Hex:4 HexNAc:2 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Capra hircus (Goat)
• Mus musculus (House mouse)
• Nasua narica (White-nosed coati)
• Pongo pygmaeus (Orangutan)
• Rattus norvegicus (Norway rat)
• Ursus americanus (Black bear)
• Todarodes pacificus (Japanese flying squid)
• Trichinella spiralis
• Megathura crenulata (Californian giant keyhole limpet)
• Apis mellifera (Honeybee)
• Drosophila melanogaster (Fruit fly)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Acid ceramidase / Homo sapiens    Q13510
• Adipocyte plasma membrane-associated protein / Homo sapiens    Q9HDC9
• Alpha-fetoprotein / Homo sapiens    P02771
• Alpha-galactosidase A / Homo sapiens    P06280
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Apolipoprotein D / Homo sapiens    P05090
• Arylsulfatase a / Homo sapiens    P15289
• C-type mannose receptor 2 / Homo sapiens    Q9UBG0
• Cap-gly domain-containinglinker protein 1 / Homo sapiens    P30622
• Cathepsin D / Homo sapiens    P07339
• Cation-independent mannose-6-phosphate receptor / Homo sapiens    P11717
• Ceramide synthase 2 / Homo sapiens    Q96G23
• Ceramide synthase 6 / Homo sapiens    Q6ZMG9
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Endoplasmin / Homo sapiens    P14625
• Fibrillin-1 / Homo sapiens    P35555
• Fibrillin-2 / Homo sapiens    P35556
• Fibrillin-3 / Homo sapiens    Q75N90
• Gamma-glutamyl hydrolase / Homo sapiens    Q92820
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Integrin beta-1 / Homo sapiens    P05556
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens    Q14767
• Low-density lipoprotein receptor / Homo sapiens    P01130
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Multimerin-1 / Homo sapiens    Q13201
• N-acetylglucosamine-6-sulfatase / Homo sapiens    P15586
• Neurocan core protein / Homo sapiens    O14594
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Prenylcysteine oxidase 1 / Homo sapiens    Q9UHG3
• Prosaposin / Homo sapiens    P07602
• Serpin h1 / Homo sapiens    P50454
• Sortilin-related receptor / Homo sapiens    Q92673
• Sulfhydryl oxidase 1 / Homo sapiens    O00391
• Tenascin / Homo sapiens    P24821
• Thyroglobulin / Homo sapiens    P01266
• Transmembrane protein 106B / Homo sapiens    Q9NUM4
• Transmembrane protein 245 / Homo sapiens    Q9H330
• Tryptase alpha/beta-1 / Homo sapiens    Q15661
• Tryptase beta-2 / Homo sapiens    P20231
• Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens    P78324
• Thyrotropin-aplha and beta chains / Bos taurus    P01217    P01223
• Mucin / Capra hircus    
• Cathepsin D / Mus musculus    P18242
• G-protein coupled receptor 56 / Mus musculus    Q8K209
• Hypoxia up-regulated protein 1 / Mus musculus    Q9JKR6
• Immunoglobulin superfamily member 8 / Mus musculus    Q8R366
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus    P11881-3
• Leukocyte surface antigen CD47 / Mus musculus    Q61735
• Lysosomal acid phosphatase / Mus musculus    P24638
• Lysosomal alpha-glucosidase / Mus musculus    P70699
• Lysosome-associated membrane glycoprotein 2 / Mus musculus    P17047
• Metabotropic glutamate receptor 3 / Mus musculus    Q9QYS2
• Myelin-associated glycoprotein / Mus musculus    P20917
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Prosaposin / Mus musculus    Q61207
• Reticulocalbin-1 / Mus musculus    Q05186
• Signal-regulatory protein alpha / Mus musculus    P97797
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Wolframin / Mus musculus    P56695
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Rhodopsin / Todarodes pacificus    P31356
• Tsl-1 antigens / Trichinella spiralis    
• Uncharacterized protein / Trichinella spiralis    
• Hemocyanin / Megathura crenulata    Q10584    Q10583
• Phospholipase a2 / Apis mellifera    P00630
• Uncharacterized protein / Drosophila melanogaster    
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Cerebellum (UBERON_0002037)  
• Embryo (UBERON_0000922)  
• Frontal Cortex (UBERON_0001870)  
• Hemolymph (UBERON_0001011)  
• Hippocampul formation (UBERON:0002421)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• neocortex (UBERON:0001950)  
• Pituitary Gland (UBERON_0000007)  
• Placenta (UBERON_0001987)  
• Retina (UBERON_0000966)   Plasma Membrane (GO_0005886)  
• Striatum (UBERON_0002345)  
• Submandibular Gland (UBERON_0001736)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Venom (UBERON_0007113)  
• BTI-Tn-5B1-4 (CVCL_C190)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293T (CVCL_0063)  

