Hex:4 HexNAc:4 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Torpedo californica (Pacific electric ray)
• Bothrops moojeni (Brazilian lancehead)
• Porcellio scaber
• Influenza a virus (strain a/fowl plague virus/rostock/34)

Protein

• Alpha-fetoprotein / Homo sapiens    P02771
• Angiotensinogen / Homo sapiens    P01019
• Asporin / Homo sapiens    Q9BXN1
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• Beta-secretase-fc fusion protein / Homo sapiens    P56817
• Biglycan / Homo sapiens    P21810
• Bile-salt-activated lipase / Homo sapiens    P19835
• Cartilage-associated protein / Homo sapiens    O75718
• CD59 glycoprotein / Homo sapiens    P13987
• Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens    O75503
• Chymotrypsin-like elastase family member 3B / Homo sapiens    P08861
• Clusterin / Homo sapiens    P10909
• Coagulation factor VIII / Homo sapiens    P00451
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-1(XIV) chain / Homo sapiens    Q05707
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Decorin / Homo sapiens    P07585
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens    P04843
• Epidermal growth factor receptor / Homo sapiens    P00533
• Erythropoietin / Homo sapiens    P01588
• Fibrillin-1 / Homo sapiens    P35555
• Fibronectin / Homo sapiens    P02751
• Fibulin-2 / Homo sapiens    P98095
• Fibulin-5 / Homo sapiens    Q9UBX5
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Hemopexin / Homo sapiens    P02790
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• IgG-IL2 fusion protein / Homo sapiens    P60568
• Immunoglobulin alpha (secretory) / Homo sapiens    P01876    P01877
• Immunoglobulin gamma / Homo sapiens    P01857    P01860    P01859    P01861
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa234] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin j chain / Homo sapiens    P01591
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interferon gamma / Homo sapiens    P01579
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens    Q14767
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Major prion protein / Homo sapiens    P04156
• Matrix metalloproteinase-9 / Homo sapiens    P14780
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Microfibril-associated glycoprotein 4 / Homo sapiens    P55083
• Mitogen-activated protein kinase 9 / Homo sapiens    P45984
• Mucin-5B / Homo sapiens    Q9HC84
• Nidogen-2 / Homo sapiens    Q14112
• Periostin / Homo sapiens    Q15063
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostatic acid phosphatase / Homo sapiens    P15309
• Protein sel-1 homolog 1 / Homo sapiens    Q9UBV2
• Serpin h1 / Homo sapiens    P50454
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens    O15389
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens    Q9Y286
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens    Q9NYZ4
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Thrombospondin-1 / Homo sapiens    P07996
• Uncharacterized protein from Fluid / Homo sapiens
• Uncharacterized protein from Meconium / Homo sapiens
• Uncharacterized protein from Serum / Homo sapiens
• Uromodulin / Homo sapiens    P07911
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Acetylcholinesterase / Bos taurus    P23795
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Corticotropin - lipotropin, npp peptide / Bos taurus    P01190
• Immunoglobulin gamma / Bos taurus
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Zona pellucida sperm-binding protein 2 / Bos taurus    Q9BH10
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
• Immunoglobulin gamma / Mus musculus
• Immunoglobulin gamma-1 / Mus musculus    P01868
• Immunoglobulin gamma-1 heterodimer / Mus musculus    P01868
• Immunoglobulin gamma-1 homodimer / Mus musculus    P01868
• Immunoglobulin gamma-2a heavy chain / Mus musculus
• Immunoglobulin gamma-2b / Mus musculus
• Immunoglobulin gamma-2b heterodimer / Mus musculus
• Immunoglobulin mu chain C region / Mus musculus    P01872
• Laminin subunit gamma-1 / Mus musculus    P02468
• Limbic system-associated membrane protein / Mus musculus    Q8BLK3
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus    P08101
• Monoclonal antibody okt3 / Mus musculus
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Tenascin-r / Mus musculus    Q8BYI9
• Teneurin-3 / Mus musculus    Q9WTS6
• Tetraspanin-2 / Mus musculus    Q922J6
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Zona pellucida sperm-binding protein matrix / Mus musculus    P20239    P10761    Q62005
• Immunoglobulin gamma / Oryctolagus cuniculus
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• Thy-1 membrane glycoprotein / Rattus norvegicus
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
• Zona pellucida sperm-binding protein 3 / Sus scrofa    P42098
• Zona pellucida sperm-binding proteins 3 and 4 / Sus scrofa    P42098    Q07287
• Immunoglobulin gamma / Gallus gallus
• Acetylcholine receptor protein / Torpedo californica    P02718    P02712    P02714    P02710
• Batroxobin / Bothrops moojeni
• Androgenic hormone / Porcellio scaber    Q817X1
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)    P03459

