GlyConnect

taxonomy (5) protein (28) source (6) structure (6) composition (1) disease (1) reference (12) site (29) peptide (22)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:5 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1875.7132 )

Disease

Prostate cancer (DOID:10283)

Reference

Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Unreviewed
Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
Epitope diversity of N-glycans from bovine peripheral myelin glycoprotein P0 revealed by mass spectrometry and nano probe magic angle spinning 1H NMR spectroscopy. (2001 - Gallego R, Blanco J, Thijssen-van Zuylen C, Gotfredsen C, Voshol H, Duus J, Schachner M, Vliegenthart J) / Status : Reviewed
Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
Novel oligosaccharides with the sialyl-Lea structure in human milk. (1991 - Kitagawa H, Nakada H, Fukui S, Funakoshi I, Kawasaki T, Yamashina I, Tate S, Inagaki F) / Status : Reviewed
Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed

Reported glycosite

Adapter protein CIKS / Homo sapiens
- Asn-263
Alpha-2-macroglobulin / Homo sapiens
- Asn-410
Coagulation factor V / Homo sapiens
- Asn-468
Complement C1r subcomponent-like protein / Homo sapiens
- Asn-296
Complement c3 / Homo sapiens
- Asn-85
Desmoglein-2 / Homo sapiens
- Asn-462
Hepatocyte growth factor receptor / Homo sapiens
- Asn-998
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Asn-180
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Asn-176
Immunoglobulin heavy constant mu / Homo sapiens
- Asn-46
Immunoglobulin j chain / Homo sapiens
- Asn-71
Interleukin-13 receptor subunit alpha-1 / Homo sapiens
- Asn-151
Laminin subunit gamma-1 / Homo sapiens
- Asn-1107
Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Asn-269
Maltase-glucoamylase, intestinal / Homo sapiens
- Asn-135
- Asn-1672
Oncostatin-M-specific receptor subunit beta / Homo sapiens
- Asn-42
Polypyrimidine tract-binding protein 2 / Homo sapiens
- Asn-31
Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
- Asn-63
Prostate-specific antigen (psa-1) / Homo sapiens
- Asn-69
T-cell surface glycoprotein cd4 / Homo sapiens
- Asn-325
Target of Nesh-SH3 / Homo sapiens
- Asn-313
Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
- Asn-439
Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
- Asn-675
Myelin p0 protein / Bos taurus
- Asn-93
Salivary plasminogen activator alpha 1 / Desmodus rotundus
- Asn-153
Sister chromatid cohesion protein PDS5 homolog B / Mus musculus
- Asn-1104
Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- Asn-627
Knob protein gp70 / Friend murine leukemia virus
- Asn-12

Mass spectrometry observed peptide

GSDELLSGSVLSSPNSNMSSMVVTANGNDSK (31aa)
- Q9UKA9 Asn-31
VSTNSTR (7aa)
- Q99650 Asn-42
ENISDPTSPLR (11aa)
- P01591 Asn-71
IIVPLNNRENISDPTSPLR (19aa)
- P01591 Asn-71
TNHMGNVTFTIPANR (15aa)
- P01024 Asn-85
NHSYHVEGNLVNTNAGFTAR (20aa)
- O43451 Asn-135
NTSPDTNYTLYYWHR (15aa)
- P78552 Asn-151
EEQFNSTFR (9aa)
- P01859 Asn-176
YPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPR (40aa)
- O43734 Asn-263
QLDMLDLSNNSLASVPEGLWASLGQPNWDMR (31aa)
- P02750 Asn-269
NQSVNVFLGHTAIDEMLK (18aa)
- Q9NZP8 Asn-296
NETLALPAESK (11aa)
- Q7Z7G0 Asn-313
SINTTNVMGTSLTVR (15aa)
- P01023 Asn-410
DIYQFLCNASER (12aa)
- O75509 Asn-439
YVQNGTYTVK (10aa)
- Q14126 Asn-462
NNTMIR (6aa)
- P12259 Asn-468
NYTWVPIR (8aa)
- Q6PHS9 Asn-627
ISDNNTEFLLNFNEFIDR (18aa)
- P54289 Asn-675
SVSPTTEMVSNESVDYR (17aa)
- P08581 Asn-998
NFSNTK (6aa)
- Q4VA53 Asn-1104
VNNTLSSQISR (11aa)
- P11047 Asn-1107
NVTAYFPR (8aa)
- O43451 Asn-1672

- Free / Lactose (avg mass : 1875.7132)
- Free / Lactose (avg mass : 1875.7132)
- Free / Lactose (avg mass : 1875.7132)
- N-Linked / Hybrid (avg mass : 1875.7132)
- N-Linked / Hybrid (avg mass : 1875.7132)
- N-Linked / Hybrid (avg mass : 1875.7132)

- Hex:5 HexNAc:3 dHex:1 NeuAc:1 / N-Linked (avg mass : 1875.7132)