taxonomy (8)
protein (22)
source (14)
structure (27)
composition (1)
disease (6)
reference (18)
site (34)
peptide (30)
- Homo sapiens (Human)
- Sus scrofa (Pig)
- Bufo bufo (European toad)
- Rana clamitans (Green frog)
- Drosophila melanogaster (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Ceramide synthase 2 / Homo sapiens Q96G23
- Endoplasmin / Homo sapiens P14625
- Integrin beta-1 / Homo sapiens P05556
- Lactotransferrin / Homo sapiens P02788
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Myeloblastin / Homo sapiens P24158
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- RNA polymerase II elongation factor ELL2 / Homo sapiens O00472
- Uncharacterized protein from Urine / Homo sapiens
- Unspecified mucin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Mucin / Sus scrofa
- Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Mucin / Bufo bufo
- Mucin / Rana clamitans
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Embryo (UBERON_0000922)
- Epithelium of Stomach (UBERON_0001276)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Mucosa of Stomach (UBERON_0001199)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Prefrontal Cortex (UBERON:0000451)
- Pulmonary Mucosa
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- T84 (CVCL_0555)
- Egg Cell Jelly Coat
Source
- N-Linked / Complex / Structure 348
- N-Linked / Complex / Fuc(a1-3)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9409
- N-Linked / Hybrid / Structure 9907
- N-Linked / Hybrid / Structure 11565
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 10066
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-?)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-2)][GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)GlcNAc(b1-6)[Gal(b1-3)]Gal(b1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)]GalNAc
Reported structure
- Hex:3 HexNAc:3 dHex:2 (avg mass : 1406.3135 )
Composition
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Fucosidosis (DOID:14500)
Disease
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Species specificity of O-linked carbohydrate chains of the oviducal mucins in amphibians: structural analysis of neutral oligosaccharide alditols released by reductive beta-elimination from the egg-jelly coats of Rana clamitans. (2002 - Delplace F, Maes E, Lemoine J, Strecker G) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Structural analysis of hexa to dodecaoligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
- Isolation and structural characterization of novel neutral oligosaccharide-alditols from respitatory-mucus glycoproteins of a patient suffering from bronchiectasis. 2. Structure of twelve hepta-to-nonasaccharide, six of which possess the GlcNAc beta(1----3)[Gal beta(1----4)GlcNAc beta(1----6)]Gal be (1991 - van Kuik J, de Waard P, Vliegenthart J, Klein A, Carnoy C, Lamblin G, Roussel P) / Status : Reviewed
- Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
- Structural characterization of neutral oligosaccharides of human H+Leb+ gastric mucin. (1984 - Slomiany B, Zdebska E, Slomiany A) / Status : Reviewed
- Structures of the oligosaccharide chains in swine trachea mucin glycoproteins. (1984 - Chandrasekaran EV, Rana SS, Davila M, Mendicino J) / Status : Reviewed
- Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed
Reference
- Ceramide synthase 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Myeloblastin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- RNA polymerase II elongation factor ELL2 / Homo sapiens
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Mucin / Sus scrofa
- Undefined site
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Rana clamitans
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- IWIPVNITWADIEDRDGR (18aa)
- FSNVTWF (7aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- HAIHVSGTNGTK (12aa)
- HAIHVSGTNGTKR (13aa)
- FHAIHVSGTNGTK (13aa)
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRY (32aa)
- IAVQFGPGFSWIANFTK (17aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- VGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPR (34aa)
- KDNTTVTR (8aa)
- RCMWSSALNSLNLSFAGLEQVPKG (24aa)
- GEVFNATR (8aa)
- GVFITNETGQPIIGK (15aa)
- LNNSSPNSSGGVK (13aa)
- KENSSEICSNNGECVCGQCVCR (22aa)
- QDVNCTEVPVAIHADQL (17aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- KNFTTAPAICHDGK (14aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGK (13aa)
- EGVFVSNGTHW (11aa)
- KNHTSPDVDLGDISGINASVVNIQK (25aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1406.3135)
- Milk (UBERON_0001913)
- Lactotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1406.3135)
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
- N-Linked / Complex
(avg mass : 1406.3135)
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
