Hex:5 HexNAc:3 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Gallus gallus (Chicken)
• Friend murine leukemia virus (F-mulv)
• Human immunodeficiency virus type 1 (HIV-1)

Protein

• Adapter protein CIKS / Homo sapiens    O43734
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Coagulation factor V / Homo sapiens    P12259
• Complement C1r subcomponent-like protein / Homo sapiens    Q9NZP8
• Complement c3 / Homo sapiens    P01024
• Desmoglein-2 / Homo sapiens    Q14126
• Hepatocyte growth factor receptor / Homo sapiens    P08581
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01860    P01859    P01861    P01857
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Interleukin-13 receptor subunit alpha-1 / Homo sapiens    P78552
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Maltase-glucoamylase, intestinal / Homo sapiens    O43451
• Oncostatin-M-specific receptor subunit beta / Homo sapiens    Q99650
• Polypyrimidine tract-binding protein 2 / Homo sapiens    Q9UKA9
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens    O00469
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Tumor necrosis factor receptor superfamily member 21 / Homo sapiens    O75509
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens    P54289
• Myelin p0 protein / Bos taurus    P10522
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Sister chromatid cohesion protein PDS5 homolog B / Mus musculus    Q4VA53
• Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus    Q6PHS9
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries    Q712V9
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries    Q712V9
• Envelope glycoprotein / Friend murine leukemia virus    P03395

Source

• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)   Mature NK T cell (CL_0000814)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Cerebellum (UBERON_0002037)  
• Cerebrospinal Fluid (UBERON_0001359)  
• Colon (UBERON_0001155)  
• Colostrum (UBERON_0001914)  
• Frontal Cortex (UBERON_0001870)  
• Hippocampul formation (UBERON:0002421)  
• Liver (UBERON_0002107)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Prefrontal Cortex (UBERON:0000451)  
• Sciatic Nerve (UBERON_0001322)  
• Seminal Fluid (UBERON_0006530)  
• Striatum (UBERON_0002345)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Eveline (CVCL_A1LI)  
• HEK293SF-3F6 (CVCL_4V95)  
• HEK293T (CVCL_0063)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  

Reported structure

• Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc
• Free / Lactose / Structure 9198
• Free / Lactose / Structure 9204
• Free / Lactose / Structure 9205
• N-Linked / Complex / Structure 10200
• N-Linked / Complex / Structure 11472
• N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Hybrid / Structure 9570
• N-Linked / Hybrid / Structure 9877
• N-Linked / Hybrid / Structure 9928
• N-Linked / Hybrid / Structure 10144
• N-Linked / Hybrid / Structure 10178
• N-Linked / Hybrid / Structure 10405
• N-Linked / Hybrid / Structure 10503
• N-Linked / Hybrid / Structure 10565
• N-Linked / Hybrid / Structure 11118
• N-Linked / Hybrid / Structure 11172
• N-Linked / Hybrid / Structure 11485
• N-Linked / Hybrid / Structure 11496
• N-Linked / Hybrid / Structure 11505
• N-Linked / Hybrid / Structure 11686
• N-Linked / Hybrid / Structure 11699

Composition

• Hex:5 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1875.7132 )

Disease

• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• Gastritis (DOID:4029)
• Mixed phenotype acute leukemia (DOID:9953)
• Prostate cancer (DOID:10283)
• Schizophrenia (DOID:5419)
• Scrapie (DOID:5434)

Reference

• Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
• Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
• Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
• Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• N-Glycosylation in isolated rat nerve terminals (2021 - Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
• Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
• Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
• Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
• Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
• Epitope diversity of N-glycans from bovine peripheral myelin glycoprotein P0 revealed by mass spectrometry and nano probe magic angle spinning 1H NMR spectroscopy. (2001 - Gallego R, Blanco J, Thijssen-van Zuylen C, Gotfredsen C, Voshol H, Duus J, Schachner M, Vliegenthart J) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Novel oligosaccharides with the sialyl-Lea structure in human milk. (1991 - Kitagawa H, Nakada H, Fukui S, Funakoshi I, Kawasaki T, Yamashina I, Tate S, Inagaki F) / Status : Reviewed
• Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed

Reported glycosite

• Adapter protein CIKS / Homo sapiens
  •        Asn-263
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-410
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Coagulation factor V / Homo sapiens
  •        Asn-382
  •        Asn-468
• Complement C1r subcomponent-like protein / Homo sapiens
  •        Asn-296
• Complement c3 / Homo sapiens
  •        Asn-85
• Desmoglein-2 / Homo sapiens
  •        Asn-462
• Hepatocyte growth factor receptor / Homo sapiens
  •        Asn-998
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-264
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Interleukin-13 receptor subunit alpha-1 / Homo sapiens
  •        Asn-151
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1107
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-269
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Asn-63
  •        Asn-180
• Maltase-glucoamylase, intestinal / Homo sapiens
  •        Asn-135
  •        Asn-1672
• Oncostatin-M-specific receptor subunit beta / Homo sapiens
  •        Asn-42
• Polypyrimidine tract-binding protein 2 / Homo sapiens
  •        Asn-31
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
  •        Asn-63
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Asn-325
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-313
• Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
  •        Asn-439
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
  •        Asn-675
• Myelin p0 protein / Bos taurus
  •        Asn-93
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-153
• Sister chromatid cohesion protein PDS5 homolog B / Mus musculus
  •        Asn-1104
• Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
  •        Asn-627
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •        Asn-184
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •        Asn-184
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-12

Mass spectrometry observed peptide

• GSDELLSGSVLSSPNSNMSSMVVTANGNDSK (31aa)
  •    Q9UKA9    Asn-31     Polypyrimidine tract-binding protein 2 / Homo sapiens
• VSTNSTR (7aa)
  •    Q99650    Asn-42     Oncostatin-M-specific receptor subunit beta / Homo sapiens
• FHNESLISSQASSY (14aa)
  •    P08637    Asn-63     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• IIVPLNNRENISDPTSPLR (19aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• ENISDPTSPLR (11aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• TNHMGNVTFTIPANR (15aa)
  •    P01024    Asn-85     Complement c3 / Homo sapiens
• NHSYHVEGNLVNTNAGFTAR (20aa)
  •    O43451    Asn-135     Maltase-glucoamylase, intestinal / Homo sapiens
• NTSPDTNYTLYYWHR (15aa)
  •    P78552    Asn-151     Interleukin-13 receptor subunit alpha-1 / Homo sapiens
• EEQFNSTFR (9aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
• CRGLVGSKNVSSE (13aa)
  •    P08637    Asn-180     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •    VAR_003960   176:F→V   dbSNP:rs396991
• FGSKNVSSE (9aa)
  •    P08637    Asn-180     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
• GSKNVSSE (8aa)
  •    P08637    Asn-180     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
• YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
• YPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPR (40aa)
  •    O43734    Asn-263     Adapter protein CIKS / Homo sapiens
• QLDMLDLSNNSLASVPEGLWASLGQPNWDMR (31aa)
  •    P02750    Asn-269     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• NQSVNVFLGHTAIDEMLK (18aa)
  •    Q9NZP8    Asn-296     Complement C1r subcomponent-like protein / Homo sapiens
• NETLALPAESK (11aa)
  •    Q7Z7G0    Asn-313     Target of Nesh-SH3 / Homo sapiens
• SINTTNVMGTSLTVR (15aa)
  •    P01023    Asn-410     Alpha-2-macroglobulin / Homo sapiens
• DIYQFLCNASER (12aa)
  •    O75509    Asn-439     Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
• YVQNGTYTVK (10aa)
  •    Q14126    Asn-462     Desmoglein-2 / Homo sapiens
• NNTMIR (6aa)
  •    P12259    Asn-468     Coagulation factor V / Homo sapiens
• NYTWVPIR (8aa)
  •    Q6PHS9    Asn-627     Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
• ISDNNTEFLLNFNEFIDR (18aa)
  •    P54289    Asn-675     Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
• SVSPTTEMVSNESVDYR (17aa)
  •    P08581    Asn-998     Hepatocyte growth factor receptor / Homo sapiens
• NFSNTK (6aa)
  •    Q4VA53    Asn-1104     Sister chromatid cohesion protein PDS5 homolog B / Mus musculus
• VNNTLSSQISR (11aa)
  •    P11047    Asn-1107     Laminin subunit gamma-1 / Homo sapiens
• NVTAYFPR (8aa)
  •    O43451    Asn-1672     Maltase-glucoamylase, intestinal / Homo sapiens