taxonomy (14)
protein (75)
source (21)
structure (30)
composition (1)
disease (3)
reference (35)
site (98)
peptide (90)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Capra hircus (Goat)
- Mus musculus (House mouse)
- Nasua narica (White-nosed coati)
- Pongo pygmaeus (Orangutan)
- Rattus norvegicus (Norway rat)
- Ursus americanus (Black bear)
- Todarodes pacificus (Japanese flying squid)
- Trichinella spiralis
- Megathura crenulata (Californian giant keyhole limpet)
- Apis mellifera (Honeybee)
- Drosophila melanogaster (Fruit fly)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Acid ceramidase / Homo sapiens Q13510
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-fetoprotein / Homo sapiens P02771
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Apolipoprotein D / Homo sapiens P05090
- Arylsulfatase a / Homo sapiens P15289
- C-type mannose receptor 2 / Homo sapiens Q9UBG0
- Cap-gly domain-containinglinker protein 1 / Homo sapiens P30622
- Cathepsin D / Homo sapiens P07339
- Cation-independent mannose-6-phosphate receptor / Homo sapiens P11717
- Ceramide synthase 2 / Homo sapiens Q96G23
- Ceramide synthase 6 / Homo sapiens Q6ZMG9
- Clusterin / Homo sapiens P10909
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Endoplasmin / Homo sapiens P14625
- Fibrillin-1 / Homo sapiens P35555
- Fibrillin-2 / Homo sapiens P35556
- Fibrillin-3 / Homo sapiens Q75N90
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Integrin beta-1 / Homo sapiens P05556
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens Q14767
- Low-density lipoprotein receptor / Homo sapiens P01130
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Multimerin-1 / Homo sapiens Q13201
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- Neurocan core protein / Homo sapiens O14594
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Prenylcysteine oxidase 1 / Homo sapiens Q9UHG3
- Prosaposin / Homo sapiens P07602
- Serpin h1 / Homo sapiens P50454
- Sortilin-related receptor / Homo sapiens Q92673
- Sulfhydryl oxidase 1 / Homo sapiens O00391
- Tenascin / Homo sapiens P24821
- Thyroglobulin / Homo sapiens P01266
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Transmembrane protein 245 / Homo sapiens Q9H330
- Tryptase alpha/beta-1 / Homo sapiens Q15661
- Tryptase beta-2 / Homo sapiens P20231
- Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens P78324
- Thyrotropin-aplha and beta chains / Bos taurus P01217 P01223
- Mucin / Capra hircus
- Cathepsin D / Mus musculus P18242
- G-protein coupled receptor 56 / Mus musculus Q8K209
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Immunoglobulin superfamily member 8 / Mus musculus Q8R366
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Lysosomal acid phosphatase / Mus musculus P24638
- Lysosomal alpha-glucosidase / Mus musculus P70699
- Lysosome-associated membrane glycoprotein 2 / Mus musculus P17047
- Metabotropic glutamate receptor 3 / Mus musculus Q9QYS2
- Myelin-associated glycoprotein / Mus musculus P20917
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Reticulocalbin-1 / Mus musculus Q05186
- Signal-regulatory protein alpha / Mus musculus P97797
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Wolframin / Mus musculus P56695
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Rhodopsin / Todarodes pacificus P31356
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Phospholipase a2 / Apis mellifera P00630
- Uncharacterized protein / Drosophila melanogaster
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Cerebellum (UBERON_0002037)
- Embryo (UBERON_0000922)
- Frontal Cortex (UBERON_0001870)
- Hemolymph (UBERON_0001011)
- Hippocampul formation (UBERON:0002421)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- neocortex (UBERON:0001950)
- Pituitary Gland (UBERON_0000007)
- Placenta (UBERON_0001987)
- Retina (UBERON_0000966) Plasma Membrane (GO_0005886)
- Striatum (UBERON_0002345)
- Submandibular Gland (UBERON_0001736)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Venom (UBERON_0007113)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- HEK293T (CVCL_0063)
Source
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-3)]Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / [Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-2)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc
- Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9217
- Free / Lactose / Structure 10114
- Free / Lactose / Structure 10842
- Free / Lactose / Structure 10843
- N-Linked / High-Mannose / Man(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-3)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-?)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Gal(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Gal(b1-4)Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 9888
- N-Linked / Pauci-Mannose / Structure 11838
- N-Linked / Pauci-Mannose / Structure 11932
- N-Linked / Undefined core / Structure 9834
- O-Linked / Undefined core / Man(?1-4)[Man(?1-6)]Glc(?1-4)GlcNAc(?1-4)[Fuc(?1-2)]Gal(?1-3)GalNAc
Reported structure
- Hex:4 HexNAc:2 dHex:1 (avg mass : 1219.1179 )
Composition
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
- N-Glycosylation in isolated rat nerve terminals (2021 - Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia MartÃnez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- N-glycan structures of squid rhodopsin. Existence of the alpha1-3 and alpha1-6 difucosylated innermost GlcNAc residue in a molluscan glycoprotein. (2003 - Takahashi N, Masuda K, Hiraki K, Yoshihara K, Huang HH, Khoo KH, Kato K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Chemical characterisation of the oligosaccharides in a sample of milk of a white-nosed coati, Nasua narica (Procyonidae: Carnivora). (1999 - Urashima T, Yamamoto M, Nakamura T, Arai I, Saito T, Namiki M, Yamaoka K, Kawahara K) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Structures of carbohydrate chains of glycoprotein isolated from goat submaxillary mucin. (1982 - Dutta B, Rao C) / Status : Reviewed
- Oligosaccharides of human milk: Structural studies of Di- and trifucosyl derivatives of lacto-N-octaose and lacto-N-neooctaose (1978 - Yoko Tachibana, Katsuko Yamashita, Akira Kobata) / Status : Reviewed
Reference
- Acid ceramidase / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-fetoprotein / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-n-acetylgalactosaminidase / Homo sapiens
- Apolipoprotein D / Homo sapiens
-
Arylsulfatase a / Homo sapiens
- Undefined site
- C-type mannose receptor 2 / Homo sapiens
- Cap-gly domain-containinglinker protein 1 / Homo sapiens
- Cathepsin D / Homo sapiens
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Ceramide synthase 6 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Endoplasmin / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
- Low-density lipoprotein receptor / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Multimerin-1 / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Neurocan core protein / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Prosaposin / Homo sapiens
- Serpin h1 / Homo sapiens
- Sortilin-related receptor / Homo sapiens
- Sulfhydryl oxidase 1 / Homo sapiens
- Tenascin / Homo sapiens
- Thyroglobulin / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Transmembrane protein 245 / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tryptase beta-2 / Homo sapiens
- Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Mucin / Capra hircus
- Undefined site
- Cathepsin D / Mus musculus
- G-protein coupled receptor 56 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Lysosomal acid phosphatase / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Wolframin / Mus musculus
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Rhodopsin / Todarodes pacificus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- FWIPHNVTWADIK (13aa)
- IWIPVNITWADIEDRDGR (18aa)
- HENNTKDNSIQHEFSLTR (18aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- VAGTAVSISCNVSDYEGPAQQDFEWFMYRPEAPATSLGIVSTK (43aa)
- FSNVTWF (7aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- APLVNVTLYYEALCGGCR (18aa)
- NAPLVNVTLYYEALCGGCR (19aa)
- HAIHVSGTNGTKRF (14aa)
- DNATQEEILHYLEK (14aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- IRNVSDTTKR (10aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- NCTLLLSTLSPELGGK (16aa)
- GHTITINFTR (10aa)
- DAMVGNYTCEVTELSR (16aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- SISNSTAR (8aa)
- ANATLLLGPLR (11aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- LGIYADMGNFTCMGYPGTTLDK (22aa)
- NGSGAVFPVAGADVQTLR (18aa)
- LENLSSTESGYTATLTR (17aa)
- QGAPLIATSVSSWQIPQNTSLPGAPSFIFSFHNAPHK (37aa)
- CNSVLTYNLTPVVQK (15aa)
- AGPNGTLFVADAYK (14aa)
- VYSSANNCTFEY (12aa)
- QTPEYQNR (8aa)
- IIHAIGGDDFIGMINR (16aa)
- EDVYRNHSIFIADINQER (18aa)
- NHSIFLADINQER (13aa)