Source

• Androgenic  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Electric Organ (UBERON_0006869)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   6/9CII (CVCL_VT76)  
• Kidney (UBERON_0002113)   BHK-21A (CVCL_RQ70)  
• Kidney (UBERON_0002113)   COS-1 (CVCL_0223)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Meconium (UBERON_0007109)  
• Milk (UBERON_0001913)  
• Neurohypophysis (UBERON_0002198)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Ovary (UBERON_0000992)   CHO Pro-5 (CVCL_4382)  
• Ovary (UBERON_0000992)   CHO-K1 (CVCL_0214)  
• Ovary (UBERON_0000992)   IM4 (CVCL_VT63)  
• Ovary (UBERON_0000992)   IM4/Vm (CVCL_VT66)  
• Ovary (UBERON_0000992)   Lec2 (CVCL_3442)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Pituitary Gland (UBERON_0000007)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• Zona Pellucida (UBERON_0000086)  
• 15B (CVCL_VU59)  
• 26A7 (CVCL_VU60)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• CE (CVCL_6D96)  
• Hybrid 27-1 (CVCL_VU61)  
• J558L (CVCL_3949)  
• NS0 (CVCL_3940)  
• P3X63Ag8 (CVCL_3411)  
• P3X63Ag8U.1 (CVCL_3412)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  
• Sp2/HL-BU (CVCL_VT74)  
• Neutrophil (CL_0000775)  
• Microsome (GO_0005792)  

Reported structure

• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
• N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
• N-Linked / Complex / Gal(?1-4)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GlcNAc"
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-4)][Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Hybrid / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Hybrid / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 2719
• N-Linked / Complex / Hex(?1-?)GlcNAc(?1-?)Man(?1-?)[GlcNAc(?1-?)Man(?1-?)]Man(?1-?)GlcNAc(?1-?)[Fuc(?1-?)]GlcNAc

Composition

• Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 )

Disease

• Arthritis (DOID:848)
• Arthritis, Rheumatoid (DOID:7148)
• Cancer, breast (DOID:1612)
• Myeloma (DOID:0070004)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Ovarian cyst (DOID:5119)
• Plasmacytoma (Mouse) (DOID:3721)
• Prostate cancer (DOID:10283)
• Sjogren's Syndrome (DOID:12894)

Reference

• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Glycomic analysis of high density lipoprotein shows a highly sialylated particle (2014 - Huang J1, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• The glycosylated androgenic hormone of the terrestrial isopod Porcellio scaber (Crustacea). (2004 - Greve P, Braquart-Varnier C, Strub JM, Felix C, Van Dorsselaer A, Martin G) / Status : Reviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
• Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
• Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
• Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
• A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
• In vivo trafficking and catabolism of IgG1 antibodies with Fc associated carbohydrates of differing structure. (2000 - Wright A, Sato Y, Okada T, Chang K, Endo T, Morrison S) / Status : Reviewed
• Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Carbohydrate release from picomole quantities of glycoprotein and characterisation of glycans by high-performance liquid chromatography and mass spectrometry. (1999 - Charlwood J, Birrell H, Camilleri P) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Localization of neutral N-linked carbohydrate chains in pig zona pellucida glycoprotein ZPC. (1999 - Yonezawa N, Fukui N, Kudo K, Nakano M) / Status : Reviewed
• N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
• Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
• Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
• Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
• The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
• The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
• Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
• Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• A simple method for the release of asparagine-linked oligosaccharides from a glycoprotein purified by SDS-polyacrylamide gel electrophoresis. (1992 - Kawashima H, Murata T, Yamamoto K, Tateishi A, Irimura T, Osawa T) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Structural analysis of the N-linked carbohydrate chains of the 55-kDa glycoprotein family (PZP3) from porcine zona pellucida. (1992 - Noguchi S, Hatanaka Y, Tobita T, Nakano M) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
• The polypeptide of immunoglobulin G influences its galactosylation in vivo. (1990 - Lee S, Connolly J, Ramirez-Soto D, Poretz R) / Status : Reviewed
• A protein structural change in aglycosylated IgG3 correlates with loss of huFc gamma R1 and huFc gamma R111 binding and/or activation. (1990 - Lund J, Tanaka T, Takahashi N, Sarmay G, Arata Y, Jefferis R) / Status : Reviewed
• The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
• The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
• Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
• Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed

Reported glycosite

• Alpha-fetoprotein / Homo sapiens
  •        Asn-251
• Angiotensinogen / Homo sapiens
  •        Asn-304
• Asporin / Homo sapiens
  •        Asn-282
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-3780
• Beta-secretase-fc fusion protein / Homo sapiens
  •        Undefined site
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Bile-salt-activated lipase / Homo sapiens
  •        Undefined site
• Cartilage-associated protein / Homo sapiens
  •        Asn-363
• CD59 glycoprotein / Homo sapiens
  •        Undefined site
• Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
  •        Asn-271
• Chymotrypsin-like elastase family member 3B / Homo sapiens
  •        Asn-114
• Clusterin / Homo sapiens
  •        Asn-354
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2679
• Collagen alpha-1(XIV) chain / Homo sapiens
  •        Asn-94
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-31
• Decorin / Homo sapiens
  •        Asn-211
  •        Asn-262
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-119
  •        Asn-276
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens
  •        Asn-299
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-196
• Erythropoietin / Homo sapiens
  •        Asn-51
• Fibrillin-1 / Homo sapiens
  •        Asn-1902
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-542
  •        Asn-1236
• Fibulin-2 / Homo sapiens
  •        Asn-1035
• Fibulin-5 / Homo sapiens
  •        Asn-296
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-63
• Hemopexin / Homo sapiens
  •        Asn-246
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-830
• IgG-IL2 fusion protein / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha (secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa234] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-205
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
  •        Asn-227
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
• Immunoglobulin j chain / Homo sapiens
  •        Asn-71
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-207
  •        Asn-517
  •        Asn-577
• Interferon gamma / Homo sapiens
  •        Undefined site
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1241
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
  •        Asn-421
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-249
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
  •        Asn-356
• Major prion protein / Homo sapiens
  •        Asn-197
• Matrix metalloproteinase-9 / Homo sapiens
  •        Undefined site
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2007
  •        Asn-2693
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Microfibril-associated glycoprotein 4 / Homo sapiens
  •        Asn-137
• Mitogen-activated protein kinase 9 / Homo sapiens
  •        Asn-384
• Mucin-5B / Homo sapiens
  •        Asn-5046
• Nidogen-2 / Homo sapiens
  •        Asn-693
  •        Asn-703
• Periostin / Homo sapiens
  •        Asn-599
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-135
  •        Asn-469
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostatic acid phosphatase / Homo sapiens
  •        Asn-333
• Protein sel-1 homolog 1 / Homo sapiens
  •        Asn-431
• Serpin h1 / Homo sapiens
  •        Asn-120
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens
  •        Undefined site
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Uncharacterized protein from Fluid / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Serum / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-275
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Corticotropin - lipotropin, npp peptide / Bos taurus
  •        Asn-91
• Immunoglobulin gamma / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Zona pellucida sperm-binding protein 2 / Bos taurus
  •        Undefined site
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-307
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-505
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
  •        Undefined site
• Immunoglobulin gamma / Mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 / Mus musculus
  •        Asn-174
• Immunoglobulin gamma-1 heterodimer / Mus musculus
  •        Asn-174
• Immunoglobulin gamma-1 homodimer / Mus musculus
  •        Asn-174
• Immunoglobulin gamma-2a heavy chain / Mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b / Mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b heterodimer / Mus musculus
  •        Undefined site
• Immunoglobulin mu chain C region / Mus musculus
  •        Asn-280
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
  •        Asn-1221
  •        Asn-1239
• Limbic system-associated membrane protein / Mus musculus
  •        Asn-300
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
  •        Undefined site
• Monoclonal antibody okt3 / Mus musculus
  •        Undefined site
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Tenascin-r / Mus musculus
  •        Undefined site
• Teneurin-3 / Mus musculus
  •        Asn-2140
• Tetraspanin-2 / Mus musculus
  •        Asn-139
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Zona pellucida sperm-binding protein matrix / Mus musculus
  •        Undefined site
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• Thy-1 membrane glycoprotein / Rattus norvegicus
  •        Undefined site
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Zona pellucida sperm-binding protein 3 / Sus scrofa
  •        Asn-124
  •        Asn-146
  •        Asn-271
• Zona pellucida sperm-binding proteins 3 and 4 / Sus scrofa
  •        Undefined site
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Batroxobin / Bothrops moojeni
  •        Undefined site
• Androgenic hormone / Porcellio scaber
  •        Undefined site
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
  •        Asn-249