Reported structure

• Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [[Fuc(a1-3)]Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
• Free / Lactose / [Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-2)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Gal(b1-4)Glc
• Free / Lactose / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc
• Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
• Free / Lactose / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
• Free / Lactose / Structure 9217
• Free / Lactose / Structure 10114
• Free / Lactose / Structure 10842
• Free / Lactose / Structure 10843
• N-Linked / High-Mannose / Man(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / High-Mannose / Man(a1-3)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / High-Mannose / Man(a1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / High-Mannose / Man(a1-?)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Pauci-Mannose / Gal(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Gal(b1-4)Fuc(a1-6)]GlcNAc
• N-Linked / Pauci-Mannose / Structure 9888
• N-Linked / Pauci-Mannose / Structure 11838
• N-Linked / Pauci-Mannose / Structure 11932
• N-Linked / Undefined core / Structure 9834
• O-Linked / Undefined core / Man(?1-4)[Man(?1-6)]Glc(?1-4)GlcNAc(?1-4)[Fuc(?1-2)]Gal(?1-3)GalNAc

Composition

• Hex:4 HexNAc:2 dHex:1 (avg mass : 1219.1179 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma, Hepatocellular (DOID:684)
• COVID-19 (DOID:0080600)

Reference

• Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
• Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
• N-Glycosylation in isolated rat nerve terminals (2021 - Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
• Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
• Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
• Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
• Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
• Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
• Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
• Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
• N-glycan structures of squid rhodopsin. Existence of the alpha1-3 and alpha1-6 difucosylated innermost GlcNAc residue in a molluscan glycoprotein. (2003 - Takahashi N, Masuda K, Hiraki K, Yoshihara K, Huang HH, Khoo KH, Kato K) / Status : Reviewed
• Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
• Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
• Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
• Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
• Chemical characterisation of the oligosaccharides in a sample of milk of a white-nosed coati, Nasua narica (Procyonidae: Carnivora). (1999 - Urashima T, Yamamoto M, Nakamura T, Arai I, Saito T, Namiki M, Yamaoka K, Kawahara K) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
• Structures of carbohydrate chains of glycoprotein isolated from goat submaxillary mucin. (1982 - Dutta B, Rao C) / Status : Reviewed
• Oligosaccharides of human milk: Structural studies of Di- and trifucosyl derivatives of lacto-N-octaose and lacto-N-neooctaose (1978 - Yoko Tachibana, Katsuko Yamashita, Akira Kobata) / Status : Reviewed

