Hex:4 HexNAc:5 dHex:2

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Mesocricetus auratus (Golden hamster)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Aminopeptidase n / Homo sapiens    P15144
• Asporin / Homo sapiens    Q9BXN1
• Biglycan / Homo sapiens    P21810
• Calumenin / Homo sapiens    O43852
• Calumenin, isoform CRA_a / Homo sapiens    
• CD166 antigen / Homo sapiens    Q13740
• Chymotrypsin-like elastase family member 3B / Homo sapiens    P08861
• Clusterin / Homo sapiens    P10909
• Coagulation factor V / Homo sapiens    P12259
• Cysteine-rich secretory protein 3 / Homo sapiens    P54108
• Decorin / Homo sapiens    P07585
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Fibrillin-1 / Homo sapiens    P35555
• Glycodelin-a / Homo sapiens    P09466
• High affinity immunoglobulin gamma Fc receptor I / Homo sapiens    P12314-2
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interstitial collagenase / Homo sapiens    P03956
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens    P12318-1
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens    P31994-3
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens    O75015
• Lumican / Homo sapiens    P51884
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Prominin-1 / Homo sapiens    O43490
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Reticulocalbin-3 / Homo sapiens    Q96D15
• Thrombospondin-1 / Homo sapiens    P07996
• Unspecified mucin / Homo sapiens    
• Vitronectin / Homo sapiens    P04004
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Corticotropin - lipotropin, npp peptide / Bos taurus    P01190
• Major prion protein / Mesocricetus auratus    P04273
• Ciliary neurotrophic factor receptor subunit alpha / Mus musculus    O88507
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries    Q712V9
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries    Q712V9
• Uncharacterized protein from Epithelium of Stomach / Sus scrofa    
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Acetabular Part of Hip Bone (UBERON_0001269)   HT-1080 (CVCL_0317)   Fibroblast (CL_0000057)  
• Amniotic Fluid (UBERON_0000173)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Epithelium of Stomach (UBERON_0001276)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Neurohypophysis (UBERON_0002198)  
• Pancreas (UBERON_0001264)  
• Stomach (UBERON_0000945)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293-F (CVCL_6642)  
• HEK293T (CVCL_0063)  

Reported structure

• N-Linked / Complex / Structure 3125
• N-Linked / Complex / Fuc(?1-3)[Gal(?1-4)]GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc"
• N-Linked / Complex / Fuc(?1-3)[GalNAc(?1-4)]GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(?1-4)GlcNAc(?1-?)"
• N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Fuc(a1-3)"
• N-Linked / Complex / Structure 9481
• N-Linked / Complex / Structure 9978
• N-Linked / Complex / Structure 9983
• N-Linked / Complex / Structure 10105
• N-Linked / Complex / Structure 10206
• N-Linked / Complex / Structure 11135
• N-Linked / Complex / Structure 11152
• N-Linked / Complex / Structure 11182
• N-Linked / Complex / Structure 11418
• O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-?)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(a1-?)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-?)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(b1-?)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc

Composition

• Hex:4 HexNAc:5 dHex:2 (avg mass : 1974.8459 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Fibrosarcoma (DOID:3355)
• Prostate cancer (DOID:10283)
• Scrapie (DOID:5434)

Reference

• Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
• The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
• Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
• Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
• Structures of the neutral oligosaccharides isolated from A-active human gastric mucin. (1984 - Slomiany A, Zdebska E, Slomiany BL) / Status : Reviewed
• Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed

Reported glycosite

• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-186
• Aminopeptidase n / Homo sapiens
  •        Asn-42
• Asporin / Homo sapiens
  •        Asn-282
• Biglycan / Homo sapiens
  •        Asn-270
• Calumenin / Homo sapiens
  •        Asn-131
• Calumenin, isoform CRA_a / Homo sapiens
  •        Asn-131
• CD166 antigen / Homo sapiens
  •        Asn-480
• Chymotrypsin-like elastase family member 3B / Homo sapiens
  •        Asn-114
• Clusterin / Homo sapiens
  •        Asn-103
  •        Asn-354
  •        Asn-374
• Coagulation factor V / Homo sapiens
  •        Asn-382
  •        Asn-1559
• Cysteine-rich secretory protein 3 / Homo sapiens
  •        Asn-239
• Decorin / Homo sapiens
  •        Asn-211
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-276
• Fibrillin-1 / Homo sapiens
  •        Asn-1703
  •        Asn-1902
• Glycodelin-a / Homo sapiens
  •        Asn-46
  •        Asn-81
• High affinity immunoglobulin gamma Fc receptor I / Homo sapiens
  •        Undefined site
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-252
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-440
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-207
  •        Asn-517
• Interstitial collagenase / Homo sapiens
  •        Asn-120
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
  •        Undefined site
• Lumican / Homo sapiens
  •        Asn-127
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
  •        Asn-248
• Prominin-1 / Homo sapiens
  •        Asn-274
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Reticulocalbin-3 / Homo sapiens
  •        Asn-140
• Thrombospondin-1 / Homo sapiens
  •        Asn-1067
• Unspecified mucin / Homo sapiens
  •        Undefined site
• Vitronectin / Homo sapiens
  •        Asn-169
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Corticotropin - lipotropin, npp peptide / Bos taurus
  •        Asn-91
• Major prion protein / Mesocricetus auratus
  •        Undefined site
• Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
  •        Asn-142
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •        Asn-184
  •        Asn-200
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •        Asn-184
  •        Asn-200
• Uncharacterized protein from Epithelium of Stomach / Sus scrofa
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-331
  •        Asn-343
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343

Mass spectrometry observed peptide

• NSGALTSGVHTFPAVLQSSGLY (22aa)
  •    P01857        Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
  •       177:L→N
• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NANSSPVASTTPSASATTNPASATTLDQSK (30aa)
  •    P15144    Asn-42     Aminopeptidase n / Homo sapiens
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• RIIVPLNNRENISDPTSPLRT (21aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NVTYGTYIDDPDPDDGFNYK (20aa)
  •        Asn-131     Calumenin, isoform CRA_a / Homo sapiens
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGHYAPGEEFHDVEDAETYKK (24aa)
  •    Q96D15    Asn-140     Reticulocalbin-3 / Homo sapiens
• GFYCSWHLPTPTYIPNTFNVTVLHGSK (27aa)
  •    O88507    Asn-142     Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
• LINDYVKNGTR (11aa)
  •    P01011    Asn-186     Alpha-1-antichymotrypsin / Homo sapiens
• GENFTETDIK (10aa)
  •    Q712V9    Asn-200     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •    Q712V9    Asn-200     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• ASCNCSNSIY (10aa)
  •    P54108    Asn-239     Cysteine-rich secretory protein 3 / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• EALENMNSTLK (11aa)
  •    O43490    Asn-274     Prominin-1 / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NATRF (5aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480     CD166 antigen / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• NYYADNQTCDGELLFNMTK (19aa)
  •    P35555    Asn-1703     Fibrillin-1 / Homo sapiens
• DACGNGTCR (9aa)
  •    P35555    Asn-1902     Fibrillin-1 / Homo sapiens