NANSSPVASTTPSASATTNPASATTLDQSK (30aa)
  •    P15144    Asn-42     Aminopeptidase n / Homo sapiens
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• RIIVPLNNRENISDPTSPLRT (21aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NVTYGTYIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGHYAPGEEFHDVEDAETYKK (24aa)
  •    Q96D15    Asn-140     Reticulocalbin-3 / Homo sapiens
• GFYCSWHLPTPTYIPNTFNVTVLHGSK (27aa)
  •    O88507    Asn-142     Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
• LINDYVKNGTR (11aa)
  •    P01011    Asn-186     Alpha-1-antichymotrypsin / Homo sapiens
• GENFTETDIK (10aa)
  •    Q712V9    Asn-200     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •    Q712V9    Asn-200     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• ASCNCSNSIY (10aa)
  •    P54108    Asn-239     Cysteine-rich secretory protein 3 / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• EALENMNSTLK (11aa)
  •    O43490    Asn-274     Prominin-1 / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NATRF (5aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480     CD166 antigen / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• NYYADNQTCDGELLFNMTK (19aa)
  •    P35555    Asn-1703     Fibrillin-1 / Homo sapiens
• DACGNGTCR (9aa)
  •    P35555    Asn-1902     Fibrillin-1 / Homo sapiens