Reported glycosite

• Acid ceramidase / Homo sapiens
  •        Asn-286
• Adipocyte plasma membrane-associated protein / Homo sapiens
  •        Asn-160
• Alpha-fetoprotein / Homo sapiens
  •        Asn-197
• Alpha-galactosidase A / Homo sapiens
  •        Asn-215
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Asn-124
• Apolipoprotein D / Homo sapiens
  •        Asn-98
• Arylsulfatase a / Homo sapiens
  •        Undefined site
• C-type mannose receptor 2 / Homo sapiens
  •        Asn-634
• Cap-gly domain-containinglinker protein 1 / Homo sapiens
  •        Asn-971
• Cathepsin D / Homo sapiens
  •        Asn-263
• Cation-independent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-400
• Ceramide synthase 2 / Homo sapiens
  •        Asn-19
• Ceramide synthase 6 / Homo sapiens
  •        Asn-18
• Clusterin / Homo sapiens
  •        Asn-354
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-119
• Endoplasmin / Homo sapiens
  •        Asn-62
• Fibrillin-1 / Homo sapiens
  •        Asn-1067
• Fibrillin-2 / Homo sapiens
  •        Asn-1112
• Fibrillin-3 / Homo sapiens
  •        Asn-1025
• Gamma-glutamyl hydrolase / Homo sapiens
  •        Asn-203
  •        Asn-307
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-63
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-515
  •        Asn-862
  •        Asn-869
  •        Asn-931
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Integrin beta-1 / Homo sapiens
  •        Asn-212
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-1366
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
  •        Asn-421
• Low-density lipoprotein receptor / Homo sapiens
  •        Asn-657
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-103
  •        Asn-249
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-356
• Multimerin-1 / Homo sapiens
  •        Asn-1020
• N-acetylglucosamine-6-sulfatase / Homo sapiens
  •        Asn-362
• Neurocan core protein / Homo sapiens
  •        Asn-122
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-197
  •        Asn-212
• Prenylcysteine oxidase 1 / Homo sapiens
  •        Asn-196
• Prosaposin / Homo sapiens
  •        Asn-332
  •        Asn-426
• Serpin h1 / Homo sapiens
  •        Asn-120
  •        Asn-125
• Sortilin-related receptor / Homo sapiens
  •        Asn-1608
• Sulfhydryl oxidase 1 / Homo sapiens
  •        Asn-130
• Tenascin / Homo sapiens
  •        Asn-1018
• Thyroglobulin / Homo sapiens
  •        Asn-1365
• Transmembrane protein 106B / Homo sapiens
  •        Asn-256
• Transmembrane protein 245 / Homo sapiens
  •        Asn-575
• Tryptase alpha/beta-1 / Homo sapiens
  •        Asn-233
• Tryptase beta-2 / Homo sapiens
  •        Asn-233
• Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens
  •        Asn-292
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Mucin / Capra hircus
  •        Undefined site
• Cathepsin D / Mus musculus
  •        Asn-261
• G-protein coupled receptor 56 / Mus musculus
  •        Asn-148
• Hypoxia up-regulated protein 1 / Mus musculus
  •        Asn-931
• Immunoglobulin superfamily member 8 / Mus musculus
  •        Asn-48
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
  •        Asn-2502
• Leukocyte surface antigen CD47 / Mus musculus
  •        Asn-109
• Lysosomal acid phosphatase / Mus musculus
  •        Asn-177
• Lysosomal alpha-glucosidase / Mus musculus
  •        Asn-140
• Lysosome-associated membrane glycoprotein 2 / Mus musculus
  •        Asn-156
• Metabotropic glutamate receptor 3 / Mus musculus
  •        Asn-439
• Myelin-associated glycoprotein / Mus musculus
  •        Asn-99
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-670
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-3954
• Prosaposin / Mus musculus
  •        Asn-80
  •        Asn-214
  •        Asn-459
• Reticulocalbin-1 / Mus musculus
  •        Asn-47
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-92
  •        Asn-271
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Wolframin / Mus musculus
  •        Asn-748
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• Rhodopsin / Todarodes pacificus
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Uncharacterized protein / Trichinella spiralis
  •        Undefined site
• Hemocyanin / Megathura crenulata
  •        Undefined site
• Phospholipase a2 / Apis mellifera
  •        Asn-46
• Uncharacterized protein / Drosophila melanogaster
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-122
  •        Asn-165
  •        Asn-331
  •        Asn-343
  •        Asn-615
  •        Asn-709
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-74
  •        Asn-1098