- NFTMNEK (7aa)
- NPCTSEQNCTSPFSYK (16aa)
- GINESYK (7aa)
- TNSSFIQGFVDHVKEDCDR (19aa)
- SIVYSCEWPIYMWPFQKPNYTEIR (24aa)
- VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa)
- KDNTTVTR (8aa)
- YQYVDCGRNTT (11aa)
- IININPNK (8aa)
- YYHGELSYLNVTR (13aa)
- GSLSYLNVTRK (11aa)
- GSISYINVTR (10aa)
- VTQQSPTSMNQVNLTCR (17aa)
- IIAPAYFIIGGNQSGEGCVITR (22aa)
- ALIYQFSPIYTGNISSFQQ (19aa)
- FPNITNL (7aa)
- IIDNNKTEK (9aa)
- GEVFNATR (8aa)
- CPFGEVFNATR (11aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- VQPFNVTQGK (10aa)
- GIKPNQTSK (9aa)
- YHNQTIR (7aa)
- DECWCPANSTGK (12aa)
- NLEKNSTK (8aa)
- INFTAPFNPNK (11aa)
- KLVLYLEHNLEKNSTKEEILAALEK (25aa)
- NSTKEEILAALEK (13aa)
- LVLYLEHNLEKNSTKEEILAALEK (24aa)
- VFGSQNITTVK (11aa)
- NVTHSGR (7aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- NCTSFR (6aa)
- VLFHNLTQPR (10aa)
- VPGNQTSTTLK (11aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- CLYGEAYPSCSSGNTSTAEEELCR (24aa)
- VINETWAWK (9aa)
- NATLAEQAK (9aa)
- AEPPINASASDQGEK (15aa)
- AEPPLNASAGDQEEK (15aa)
- INYSIPTGQWVGVQIPR (17aa)
- NCTDIDECR (9aa)
- VPAQEKNF (8aa)
- HVTYVPAQEKNF (12aa)
- EGVFVSNGTHW (11aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- FYFGGSPISAQYANFTGCISNAYFTR (26aa)
- TIETHSNK (8aa)
- NLQVYNATSNSLTVK (15aa)
- VETGENCTSPAPK (13aa)
- GVTHLNISGLK (11aa)
Mass spectrometry observed peptide
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Oligosaccharides of human milk: Structural studies of Di- and trifucosyl derivatives of lacto-N-octaose and lacto-N-neooctaose (1978 - Yoko Tachibana, Katsuko Yamashita, Akira Kobata) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia MartÃnez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
- Oligosaccharides of human milk: Structural studies of Di- and trifucosyl derivatives of lacto-N-octaose and lacto-N-neooctaose (1978 - Yoko Tachibana, Katsuko Yamashita, Akira Kobata) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Oligosaccharides of human milk: Structural studies of Di- and trifucosyl derivatives of lacto-N-octaose and lacto-N-neooctaose (1978 - Yoko Tachibana, Katsuko Yamashita, Akira Kobata) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1219.1179)
- Milk (UBERON_0001913)
-
- N-Linked / High-Mannose
(avg mass : 1219.1179)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1219.1179)
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1219.1179)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Carcinoma, Hepatocellular (DOID:684)
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1219.1179)
- Venom (UBERON_0007113)
- Phospholipase a2 / Apis mellifera
-
- N-Linked / High-Mannose
(avg mass : 1219.1179)
- neocortex (UBERON:0001950)
- Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1219.1179)
- Placenta (UBERON_0001987)
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
-
Arylsulfatase a / Homo sapiens
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1219.1179)
- Hemolymph (UBERON_0001011)
-
Hemocyanin / Megathura crenulata
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1219.1179)
-
Rhodopsin / Todarodes pacificus
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1219.1179)
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1219.1179)
- HEK293T (CVCL_0063)
- Adipocyte plasma membrane-associated protein / Homo sapiens
- AGPNGTLFVADAYK (14aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1219.1179)
- Cerebellum (UBERON_0002037)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Striatum (UBERON_0002345)
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- N-Glycosylation in isolated rat nerve terminals (2021 - Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR) / Status : Reviewed
-
- N-Linked / Undefined core
(avg mass : 1219.1179)
- Embryo (UBERON_0000922)
-
- O-Linked / Undefined core
(avg mass : 1219.1179)
-
Mucin / Capra hircus
- Undefined site
-
- Hex:4 HexNAc:2 dHex:1 / N-Linked
(avg mass : 1219.1179)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / High-Mannose / Man(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-3)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-?)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Gal(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Gal(b1-4)Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 9888
- N-Linked / Pauci-Mannose / Structure 11838
- N-Linked / Pauci-Mannose / Structure 11932
- N-Linked / Undefined core / Structure 9834
