taxonomy (5)
protein (35)
source (12)
structure (10)
composition (1)
disease (6)
reference (16)
site (41)
peptide (35)
- Homo sapiens (Human)
- Mus musculus (House mouse)
- Sus scrofa (Pig)
- Bothrops moojeni (Brazilian lancehead)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-S1-casein / Homo sapiens P47710
- Apolipoprotein D / Homo sapiens P05090
- Asporin / Homo sapiens Q9BXN1
- Biglycan / Homo sapiens P21810
- Carboxypeptidase D / Homo sapiens O75976
- Clusterin / Homo sapiens P10909
- GDNF family receptor alpha-1 / Homo sapiens P56159
- Glucosylceramidase / Homo sapiens P04062
- Glycodelin-a / Homo sapiens P09466
- Interstitial collagenase / Homo sapiens P03956
- Kininogen-1 / Homo sapiens P01042
- Lactotransferrin / Homo sapiens P02788
- Nephronectin / Homo sapiens Q6UXI9
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Periostin / Homo sapiens Q15063
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Prothrombin / Homo sapiens P00734
- Serotransferrin / Homo sapiens P02787
- Thrombospondin-1 / Homo sapiens P07996
- Tissue-type plasminogen activator / Homo sapiens P00750
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Transmembrane protein 87A / Homo sapiens Q8NBN3
- Vitamin k-dependent protein c / Homo sapiens P04070
- WAP four-disulfide core domain protein 2 / Homo sapiens Q14508
- Intercellular adhesion molecule 5 / Mus musculus Q60625
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Batroxobin / Bothrops moojeni
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Acetabular Part of Hip Bone (UBERON_0001269) HT-1080 (CVCL_0317) Fibroblast (CL_0000057)
- Amniotic Fluid (UBERON_0000173)
- Brain (UBERON_0000955)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
Source
- N-Linked / Complex / NeuAc(a2-3)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9502
- N-Linked / Complex / Structure 9675
- N-Linked / Complex / Structure 10053
- N-Linked / Complex / Structure 10080
- N-Linked / Complex / Structure 10698
Reported structure
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Fibrosarcoma (DOID:3355)
- Melanoma (DOID:1909)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
Disease
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
- Novel Asn-linked oligosaccharides terminating in GalNAc beta (1-->4)[Fuc alpha (1-->3)]GlcNAc beta (1-->.) are present in recombinant human protein C expressed in human kidney 293 cells. (1993 - Yan S, Chao Y, van Halbeek H) / Status : Reviewed
- A novel sialylated N-acetylgalactosamine-containing oligosaccharide is the major complex-type structure present in Bowes melanoma tissue plasminogen activator. (1991 - Chan A, Morris H, Panico M, Etienne A, Rogers M, Gaffney P, Creighton-Kempsford L, Dell A) / Status : Reviewed
Reference
- Alpha-S1-casein / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Clusterin / Homo sapiens
- GDNF family receptor alpha-1 / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Glycodelin-a / Homo sapiens
- Interstitial collagenase / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Nephronectin / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Prothrombin / Homo sapiens
- Serotransferrin / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tissue-type plasminogen activator / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Transmembrane protein 87A / Homo sapiens
-
Vitamin k-dependent protein c / Homo sapiens
- Undefined site
- WAP four-disulfide core domain protein 2 / Homo sapiens
- Intercellular adhesion molecule 5 / Mus musculus
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Batroxobin / Bothrops moojeni
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- WFSAGLASNSSWLR (14aa)
- ETNFSIASGIEAK (13aa)
- NTTIFLK (7aa)
- RNESTQNCVVAEPEKM (16aa)
- NK (2aa)
- NKSVLLGR (8aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRY (32aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- ADGTVNQIEGEATPVNLTEPAKLEVK (26aa)
- TFYWDFYTNR (10aa)
- FYIQNFTALPLNTVVPPQR (19aa)
- YPHKPEINSTTHPGADLQENFCR (23aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- IINTTDVYIIPSINPDGFER (20aa)
- TYTYADTPDDFQIHNFSIPEEDTK (24aa)
- REDHRVNFSCLAELDLR (17aa)
- GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
- FHLANR (6aa)
- MIENGSISFIPTIR (14aa)
- GNGTILK (7aa)
- NGTITDAVDCALDPLSE (17aa)
- ITDIENGSIANIPR (14aa)
- LNAENNATFYFK (12aa)
- IIQVVYIHSNNITK (14aa)
- LQVVYLHSNNITK (13aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- GEVFNATR (8aa)
- IANITQGEDQYYIR (14aa)
- CGLVPVLAENYNK (13aa)
- EVNDTLLVNELK (12aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2161.0134)
- Venom (UBERON_0007113)
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex
(avg mass : 2161.0134)
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Novel Asn-linked oligosaccharides terminating in GalNAc beta (1-->4)[Fuc alpha (1-->3)]GlcNAc beta (1-->.) are present in recombinant human protein C expressed in human kidney 293 cells. (1993 - Yan S, Chao Y, van Halbeek H) / Status : Reviewed
-
Vitamin k-dependent protein c / Homo sapiens
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2161.0134)
- Melanoma (DOID:1909)
- Tissue-type plasminogen activator / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2161.0134)
- Amniotic Fluid (UBERON_0000173)
- Glycodelin-a / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2161.0134)
- Fibrosarcoma (DOID:3355)
- Interstitial collagenase / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2161.0134)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- RNESTQNCVVAEPEKM (16aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRY (32aa)
-
- N-Linked / Complex
(avg mass : 2161.0134)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2161.0134)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- NGTITDAVDCALDPLSE (17aa)
-
- N-Linked / Complex
(avg mass : 2161.0134)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
-
- N-Linked / Complex
(avg mass : 2161.0134)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- Hex:3 HexNAc:6 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2161.0134)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Seminal Fluid (UBERON_0006530)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / NeuAc(a2-3)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9502
- N-Linked / Complex / Structure 9675
- N-Linked / Complex / Structure 10053
- N-Linked / Complex / Structure 10080
- N-Linked / Complex / Structure 10698
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Apolipoprotein D / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Clusterin / Homo sapiens
- GDNF family receptor alpha-1 / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Nephronectin / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Prothrombin / Homo sapiens
- Serotransferrin / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Transmembrane protein 87A / Homo sapiens
- WAP four-disulfide core domain protein 2 / Homo sapiens
- Intercellular adhesion molecule 5 / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- WFSAGLASNSSWLR (14aa)
- ETNFSIASGIEAK (13aa)
- NTTIFLK (7aa)
- NKSVLLGR (8aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- ADGTVNQIEGEATPVNLTEPAKLEVK (26aa)
- TFYWDFYTNR (10aa)
- FYIQNFTALPLNTVVPPQR (19aa)
- YPHKPEINSTTHPGADLQENFCR (23aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- IINTTDVYIIPSINPDGFER (20aa)
- TYTYADTPDDFQIHNFSIPEEDTK (24aa)
- REDHRVNFSCLAELDLR (17aa)
- GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
- FHLANR (6aa)
- MIENGSISFIPTIR (14aa)
- GNGTILK (7aa)
- ITDIENGSIANIPR (14aa)
- LNAENNATFYFK (12aa)
- IIQVVYIHSNNITK (14aa)
- LQVVYLHSNNITK (13aa)
- RFPNIT (6aa)
- GEVFNATR (8aa)
- IANITQGEDQYYIR (14aa)
- CGLVPVLAENYNK (13aa)
- EVNDTLLVNELK (12aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:6 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2161.0134)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2161.0134)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2161.0134)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2161.0134)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2161.0134)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2161.0134)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2161.0134)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2161.0134)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2161.0134)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2161.0134)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2161.0134)