Mass spectrometry observed peptide

• YVNMSNHHR (9aa)
  •    P08185    Asn-31
• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42
• NAPLVNVTLYYEALCGGCR (19aa)
  •    P13284    Asn-63
• IIVPINNRENISDPTSPIR (19aa)
  •    P01591    Asn-71
• AIIQGLMPDQNYTVQIIAYNK (21aa)
  •    Q05707    Asn-94
• DIVEYYNDSNGSHVIQGR (18aa)
  •    P25311    Asn-109
• VTTYCNETMTGWVHDVIGR (19aa)
  •    P53634    Asn-119
• SISNSTAR (8aa)
  •    P50454    Asn-120
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• FGCEIENNRSSGAFWK (16aa)
  •    P25311    Asn-128
• VDIEDFENNTAYAK (14aa)
  •    P55083    Asn-137
• ARGNGTLITFHSAFQCCGK (19aa)
  •    Q922J6    Asn-139
• TKPREEQFNSTFR (13aa)
  •    P01859    Asn-176
• EEQFNSTFR (9aa)
  •    P01859    Asn-176
• EEQFNSTF (8aa)
  •    P01859    Asn-176
• EEQFNSTY (8aa)
  •    P01861    Asn-177
• EEQFNSTYR (9aa)
  •    P01861    Asn-177
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• EEQYNSTYRVVSVLTVLHQDWLNGK (25aa)
  •    P01857    Asn-180
• TKPREEQYNSTY (12aa)
  •    P01857    Asn-180
• TKPREEQYNSTYR (13aa)
  •    P01857    Asn-180
• EEQYNSTY (8aa)
  •    P01857    Asn-180
• CDPSCPNGSCWGAGEENCQK (20aa)
  •    P00533    Asn-196
• GENFTETDVK (10aa)
  •    P04156    Asn-197
• TPLTANITK (9aa)
  •    P01877    Asn-205
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211
• EEQYNSTFR (9aa)
  •    P01860    Asn-227
• KDNTTVTR (8aa)
  •    P11279    Asn-249
• IININPNK (8aa)
  •    P11279    Asn-261
• GLSFNSISAVDNGSLANTPHLR (22aa)
  •    P07585    Asn-262
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• IFLYSGEPTYLGNETSVFGPTGNK (24aa)
  •    O75503    Asn-271
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Asn-275
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276
• IMESHPNGTFSAK (13aa)
  •    P01872    Asn-280
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282
• VIYQNHNK (8aa)
  •    P11627    Asn-293
• SCQDINECEHRNHTCNLQQTCYNLQGGFK (29aa)
  •    Q9UBX5    Asn-296
• DEIGNVSTSHIIIIDDSVEMEIRPR (25aa)
  •    P04843    Asn-299
• LGVTNASLVLFRPGSVR (17aa)
  •    Q8BLK3    Asn-300
• FFHVNGSAFLPR (12aa)
  •    Q9DB72    Asn-307
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311
• NETQHEPYPLMLPGCSPSCPLER (23aa)
  •    P15309    Asn-333
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360
• DTWGISDEHFQPRPEAVQFFNVTTIQK (27aa)
  •    O75718    Asn-363
• DQPSDAAVSSNATPSQSSSINDI (23aa)
  •    P45984    Asn-384
• DECWCPANSTGK (12aa)
  •    Q14767    Asn-421
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430
• GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
  •    P02751    Asn-430
• GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
  •    P02751    Asn-430
• MYSEGSDIVPQSNETAIHYFK (21aa)
  •    Q9UBV2    Asn-431
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469
• CEGPGVPTVTVHNTTDKR (18aa)
  •    Q9Z218    Asn-505
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• EVNDTLLVNEL (11aa)
  •    Q15063    Asn-599
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• DYSITFGAINQTWSYR (16aa)
  •    Q14112    Asn-693
• IHQNITYQVCR (11aa)
  •    Q14112    Asn-703
• ISAIDNIINHSSMFIK (16aa)
  •    Q9Y4L1    Asn-830
• DVDECAIGTHNCSEAETCHNIQGSFR (26aa)
  •    P98095    Asn-1035
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105
• TLAGENQTALEIEELNR (17aa)
  •    P02468    Asn-1221
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236
• KYEQAKNISQDLEK (14aa)
  •    P02468    Asn-1239
• NISQDLEK (8aa)
  •    P11047    Asn-1241
• NISQDLEK (8aa)
  •    P02468    Asn-1239
• YEQAKNISQDLEK (13aa)
  •    P02468    Asn-1239
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763
• DACGNGTCR (9aa)
  •    P35555    Asn-1902
• ITLHENR (7aa)
  •    Q9NR99    Asn-2007
• EIKIGPFANTTK (12aa)
  •    Q9WTS6    Asn-2140
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679
• VSIIDNGTITVR (12aa)
  •    Q9NR99    Asn-2693
• SLTQGSLIVGDLAPVNGTSQGK (22aa)
  •    P98160    Asn-3780
• VVLLDPKPVANVTCVNK (17aa)
  •    Q9HC84    Asn-5046