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Acid ceramidase / Homo sapiens
- Alpha-fetoprotein / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-n-acetylgalactosaminidase / Homo sapiens
- Apolipoprotein D / Homo sapiens
- C-type mannose receptor 2 / Homo sapiens
- Cap-gly domain-containinglinker protein 1 / Homo sapiens
- Cathepsin D / Homo sapiens
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Ceramide synthase 6 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Endoplasmin / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
- Low-density lipoprotein receptor / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Multimerin-1 / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Neurocan core protein / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Prosaposin / Homo sapiens
- Serpin h1 / Homo sapiens
- Sortilin-related receptor / Homo sapiens
- Sulfhydryl oxidase 1 / Homo sapiens
- Tenascin / Homo sapiens
- Thyroglobulin / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Transmembrane protein 245 / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tryptase beta-2 / Homo sapiens
- Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens
- Cathepsin D / Mus musculus
- G-protein coupled receptor 56 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Lysosomal acid phosphatase / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Wolframin / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- FWIPHNVTWADIK (13aa)
- IWIPVNITWADIEDRDGR (18aa)
- HENNTKDNSIQHEFSLTR (18aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- VAGTAVSISCNVSDYEGPAQQDFEWFMYRPEAPATSLGIVSTK (43aa)
- FSNVTWF (7aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- APLVNVTLYYEALCGGCR (18aa)
- NAPLVNVTLYYEALCGGCR (19aa)
- HAIHVSGTNGTKRF (14aa)
- DNATQEEILHYLEK (14aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- IRNVSDTTKR (10aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- NCTLLLSTLSPELGGK (16aa)
- GHTITINFTR (10aa)
- DAMVGNYTCEVTELSR (16aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- SISNSTAR (8aa)
- ANATLLLGPLR (11aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- LGIYADMGNFTCMGYPGTTLDK (22aa)
- NGSGAVFPVAGADVQTLR (18aa)
- LENLSSTESGYTATLTR (17aa)
- QGAPLIATSVSSWQIPQNTSLPGAPSFIFSFHNAPHK (37aa)
- CNSVLTYNLTPVVQK (15aa)
- VYSSANNCTFEY (12aa)
- QTPEYQNR (8aa)
- IIHAIGGDDFIGMINR (16aa)
- EDVYRNHSIFIADINQER (18aa)
- NHSIFLADINQER (13aa)
- NFTMNEK (7aa)
- NPCTSEQNCTSPFSYK (16aa)
- GINESYK (7aa)
- TNSSFIQGFVDHVKEDCDR (19aa)
- SIVYSCEWPIYMWPFQKPNYTEIR (24aa)
- VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa)
- KDNTTVTR (8aa)
- YQYVDCGRNTT (11aa)
- IININPNK (8aa)
- YYHGELSYLNVTR (13aa)
- GSLSYLNVTRK (11aa)
- GSISYINVTR (10aa)
- VTQQSPTSMNQVNLTCR (17aa)
- IIAPAYFIIGGNQSGEGCVITR (22aa)
- ALIYQFSPIYTGNISSFQQ (19aa)
- FPNITNL (7aa)
- IIDNNKTEK (9aa)
- GEVFNATR (8aa)
- CPFGEVFNATR (11aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- VQPFNVTQGK (10aa)
- GIKPNQTSK (9aa)
- YHNQTIR (7aa)
- DECWCPANSTGK (12aa)
- NLEKNSTK (8aa)
- INFTAPFNPNK (11aa)
- KLVLYLEHNLEKNSTKEEILAALEK (25aa)
- NSTKEEILAALEK (13aa)
- LVLYLEHNLEKNSTKEEILAALEK (24aa)
- VFGSQNITTVK (11aa)
- NVTHSGR (7aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- NCTSFR (6aa)
- VLFHNLTQPR (10aa)
- VPGNQTSTTLK (11aa)
- CLYGEAYPSCSSGNTSTAEEELCR (24aa)
- VINETWAWK (9aa)
- NATLAEQAK (9aa)
- AEPPINASASDQGEK (15aa)
- AEPPLNASAGDQEEK (15aa)
- INYSIPTGQWVGVQIPR (17aa)
- NCTDIDECR (9aa)
- VPAQEKNF (8aa)
- HVTYVPAQEKNF (12aa)
- EGVFVSNGTHW (11aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- FYFGGSPISAQYANFTGCISNAYFTR (26aa)
- TIETHSNK (8aa)
- NLQVYNATSNSLTVK (15aa)
- VETGENCTSPAPK (13aa)
- GVTHLNISGLK (11aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:2 dHex:1 / N-Linked
(avg mass : 1219.1179)
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1219.1179)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1219.1179)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1219.1179)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1219.1179)
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1219.1179)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1219.1179)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1219.1179)
Source
Disease
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1219.1179)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1219.1179)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1219.1179)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1219.1179)