- N-Linked / Complex
(avg mass : 1406.3135)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Complex
(avg mass : 1406.3135)
- Milk (UBERON_0001913)
- Monocyte differentiation antigen cd14 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRY (32aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- RCMWSSALNSLNLSFAGLEQVPKG (24aa)
-
- N-Linked / Hybrid
(avg mass : 1406.3135)
- Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1406.3135)
-
- N-Linked / No-core
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1406.3135)
- BTI-Tn-5B1-4 (CVCL_C190)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- KNFTTAPAICHDGK (14aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
-
- O-Linked / Core 1
(avg mass : 1406.3135)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1406.3135)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1406.3135)
- Isolation and structural characterization of novel neutral oligosaccharide-alditols from respitatory-mucus glycoproteins of a patient suffering from bronchiectasis. 2. Structure of twelve hepta-to-nonasaccharide, six of which possess the GlcNAc beta(1----3)[Gal beta(1----4)GlcNAc beta(1----6)]Gal be (1991 - van Kuik J, de Waard P, Vliegenthart J, Klein A, Carnoy C, Lamblin G, Roussel P) / Status : Reviewed
- Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1406.3135)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1406.3135)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1406.3135)
- Egg Cell Jelly Coat
-
Mucin / Bufo bufo
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1406.3135)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1406.3135)
- Pulmonary Mucosa
-
Mucin / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1406.3135)
- Pulmonary Mucosa
- Cystic Fibrosis (DOID:1485)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1406.3135)
- Egg Cell Jelly Coat
-
Mucin / Rana clamitans
- Undefined site
-
- Hex:3 HexNAc:3 dHex:2 / N-Linked
(avg mass : 1406.3135)
- N-Linked / Complex / Structure 348
- N-Linked / Complex / Fuc(a1-3)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9409
- N-Linked / Hybrid / Structure 9907
- N-Linked / Hybrid / Structure 11565
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 10066
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Ceramide synthase 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Myeloblastin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- RNA polymerase II elongation factor ELL2 / Homo sapiens
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- IWIPVNITWADIEDRDGR (18aa)
- FSNVTWF (7aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- HAIHVSGTNGTK (12aa)
- HAIHVSGTNGTKR (13aa)
- FHAIHVSGTNGTK (13aa)
- IAVQFGPGFSWIANFTK (17aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- VGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPR (34aa)
- KDNTTVTR (8aa)
- GEVFNATR (8aa)
- GVFITNETGQPIIGK (15aa)
- LNNSSPNSSGGVK (13aa)
- KENSSEICSNNGECVCGQCVCR (22aa)
- QDVNCTEVPVAIHADQL (17aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGK (13aa)
- EGVFVSNGTHW (11aa)
- KNHTSPDVDLGDISGINASVVNIQK (25aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
-
- Hex:3 HexNAc:3 dHex:2 / O-Linked
(avg mass : 1406.3135)
- T84 (CVCL_0555)
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-?)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-2)][GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)GlcNAc(b1-6)[Gal(b1-3)]Gal(b1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)]GalNAc
- Colon adenocarcinoma (DOID:234)
Source
Suggested structure
Disease
Reported glycosite
- Hex:3 HexNAc:3 dHex:2 / O-Linked
(avg mass : 1406.3135)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:3 dHex:2 / N-Linked
(avg mass : 1406.3135)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1406.3135)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1406.3135)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1406.3135)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1406.3135)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1406.3135)
Reported glycosite
- O-Linked / Core 1
(avg mass : 1406.3135)
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 1406.3135)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1406.3135)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1406.3135)
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1406.3135)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1406.3135)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1406.3135)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1406.3135)
Reported glycosite
- N-Linked / Complex
(avg mass : 1406.3135)
Reported glycosite
- N-Linked / Complex
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1406.3135)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1406.3135)