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FWIPHNVTWADIK (13aa)
  •    Q6ZMG9    Asn-18     Ceramide synthase 6 / Homo sapiens
• IWIPVNITWADIEDRDGR (18aa)
  •    Q96G23    Asn-19     Ceramide synthase 2 / Homo sapiens
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
  •    Q05186    Asn-47     Reticulocalbin-1 / Mus musculus
• VAGTAVSISCNVSDYEGPAQQDFEWFMYRPEAPATSLGIVSTK (43aa)
  •    Q8R366    Asn-48     Immunoglobulin superfamily member 8 / Mus musculus
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TDDEVVQREEEAIQIDGINASQIR (24aa)
  •    P14625    Asn-62     Endoplasmin / Homo sapiens
• APLVNVTLYYEALCGGCR (18aa)
  •    P13284    Asn-63     Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
• NAPLVNVTLYYEALCGGCR (19aa)
  •    P13284    Asn-63     Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• DNATQEEILHYLEK (14aa)
  •    Q61207    Asn-80     Prosaposin / Mus musculus
• TVVTEAGNLLKDNATQEEILHYLEK (25aa)
  •    Q61207    Asn-80     Prosaposin / Mus musculus
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92     Signal-regulatory protein alpha / Mus musculus
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• NCTLLLSTLSPELGGK (16aa)
  •    P20917    Asn-99     Myelin-associated glycoprotein / Mus musculus
• GHTITINFTR (10aa)
  •    P11279    Asn-103     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• DAMVGNYTCEVTELSR (16aa)
  •    Q61735    Asn-109     Leukocyte surface antigen CD47 / Mus musculus
• VTTYCNETMTGWVHDVIGR (19aa)
  •    P53634    Asn-119     Dipeptidyl peptidase 1 / Homo sapiens
• SISNSTAR (8aa)
  •    P50454    Asn-120     Serpin h1 / Homo sapiens
• ANATLLLGPLR (11aa)
  •    O14594    Asn-122     Neurocan core protein / Homo sapiens
• LIVNNATNVVIK (12aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LGIYADMGNFTCMGYPGTTLDK (22aa)
  •    P17050    Asn-124     Alpha-n-acetylgalactosaminidase / Homo sapiens
• NGSGAVFPVAGADVQTLR (18aa)
  •    O00391    Asn-130     Sulfhydryl oxidase 1 / Homo sapiens
• LENLSSTESGYTATLTR (17aa)
  •    P70699    Asn-140     Lysosomal alpha-glucosidase / Mus musculus
• QGAPLIATSVSSWQIPQNTSLPGAPSFIFSFHNAPHK (37aa)
  •    Q8K209    Asn-148     G-protein coupled receptor 56 / Mus musculus
• CNSVLTYNLTPVVQK (15aa)
  •    P17047    Asn-156     Lysosome-associated membrane glycoprotein 2 / Mus musculus
• AGPNGTLFVADAYK (14aa)
  •    Q9HDC9    Asn-160     Adipocyte plasma membrane-associated protein / Homo sapiens
• VYSSANNCTFEY (12aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QTPEYQNR (8aa)
  •    P24638    Asn-177     Lysosomal acid phosphatase / Mus musculus
• IIHAIGGDDFIGMINR (16aa)
  •    Q9UHG3    Asn-196     Prenylcysteine oxidase 1 / Homo sapiens
• EDVYRNHSIFIADINQER (18aa)
  •    P50897    Asn-197     Palmitoyl-protein thioesterase 1 / Homo sapiens
• NHSIFLADINQER (13aa)
  •    P50897    Asn-197     Palmitoyl-protein thioesterase 1 / Homo sapiens
• NFTMNEK (7aa)
  •    Q92820    Asn-203     Gamma-glutamyl hydrolase / Homo sapiens
• NPCTSEQNCTSPFSYK (16aa)
  •    P05556    Asn-212     Integrin beta-1 / Homo sapiens
• GINESYK (7aa)
  •    P50897    Asn-212     Palmitoyl-protein thioesterase 1 / Homo sapiens
• TNSSFIQGFVDHVKEDCDR (19aa)
  •    Q61207    Asn-214     Prosaposin / Mus musculus
• SIVYSCEWPIYMWPFQKPNYTEIR (24aa)
  •    P06280    Asn-215     Alpha-galactosidase A / Homo sapiens
• VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa)
  •    Q15661    Asn-233     Tryptase alpha/beta-1 / Homo sapiens
  •    P20231    Asn-233     Tryptase beta-2 / Homo sapiens
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• YQYVDCGRNTT (11aa)
