Hex:10 HexNAc:9 dHex:1

Taxonomy

• Homo sapiens (Human)
• Mesocricetus auratus (Golden hamster)
• Rattus norvegicus (Norway rat)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Bone marrow stromal antigen 2 / Homo sapiens    Q10589
• CD59 glycoprotein / Homo sapiens    P13987
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Erythropoietin / Homo sapiens    P01588
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens    P32942
• Uromodulin / Homo sapiens    P07911
• Uncharacterized protein / Rattus norvegicus    
• Uncharacterized protein / Rattus norvegicus    
• Uncharacterized protein / Rattus norvegicus    
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   BHK21/13/Py6 (CVCL_LM74)   Plasma Membrane (GO_0005886)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Urine (UBERON_0001088)  
• 3Y1-B clone 1 (CVCL_4563)  
• CHO (CVCL_0213)  
• T-Lymphocyte (CL_0000084)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 4 x Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 9367

Composition

• Hex:10 HexNAc:9 dHex:1 (avg mass : 3614.3373 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Prostate cancer (DOID:10283)

Reference

• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50). (2001 - Funatsu O, Sato T, Kotovuori P, Gahmberg CG, Ikekita M, Furukawa K) / Status : Reviewed
• Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
• Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
• Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-381
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-271
• Bone marrow stromal antigen 2 / Homo sapiens
  •        Asn-65
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-294
• Erythropoietin / Homo sapiens
  •        Undefined site
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-513
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331

Mass spectrometry observed peptide

• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• NVTHIIQQEITEAQK (15aa)
  •    Q10589    Asn-65     Bone marrow stromal antigen 2 / Homo sapiens
• KYTGNASALFILPDQDKM (18aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
  •    Q9Y5L3    Asn-294     Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IIIAGTNSSDIQQIISIIESNK (22aa)
  •    P08195    Asn-381     4F2 cell-surface antigen heavy chain / Homo sapiens
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens