taxonomy (7)
protein (38)
source (15)
structure (16)
composition (1)
disease (5)
reference (17)
site (53)
peptide (38)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mesocricetus auratus (Golden hamster)
- Mus musculus (House mouse)
- Ovis aries (Sheep)
- Sus scrofa (Pig)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Aminopeptidase n / Homo sapiens P15144
- Asporin / Homo sapiens Q9BXN1
- Biglycan / Homo sapiens P21810
- Calumenin / Homo sapiens O43852
- Calumenin, isoform CRA_a / Homo sapiens
- CD166 antigen / Homo sapiens Q13740
- Chymotrypsin-like elastase family member 3B / Homo sapiens P08861
- Clusterin / Homo sapiens P10909
- Cysteine-rich secretory protein 3 / Homo sapiens P54108
- Decorin / Homo sapiens P07585
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Fibrillin-1 / Homo sapiens P35555
- Glycodelin-a / Homo sapiens P09466
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interstitial collagenase / Homo sapiens P03956
- Lumican / Homo sapiens P51884
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Prominin-1 / Homo sapiens O43490
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Reticulocalbin-3 / Homo sapiens Q96D15
- Thrombospondin-1 / Homo sapiens P07996
- Unspecified mucin / Homo sapiens
- Vitronectin / Homo sapiens P04004
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Corticotropin - lipotropin, npp peptide / Bos taurus P01190
- Major prion protein / Mesocricetus auratus P04273
- Ciliary neurotrophic factor receptor subunit alpha / Mus musculus O88507
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries Q712V9
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries Q712V9
- Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Acetabular Part of Hip Bone (UBERON_0001269) HT-1080 (CVCL_0317) Fibroblast (CL_0000057)
- Amniotic Fluid (UBERON_0000173)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Epithelium of Stomach (UBERON_0001276)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Neurohypophysis (UBERON_0002198)
- Pancreas (UBERON_0001264)
- Stomach (UBERON_0000945)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
Source
- N-Linked / Complex / Structure 3125
- N-Linked / Complex / Fuc(?1-3)[Gal(?1-4)]GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc"
- N-Linked / Complex / Fuc(?1-3)[GalNAc(?1-4)]GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(?1-4)GlcNAc(?1-?)"
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Fuc(a1-3)"
- N-Linked / Complex / Structure 9481
- N-Linked / Complex / Structure 9978
- N-Linked / Complex / Structure 9983
- N-Linked / Complex / Structure 10105
- N-Linked / Complex / Structure 10206
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-?)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(a1-?)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-?)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(b1-?)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
Reported structure
- Hex:4 HexNAc:5 dHex:2 (avg mass : 1974.8459 )
Composition
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Fibrosarcoma (DOID:3355)
- Prostate cancer (DOID:10283)
- Scrapie (DOID:5434)
Disease
- Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
- Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
- The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
- Structures of the neutral oligosaccharides isolated from A-active human gastric mucin. (1984 - Slomiany A, Zdebska E, Slomiany BL) / Status : Reviewed
- Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed
Reference
- Alpha-1-antichymotrypsin / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- CD166 antigen / Homo sapiens
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Clusterin / Homo sapiens
- Cysteine-rich secretory protein 3 / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Glycodelin-a / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Interstitial collagenase / Homo sapiens
- Lumican / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Prominin-1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
-
Unspecified mucin / Homo sapiens
- Undefined site
- Vitronectin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
Major prion protein / Mesocricetus auratus
- Undefined site
- Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- NANSSPVASTTPSASATTNPASATTLDQSK (30aa)
- HENNTKDNSIQHEFSLTR (18aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- TQSLLIVNNATNVVIK (16aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- GFYCSWHLPTPTYIPNTFNVTVLHGSK (27aa)
- YHKNNKSWMESEF (13aa)
- NGSLFAFR (8aa)
- IYVIDGTQNDTAFVFPR (17aa)
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
- LINDYVKNGTR (11aa)
- GENFTETDIK (10aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- ASCNCSNSIY (10aa)