  •    Q9NUM4    Asn-256     Transmembrane protein 106B / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• YYHGELSYLNVTR (13aa)
  •    P18242    Asn-261     Cathepsin D / Mus musculus
• GSLSYLNVTRK (11aa)
  •    P07339    Asn-263     Cathepsin D / Homo sapiens
• GSISYINVTR (10aa)
  •    P07339    Asn-263     Cathepsin D / Homo sapiens
• VTQQSPTSMNQVNLTCR (17aa)
  •    P97797    Asn-271     Signal-regulatory protein alpha / Mus musculus
• IIAPAYFIIGGNQSGEGCVITR (22aa)
  •    Q13510    Asn-286     Acid ceramidase / Homo sapiens
• ALIYQFSPIYTGNISSFQQ (19aa)
  •    Q92820    Asn-307     Gamma-glutamyl hydrolase / Homo sapiens
• FPNITNL (7aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IIDNNKTEK (9aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• CPFGEVFNATR (11aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• GIKPNQTSK (9aa)
  •    P15586    Asn-362     N-acetylglucosamine-6-sulfatase / Homo sapiens
• YHNQTIR (7aa)
  •    P11717    Asn-400     Cation-independent mannose-6-phosphate receptor / Homo sapiens
• DECWCPANSTGK (12aa)
  •    Q14767    Asn-421     Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
• NLEKNSTK (8aa)
  •    P07602    Asn-426     Prosaposin / Homo sapiens
• INFTAPFNPNK (11aa)
  •    Q9QYS2    Asn-439     Metabotropic glutamate receptor 3 / Mus musculus
• KLVLYLEHNLEKNSTKEEILAALEK (25aa)
  •    Q61207    Asn-459     Prosaposin / Mus musculus
• NSTKEEILAALEK (13aa)
  •    Q61207    Asn-459     Prosaposin / Mus musculus
• LVLYLEHNLEKNSTKEEILAALEK (24aa)
  •    Q61207    Asn-459     Prosaposin / Mus musculus
• VFGSQNITTVK (11aa)
  •    Q9Y4L1    Asn-515     Hypoxia up-regulated protein 1 / Homo sapiens
• NVTHSGR (7aa)
  •    Q9H330    Asn-575     Transmembrane protein 245 / Homo sapiens
• QDVNCTEVPVAIHADQLTPTWR (22aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NCTSFR (6aa)
  •    Q9UBG0    Asn-634     C-type mannose receptor 2 / Homo sapiens
• VLFHNLTQPR (10aa)
  •    P01130    Asn-657     Low-density lipoprotein receptor / Homo sapiens
• VPGNQTSTTLK (11aa)
  •    P11627    Asn-670     Neural cell adhesion molecule L1 / Mus musculus
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-709     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• CLYGEAYPSCSSGNTSTAEEELCR (24aa)
  •    P56695    Asn-748     Wolframin / Mus musculus
• VINETWAWK (9aa)
  •    Q9Y4L1    Asn-862     Hypoxia up-regulated protein 1 / Homo sapiens
• NATLAEQAK (9aa)
  •    Q9Y4L1    Asn-869     Hypoxia up-regulated protein 1 / Homo sapiens
• AEPPINASASDQGEK (15aa)
  •    Q9Y4L1    Asn-931     Hypoxia up-regulated protein 1 / Homo sapiens
• AEPPLNASAGDQEEK (15aa)
  •    Q9JKR6    Asn-931     Hypoxia up-regulated protein 1 / Mus musculus
• INYSIPTGQWVGVQIPR (17aa)
  •    P24821    Asn-1018     Tenascin / Homo sapiens
• NCTDIDECR (9aa)
  •    P35556    Asn-1112     Fibrillin-2 / Homo sapiens
  •    P35555    Asn-1067     Fibrillin-1 / Homo sapiens
  •    Q75N90    Asn-1025     Fibrillin-3 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HVTYVPAQEKNF (12aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FYFGGSPISAQYANFTGCISNAYFTR (26aa)
  •    Q16363    Asn-1366     Laminin subunit alpha-4 / Homo sapiens
• TIETHSNK (8aa)
  •    Q92673    Asn-1608     Sortilin-related receptor / Homo sapiens
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763     Collagen alpha-1(XII) chain / Homo sapiens
• VETGENCTSPAPK (13aa)
  •    P11881-3    Asn-2502     Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
• GVTHLNISGLK (11aa)
  •    Q91ZX7    Asn-3954     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus