taxonomy (7)
protein (38)
source (19)
structure (19)
composition (1)
disease (6)
reference (24)
site (44)
peptide (28)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Desmodus rotundus (Common vampire bat)
- Mus musculus (House mouse)
- Ovis aries (Sheep)
- Gallus gallus (Chicken)
- Friend murine leukemia virus (F-mulv)
Taxonomy
- Adapter protein CIKS / Homo sapiens O43734
- Alpha-2-macroglobulin / Homo sapiens P01023
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- CD16A-NK08-V/F genotype / Homo sapiens P08637
- CD16A-NK09-V/F genotype / Homo sapiens P08637
- CD16A-NK11-F/F genotype / Homo sapiens P08637
- CD16A-NK12-V/F genotype / Homo sapiens P08637
- CD16A-NK13-V/F genotype / Homo sapiens P08637
- Coagulation factor V / Homo sapiens P12259
- Complement C1r subcomponent-like protein / Homo sapiens Q9NZP8
- Complement c3 / Homo sapiens P01024
- Desmoglein-2 / Homo sapiens Q14126
- Hepatocyte growth factor receptor / Homo sapiens P08581
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Interleukin-13 receptor subunit alpha-1 / Homo sapiens P78552
- Laminin subunit gamma-1 / Homo sapiens P11047
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Maltase-glucoamylase, intestinal / Homo sapiens O43451
- Oncostatin-M-specific receptor subunit beta / Homo sapiens Q99650
- Polypyrimidine tract-binding protein 2 / Homo sapiens Q9UKA9
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens O00469
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Target of Nesh-SH3 / Homo sapiens Q7Z7G0
- Tumor necrosis factor receptor superfamily member 21 / Homo sapiens O75509
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens P54289
- Myelin p0 protein / Bos taurus P10522
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Sister chromatid cohesion protein PDS5 homolog B / Mus musculus Q4VA53
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries Q712V9
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries Q712V9
- Envelope glycoprotein / Friend murine leukemia virus P03395
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Colostrum (UBERON_0001914)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Sciatic Nerve (UBERON_0001322)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Eveline (CVCL_A1LI)
- HEK293T (CVCL_0063)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
Source
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc
- Free / Lactose / Structure 9198
- Free / Lactose / Structure 9204
- Free / Lactose / Structure 9205
- N-Linked / Complex / Structure 10200
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 9570
- N-Linked / Hybrid / Structure 9877
- N-Linked / Hybrid / Structure 9928
- N-Linked / Hybrid / Structure 10144
- N-Linked / Hybrid / Structure 10178
- N-Linked / Hybrid / Structure 10405
- N-Linked / Hybrid / Structure 10503
- N-Linked / Hybrid / Structure 10565
- N-Linked / Hybrid / Structure 11118
- N-Linked / Hybrid / Structure 11172
Reported structure
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- Gastritis (DOID:4029)
- Mixed phenotype acute leukemia (DOID:9953)
- Prostate cancer (DOID:10283)
- Scrapie (DOID:5434)
Disease
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Epitope diversity of N-glycans from bovine peripheral myelin glycoprotein P0 revealed by mass spectrometry and nano probe magic angle spinning 1H NMR spectroscopy. (2001 - Gallego R, Blanco J, Thijssen-van Zuylen C, Gotfredsen C, Voshol H, Duus J, Schachner M, Vliegenthart J) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
- Novel oligosaccharides with the sialyl-Lea structure in human milk. (1991 - Kitagawa H, Nakada H, Fukui S, Funakoshi I, Kawasaki T, Yamashina I, Tate S, Inagaki F) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
Reference
- Adapter protein CIKS / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- CD16A-NK08-V/F genotype / Homo sapiens
- CD16A-NK09-V/F genotype / Homo sapiens
- CD16A-NK11-F/F genotype / Homo sapiens
- CD16A-NK12-V/F genotype / Homo sapiens
- CD16A-NK13-V/F genotype / Homo sapiens
- Coagulation factor V / Homo sapiens
- Complement C1r subcomponent-like protein / Homo sapiens
- Complement c3 / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Hepatocyte growth factor receptor / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Interleukin-13 receptor subunit alpha-1 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Maltase-glucoamylase, intestinal / Homo sapiens
- Oncostatin-M-specific receptor subunit beta / Homo sapiens
- Polypyrimidine tract-binding protein 2 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- T-cell surface glycoprotein cd4 / Homo sapiens
- Target of Nesh-SH3 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
- Myelin p0 protein / Bos taurus
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
- Sister chromatid cohesion protein PDS5 homolog B / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
- Envelope glycoprotein / Friend murine leukemia virus
Reported glycosite
- GSDELLSGSVLSSPNSNMSSMVVTANGNDSK (31aa)
- VSTNSTR (7aa)
- FHNESLISSQASSY (14aa)
- P08637 Asn-63     CD16A-NK11-F/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK12-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK08-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK13-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK09-V/F genotype / Homo sapiens
- NKSVLLGR (8aa)
- IIVPLNNRENISDPTSPLR (19aa)
- ENISDPTSPLR (11aa)
- TNHMGNVTFTIPANR (15aa)
- NHSYHVEGNLVNTNAGFTAR (20aa)
- NTSPDTNYTLYYWHR (15aa)
- EEQFNSTFR (9aa)
- CRGLVGSKNVSSE (13aa)
- VAR_003960 176:F→V dbSNP:rs396991
- P08637 Asn-180     CD16A-NK08-V/F genotype / Homo sapiens
- VAR_003960 176:F→V dbSNP:rs396991
- P08637 Asn-180     CD16A-NK12-V/F genotype / Homo sapiens
- VAR_003960 176:F→V dbSNP:rs396991
- VAR_003960 176:F→V dbSNP:rs396991
- P08637 Asn-180     CD16A-NK13-V/F genotype / Homo sapiens
- VAR_003960 176:F→V dbSNP:rs396991
- VAR_003960 176:F→V dbSNP:rs396991
- FGSKNVSSE (9aa)
- GSKNVSSE (8aa)
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
- YPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPR (40aa)
- QLDMLDLSNNSLASVPEGLWASLGQPNWDMR (31aa)
- NQSVNVFLGHTAIDEMLK (18aa)
- NETLALPAESK (11aa)
- SINTTNVMGTSLTVR (15aa)
- DIYQFLCNASER (12aa)
- YVQNGTYTVK (10aa)
- NNTMIR (6aa)
- NYTWVPIR (8aa)
- ISDNNTEFLLNFNEFIDR (18aa)
- SVSPTTEMVSNESVDYR (17aa)
- NFSNTK (6aa)
- VNNTLSSQISR (11aa)
- NVTAYFPR (8aa)
Mass spectrometry observed peptide
-
- Free / Lactose
(avg mass : 1875.7132)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1875.7132)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1875.7132)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1875.7132)
- Milk (UBERON_0001913)
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1875.7132)
- Milk (UBERON_0001913)
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1875.7132)
- Milk (UBERON_0001913)
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
-
- N-Linked / Complex
(avg mass : 1875.7132)
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- CD16A-NK08-V/F genotype / Homo sapiens
- CD16A-NK09-V/F genotype / Homo sapiens
- CD16A-NK11-F/F genotype / Homo sapiens
- CD16A-NK12-V/F genotype / Homo sapiens
- CD16A-NK13-V/F genotype / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- FHNESLISSQASSY (14aa)
- P08637 Asn-63     CD16A-NK11-F/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK12-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK08-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK13-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK09-V/F genotype / Homo sapiens
- IIVPLNNRENISDPTSPLR (19aa)
- CRGLVGSKNVSSE (13aa)
- VAR_003960 176:F→V dbSNP:rs396991
- P08637 Asn-180     CD16A-NK08-V/F genotype / Homo sapiens
- VAR_003960 176:F→V dbSNP:rs396991
- P08637 Asn-180     CD16A-NK12-V/F genotype / Homo sapiens
- VAR_003960 176:F→V dbSNP:rs396991
- VAR_003960 176:F→V dbSNP:rs396991
- P08637 Asn-180     CD16A-NK13-V/F genotype / Homo sapiens
- VAR_003960 176:F→V dbSNP:rs396991
- VAR_003960 176:F→V dbSNP:rs396991
- FGSKNVSSE (9aa)
- GSKNVSSE (8aa)
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Epitope diversity of N-glycans from bovine peripheral myelin glycoprotein P0 revealed by mass spectrometry and nano probe magic angle spinning 1H NMR spectroscopy. (2001 - Gallego R, Blanco J, Thijssen-van Zuylen C, Gotfredsen C, Voshol H, Duus J, Schachner M, Vliegenthart J) / Status : Reviewed
- Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- T-cell surface glycoprotein cd4 / Homo sapiens
- Myelin p0 protein / Bos taurus
- Envelope glycoprotein / Friend murine leukemia virus
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Bone Marrow (UBERON_0002371)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Bone Marrow (UBERON_0002371)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Brain (UBERON_0000955)
- Scrapie (DOID:5434)
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Colostrum (UBERON_0001914)
- Immunoglobulin J chain / Homo sapiens
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Colon (UBERON_0001155)
-
- N-Linked / Hybrid
(avg mass : 1875.7132)
- Blood Plasma (UBERON_0001969)
- Coagulation factor V / Homo sapiens
-
- Hex:5 HexNAc:3 dHex:1 NeuAc:1 / N-Linked
(avg mass : 1875.7132)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- N-Linked / Complex / Structure 10200
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 9570
- N-Linked / Hybrid / Structure 9877
- N-Linked / Hybrid / Structure 9928
- N-Linked / Hybrid / Structure 10144
- N-Linked / Hybrid / Structure 10178
- N-Linked / Hybrid / Structure 10405
- N-Linked / Hybrid / Structure 10503
- N-Linked / Hybrid / Structure 10565
- N-Linked / Hybrid / Structure 11118
- N-Linked / Hybrid / Structure 11172
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Adapter protein CIKS / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Complement C1r subcomponent-like protein / Homo sapiens
- Complement c3 / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Hepatocyte growth factor receptor / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Interleukin-13 receptor subunit alpha-1 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Maltase-glucoamylase, intestinal / Homo sapiens
- Oncostatin-M-specific receptor subunit beta / Homo sapiens
- Polypyrimidine tract-binding protein 2 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Target of Nesh-SH3 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
- Sister chromatid cohesion protein PDS5 homolog B / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- GSDELLSGSVLSSPNSNMSSMVVTANGNDSK (31aa)
- VSTNSTR (7aa)
- NKSVLLGR (8aa)
- IIVPLNNRENISDPTSPLR (19aa)
- ENISDPTSPLR (11aa)
- TNHMGNVTFTIPANR (15aa)
- NHSYHVEGNLVNTNAGFTAR (20aa)
- NTSPDTNYTLYYWHR (15aa)
- EEQFNSTFR (9aa)
- YPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPR (40aa)
- QLDMLDLSNNSLASVPEGLWASLGQPNWDMR (31aa)
- NQSVNVFLGHTAIDEMLK (18aa)
- NETLALPAESK (11aa)
- SINTTNVMGTSLTVR (15aa)
- DIYQFLCNASER (12aa)
- YVQNGTYTVK (10aa)
- NNTMIR (6aa)
- NYTWVPIR (8aa)
- ISDNNTEFLLNFNEFIDR (18aa)
- SVSPTTEMVSNESVDYR (17aa)
- NFSNTK (6aa)
- VNNTLSSQISR (11aa)
- NVTAYFPR (8aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:3 dHex:1 NeuAc:1 / N-Linked
(avg mass : 1875.7132)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1875.7132)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1875.7132)
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1875.7132)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1875.7132)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1875.7132)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1875.7132)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1875.7132)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1875.7132)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1875.7132)