taxonomy (5)
protein (28)
source (6)
structure (4)
composition (1)
disease (1)
reference (11)
site (29)
peptide (22)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Desmodus rotundus (Common vampire bat)
- Mus musculus (House mouse)
- Friend murine leukemia virus (F-mulv)
Taxonomy
- Adapter protein CIKS / Homo sapiens O43734
- Alpha-2-macroglobulin / Homo sapiens P01023
- Coagulation factor V / Homo sapiens P12259
- Complement C1r subcomponent-like protein / Homo sapiens Q9NZP8
- Complement c3 / Homo sapiens P01024
- Desmoglein-2 / Homo sapiens Q14126
- Hepatocyte growth factor receptor / Homo sapiens P08581
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin j chain / Homo sapiens P01591
- Interleukin-13 receptor subunit alpha-1 / Homo sapiens P78552
- Laminin subunit gamma-1 / Homo sapiens P11047
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Maltase-glucoamylase, intestinal / Homo sapiens O43451
- Oncostatin-M-specific receptor subunit beta / Homo sapiens Q99650
- Polypyrimidine tract-binding protein 2 / Homo sapiens Q9UKA9
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens O00469
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Target of Nesh-SH3 / Homo sapiens Q7Z7G0
- Tumor necrosis factor receptor superfamily member 21 / Homo sapiens O75509
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens P54289
- Myelin p0 protein / Bos taurus P10522
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Sister chromatid cohesion protein PDS5 homolog B / Mus musculus Q4VA53
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- Knob protein gp70 / Friend murine leukemia virus P03395
Protein
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Sciatic Nerve (UBERON_0001322)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
Source
- Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 3513
Reported structure
- Prostate cancer (DOID:10283)
Disease
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Epitope diversity of N-glycans from bovine peripheral myelin glycoprotein P0 revealed by mass spectrometry and nano probe magic angle spinning 1H NMR spectroscopy. (2001 - Gallego R, Blanco J, Thijssen-van Zuylen C, Gotfredsen C, Voshol H, Duus J, Schachner M, Vliegenthart J) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Novel oligosaccharides with the sialyl-Lea structure in human milk. (1991 - Kitagawa H, Nakada H, Fukui S, Funakoshi I, Kawasaki T, Yamashina I, Tate S, Inagaki F) / Status : Reviewed
- Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
Reference
- Adapter protein CIKS / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Complement C1r subcomponent-like protein / Homo sapiens
- Complement c3 / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Hepatocyte growth factor receptor / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin j chain / Homo sapiens
- Interleukin-13 receptor subunit alpha-1 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Maltase-glucoamylase, intestinal / Homo sapiens
- Oncostatin-M-specific receptor subunit beta / Homo sapiens
- Polypyrimidine tract-binding protein 2 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- T-cell surface glycoprotein cd4 / Homo sapiens
- Target of Nesh-SH3 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
- Myelin p0 protein / Bos taurus
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
- Sister chromatid cohesion protein PDS5 homolog B / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- Knob protein gp70 / Friend murine leukemia virus
Reported glycosite
- GSDELLSGSVLSSPNSNMSSMVVTANGNDSK (31aa)
- VSTNSTR (7aa)
- ENISDPTSPLR (11aa)
- IIVPLNNRENISDPTSPLR (19aa)
- TNHMGNVTFTIPANR (15aa)
- NHSYHVEGNLVNTNAGFTAR (20aa)
- NTSPDTNYTLYYWHR (15aa)
- EEQFNSTFR (9aa)
- YPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPR (40aa)
- QLDMLDLSNNSLASVPEGLWASLGQPNWDMR (31aa)
- NQSVNVFLGHTAIDEMLK (18aa)
- NETLALPAESK (11aa)
- SINTTNVMGTSLTVR (15aa)
- DIYQFLCNASER (12aa)
- YVQNGTYTVK (10aa)
- NNTMIR (6aa)
- NYTWVPIR (8aa)
- ISDNNTEFLLNFNEFIDR (18aa)
- SVSPTTEMVSNESVDYR (17aa)
- NFSNTK (6aa)
- VNNTLSSQISR (11aa)
- NVTAYFPR (8aa)
Mass spectrometry observed peptide
-
- Free / Lactose (avg mass : 1875.7132)
- Milk (UBERON_0001913)
-
- N-Linked / Hybrid (avg mass : 1875.7132)
- Epitope diversity of N-glycans from bovine peripheral myelin glycoprotein P0 revealed by mass spectrometry and nano probe magic angle spinning 1H NMR spectroscopy. (2001 - Gallego R, Blanco J, Thijssen-van Zuylen C, Gotfredsen C, Voshol H, Duus J, Schachner M, Vliegenthart J) / Status : Reviewed
- Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- T-cell surface glycoprotein cd4 / Homo sapiens
- Myelin p0 protein / Bos taurus
- Knob protein gp70 / Friend murine leukemia virus
-
- N-Linked / Hybrid (avg mass : 1875.7132)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
- N-Linked / Hybrid (avg mass : 1875.7132)
- Prostate-specific antigen (psa-1) / Homo sapiens
-
- Hex:5 HexNAc:3 dHex:1 NeuAc:1 / N-Linked (avg mass : 1875.7132)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 3513
- Prostate cancer (DOID:10283)
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Adapter protein CIKS / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Complement C1r subcomponent-like protein / Homo sapiens
- Complement c3 / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Hepatocyte growth factor receptor / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin j chain / Homo sapiens
- Interleukin-13 receptor subunit alpha-1 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Maltase-glucoamylase, intestinal / Homo sapiens
- Oncostatin-M-specific receptor subunit beta / Homo sapiens
- Polypyrimidine tract-binding protein 2 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
- Target of Nesh-SH3 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
- Sister chromatid cohesion protein PDS5 homolog B / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- GSDELLSGSVLSSPNSNMSSMVVTANGNDSK (31aa)
- VSTNSTR (7aa)
- ENISDPTSPLR (11aa)
- IIVPLNNRENISDPTSPLR (19aa)
- TNHMGNVTFTIPANR (15aa)
- NHSYHVEGNLVNTNAGFTAR (20aa)
- NTSPDTNYTLYYWHR (15aa)
- EEQFNSTFR (9aa)
- YPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPR (40aa)
- QLDMLDLSNNSLASVPEGLWASLGQPNWDMR (31aa)
- NQSVNVFLGHTAIDEMLK (18aa)
- NETLALPAESK (11aa)
- SINTTNVMGTSLTVR (15aa)
- DIYQFLCNASER (12aa)
- YVQNGTYTVK (10aa)
- NNTMIR (6aa)
- NYTWVPIR (8aa)
- ISDNNTEFLLNFNEFIDR (18aa)
- SVSPTTEMVSNESVDYR (17aa)
- NFSNTK (6aa)
- VNNTLSSQISR (11aa)
- NVTAYFPR (8aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Disease
Reference
Reported glycosite
Source
Disease
Reported glycosite