- FHLANR (6aa)
- MIENGSISFIPTIR (14aa)
- EALENMNSTLK (11aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- ITDIENGSIANIPR (14aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- NATRF (5aa)
- GEVFNATR (8aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- IANITQGEDQYYIR (14aa)
- IIISPEENVTITCTAENQIER (21aa)
- VVNSTTGPGEHIR (13aa)
- NYYADNQTCDGELLFNMTK (19aa)
- DACGNGTCR (9aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1974.8459)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1974.8459)
- Neurohypophysis (UBERON_0002198)
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
- N-Linked / Complex
(avg mass : 1974.8459)
- Neurohypophysis (UBERON_0002198)
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
- N-Linked / Complex
(avg mass : 1974.8459)
- Pancreas (UBERON_0001264)
- Chymotrypsin-like elastase family member 3B / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1974.8459)
- Brain (UBERON_0000955)
- Scrapie (DOID:5434)
-
Major prion protein / Mesocricetus auratus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1974.8459)
- Acetabular Part of Hip Bone (UBERON_0001269) HT-1080 (CVCL_0317) Fibroblast (CL_0000057)
- Amniotic Fluid (UBERON_0000173)
- Fibrosarcoma (DOID:3355)
- N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
- Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
- Glycodelin-a / Homo sapiens
- Interstitial collagenase / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1974.8459)
- Milk (UBERON_0001913)
- Immunoglobulin J chain / Homo sapiens
- RIIVPLNNRENISDPTSPLRT (21aa)
-
- N-Linked / Complex
(avg mass : 1974.8459)
- Brain (UBERON_0000955)
- Scrapie (DOID:5434)
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
-
- N-Linked / Complex
(avg mass : 1974.8459)
- Brain (UBERON_0000955)
- Scrapie (DOID:5434)
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
- GENFTETDIK (10aa)
-
- N-Linked / Complex
(avg mass : 1974.8459)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
-
- N-Linked / Complex
(avg mass : 1974.8459)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- O-Linked / Core 1
(avg mass : 1974.8459)
- Stomach (UBERON_0000945)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1974.8459)
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1974.8459)
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1974.8459)
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1974.8459)
- Stomach (UBERON_0000945)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- Hex:4 HexNAc:5 dHex:2 / N-Linked
(avg mass : 1974.8459)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / Complex / Structure 3125
- N-Linked / Complex / Fuc(?1-3)[Gal(?1-4)]GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc"
- N-Linked / Complex / Fuc(?1-3)[GalNAc(?1-4)]GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(?1-4)GlcNAc(?1-?)"
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Fuc(a1-3)"
- N-Linked / Complex / Structure 9481
- N-Linked / Complex / Structure 9978
- N-Linked / Complex / Structure 9983
- N-Linked / Complex / Structure 10105
- N-Linked / Complex / Structure 10206
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Alpha-1-antichymotrypsin / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- CD166 antigen / Homo sapiens
- Clusterin / Homo sapiens
- Cysteine-rich secretory protein 3 / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Lumican / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Prominin-1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Vitronectin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- NANSSPVASTTPSASATTNPASATTLDQSK (30aa)
- HENNTKDNSIQHEFSLTR (18aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- TQSLLIVNNATNVVIK (16aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- GFYCSWHLPTPTYIPNTFNVTVLHGSK (27aa)
- YHKNNKSWMESEF (13aa)
- NGSLFAFR (8aa)
- IYVIDGTQNDTAFVFPR (17aa)
- LINDYVKNGTR (11aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- ASCNCSNSIY (10aa)
- FHLANR (6aa)
- MIENGSISFIPTIR (14aa)
- EALENMNSTLK (11aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- ITDIENGSIANIPR (14aa)
- RFPNIT (6aa)
- NATRF (5aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- IANITQGEDQYYIR (14aa)
- IIISPEENVTITCTAENQIER (21aa)
- VVNSTTGPGEHIR (13aa)
- NYYADNQTCDGELLFNMTK (19aa)
- DACGNGTCR (9aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:5 dHex:2 / N-Linked
(avg mass : 1974.8459)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1974.8459)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1974.8459)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1974.8459)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1974.8459)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1974.8459)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1974.8459)