Hex:5 HexNAc:6 dHex:1 NeuAc:3

Taxonomy

• Homo sapiens (Human)
• Calloselasma rhodostoma (Malayan pit viper)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Clusterin / Homo sapiens    P10909
• Fibromodulin / Homo sapiens    Q06828
• HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens    P01903
• Mammaglobin-A / Homo sapiens    Q13296
• Prolyl 3-hydroxylase 1 / Homo sapiens    Q32P28
• Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens    Q9BYF1
• Uromodulin / Homo sapiens    P07911
• Vitamin k-dependent protein c / Homo sapiens    P04070
• WAP four-disulfide core domain protein 2 / Homo sapiens    Q14508
• Ancrod / Calloselasma rhodostoma    P26324
• Recombinant Spike glycoprotein (FreeStyle 293-F) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  

Reported structure

• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-?)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc

Composition

• Hex:5 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3067.814 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Prostate cancer (DOID:10283)

Reference

• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Unreviewed
• Site-specific analysis of the SARS-CoV-2 glycan shield (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Novel Asn-linked oligosaccharides terminating in GalNAc beta (1-->4)[Fuc alpha (1-->3)]GlcNAc beta (1-->.) are present in recombinant human protein C expressed in human kidney 293 cells. (1993 - Yan S, Chao Y, van Halbeek H) / Status : Reviewed
• Carbohydrate structure of a thrombin-like serine protease from Agkistrodon rhodostoma. Structure elucidation of oligosaccharides by methylation analysis, liquid secondary-ion mass spectrometry and proton magnetic resonance. (1992 - Pfeiffer G, Dabrowski U, Dabrowski J, Stirm S, Strube K, Geyer R) / Status : Reviewed

Reported glycosite

• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
  •        Asn-374
• Fibromodulin / Homo sapiens
  •        Asn-166
• HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens
  •        Asn-103
• Mammaglobin-A / Homo sapiens
  •        Asn-53
• Prolyl 3-hydroxylase 1 / Homo sapiens
  •        Asn-540
• Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens
  •        Asn-90
• Uromodulin / Homo sapiens
  •        Asn-513
• Vitamin k-dependent protein c / Homo sapiens
  •        Undefined site
• WAP four-disulfide core domain protein 2 / Homo sapiens
  •        Asn-44
• Ancrod / Calloselasma rhodostoma
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-1194
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-149
  •        Asn-657
  •        Asn-1194

Mass spectrometry observed peptide

• TGVCPELQADQNCTQECVSDSECADNLK (28aa)
  •    Q14508    Asn-44
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53
• KEDALNETR (9aa)
  •    P10909    Asn-86
• PLQEIQNL (8aa)
  •    Q9BYF1    Asn-90
• IKEIPGVCNETMMAIWEECKPCIK (24aa)
  •    P10909    Asn-103
• SNYTPITNVPPEVTVITNSPVEIR (24aa)
  •    P01903    Asn-103
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103
• GWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLG (40aa)
  •    P0DTC2    Asn-122
• NN (2aa)
  •    P0DTC2    Asn-149
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513
• LYYNVTEK (8aa)
  •    Q32P28    Asn-540
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• LNEVAKNLNESLIDLQ (16aa)
  •    P0DTC2    Asn-1194
• KNLNE (5aa)
  •    P0DTC2    Asn-1194