taxonomy (9)
protein (166)
source (28)
structure (41)
composition (1)
disease (18)
reference (61)
site (249)
peptide (270)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis lupus familiaris (Dog)
- Equus caballus (Domestic horse)
- Mus musculus (House mouse)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
Taxonomy
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- A disintegrin and metalloproteinase with thrombospondin motifs (13adamts13) / Homo sapiens Q76LX8
- ADAM DEC1 / Homo sapiens O15204
- Afamin / Homo sapiens P43652
- Aggrecan core protein / Homo sapiens P16112
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-1b-glycoprotein / Homo sapiens P04217
- Alpha-2-antiplasmin / Homo sapiens P08697
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Alpha-2-macroglobulin / Homo sapiens P01023
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Antithrombin-III / Homo sapiens P01008
- Apolipoprotein (a) / Homo sapiens P08519
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Apolipoprotein M / Homo sapiens O95445
- Asialoglycoprotein receptor 2 / Homo sapiens P07307
- Attractin / Homo sapiens O75882
- BDNF/NT-3 growth factors receptor / Homo sapiens Q16620
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Beta-Ala-His dipeptidase / Homo sapiens Q96KN2
- Biotinidase / Homo sapiens P43251
- Bone marrow stromal antigen 2 / Homo sapiens Q10589
- C4b-binding protein alpha chain / Homo sapiens P04003
- C4b-binding protein beta chain / Homo sapiens P20851
- Cadherin-13 / Homo sapiens P55290
- Carbonic anhydrase 12 / Homo sapiens O43570
- Carboxypeptidase b2 / Homo sapiens Q96IY4
- Carboxypeptidase D / Homo sapiens O75976
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cathepsin L1 / Homo sapiens P07711
- CD166 antigen / Homo sapiens Q13740
- CD44 antigen / Homo sapiens P16070
- CD59 glycoprotein / Homo sapiens P13987
- Cell adhesion molecule 1 / Homo sapiens Q9BY67
- Cerebellin-4 / Homo sapiens Q9NTU7
- Ceruloplasmin / Homo sapiens P00450
- Cholesteryl ester transfer protein / Homo sapiens P11597
- Clusterin / Homo sapiens P10909
- Coagulation factor IX / Homo sapiens P00740
- Coagulation factor VIII / Homo sapiens P00451
- Coagulation factor XI / Homo sapiens P03951
- Coagulation factor XIII B chain / Homo sapiens P05160
- Complement factor h / Homo sapiens P08603
- Complement factor H-related protein 3 / Homo sapiens Q02985
- Complement factor H-related protein 4 / Homo sapiens Q92496
- Complement factor i / Homo sapiens P05156
- Contactin-3 / Homo sapiens Q9P232
- Contactin-4 / Homo sapiens Q8IWV2
- Corticosteroid-binding globulin / Homo sapiens P08185
- Desmoglein-2 / Homo sapiens Q14126
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens P22413
- Ephrin-B2 / Homo sapiens P52799
- Epidermal growth factor receptor / Homo sapiens P00533
- Epithelial cell adhesion molecule / Homo sapiens P16422
- Erythropoietin / Homo sapiens P01588
- Fibroblast growth factor receptor 1 / Homo sapiens P11362
- Fibromodulin / Homo sapiens Q06828
- Fibronectin / Homo sapiens P02751
- Filamin-B / Homo sapiens O75369
- Follitropin, alpha and beta chains / Homo sapiens P01225 P01215
- G-protein coupled receptor 126 / Homo sapiens Q86SQ4
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyltranspeptidase 1 / Homo sapiens P19440
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- Heparin cofactor 2 / Homo sapiens P05546
- Hepatocyte growth factor receptor / Homo sapiens P08581
- Histidine-rich glycoprotein / Homo sapiens P04196
- Homeobox protein Hox-B3 / Homo sapiens P14651
- Icos ligand / Homo sapiens O75144
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01860 P01857
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens P01880
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens Q8TDY8
- Inactive tyrosine-protein kinase 7 / Homo sapiens Q13308
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens P35858
- Integrin alpha-5 / Homo sapiens P08648
- Integrin alpha-5/beta-1 / Homo sapiens P08648 P05556
- Integrin beta-1 / Homo sapiens P05556
- Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens P19827
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Intercellular adhesion molecule 2 / Homo sapiens P13598
- Interferon alpha/beta receptor 2 / Homo sapiens P48551
- Interleukin-1 receptor-like 1 / Homo sapiens Q01638
- Kallistatin / Homo sapiens P29622
- Kininogen-1 / Homo sapiens P01042
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-2 / Homo sapiens P24043
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Leucyl-cystinyl aminopeptidase / Homo sapiens Q9UIQ6
- Lipopolysaccharide-binding protein / Homo sapiens P18428
- Lumican / Homo sapiens P51884
- Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens Q9Y5Y7
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens P38571
- Lysosome membrane protein 2 / Homo sapiens Q14108
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Maltase-glucoamylase, intestinal / Homo sapiens O43451
- Mesothelin / Homo sapiens Q13421
- Multimerin-2 / Homo sapiens Q9H8L6
- Myeloperoxidase / Homo sapiens P05164
- Nectin-4 / Homo sapiens Q96NY8
- Oncoprotein-induced transcript 3 protein / Homo sapiens Q8WWZ8
- Plasma kallikrein / Homo sapiens P03952
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Plasma serine protease inhibitor / Homo sapiens P05154
- Plasminogen / Homo sapiens P00747
- Platelet endothelial cell adhesion molecule / Homo sapiens P16284
- Platelet glycoprotein V / Homo sapiens P40197
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prosaposin / Homo sapiens P07602
- Prostaglandin F2 receptor negative regulator / Homo sapiens Q9P2B2
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Protein heg homolog 1 / Homo sapiens Q9ULI3
- Protein ITFG3 / Homo sapiens Q9H0X4
- Protein Z-dependent protease inhibitor / Homo sapiens Q9UK55
- Prothrombin / Homo sapiens P00734
- Protocadherin-9 / Homo sapiens Q9HC56
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Reelin / Homo sapiens P78509
- Seizure 6-like protein 2 / Homo sapiens Q6UXD5
- Selenoprotein P / Homo sapiens P49908
- Serotransferrin / Homo sapiens P02787
- Serum paraoxonase/arylesterase 1 / Homo sapiens P27169
- Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens Q4LDE5
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Tenascin / Homo sapiens P24821
- Thyroxine-binding globulin / Homo sapiens P05543
- Trafficking protein particle complex subunit 8 / Homo sapiens Q9Y2L5
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- UDP-glucuronosyltransferase 2B15 / Homo sapiens P54855
- Uncharacterized protein from Blood Serum / Homo sapiens
- Uncharacterized protein from Pleura / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Vitronectin / Homo sapiens P04004
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens P54289
- Von willebrand factor / Homo sapiens P04275
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Acetylcholinesterase / Bos taurus P23795
- Alpha-1-acid glycoprotein / Bos taurus Q3SZR3
- Alpha-2-hs-glycoprotein / Bos taurus P12763
- Alpha-1-acid glycoprotein / Canis lupus familiaris F6Y713
- Uncharacterized protein from Dander / Equus caballus
- Monoclonal antibody okt3 / Mus musculus
- Alpha-1-acid glycoprotein / Ovis aries W5P7S6
- T-kininogen / Rattus norvegicus P08932 P01048
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein from Liver / Rattus norvegicus
- Uncharacterized proteoglycan / Rattus norvegicus
- Riboflavin-binding protein / Gallus gallus P02752
- Acetylcholine receptor protein / Torpedo californica P02714 P02718 P02712 P02710
Protein
- Amniotic Fluid (UBERON_0000173)
- Ascitic fluid (UBERON_0007795)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Dander
- Electric Organ (UBERON_0006869)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Placenta (UBERON_0001987)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- HEK293 (CVCL_0045)
- Jurkat (CVCL_0065)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Hepatocyte (CL_0000182)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / Gal(b1-3)GlcNAc(?1-?)[Gal(b1-3)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-3)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 251
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(?1-?) + 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-3) + 2 x NeuAc(a2-6)"
- N-Linked / Complex / NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)[NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-4)]Man(a1-?)[NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 3629
- N-Linked / Complex / Structure 9339
- N-Linked / Complex / Structure 9441
- N-Linked / Complex / Structure 9829
- N-Linked / Complex / Structure 10609
- N-Linked / Complex / Structure 10724
- N-Linked / Complex / Structure 10760
- N-Linked / Complex / Structure 10769
- N-Linked / Complex / Structure 10789
- N-Linked / Complex / Structure 10791
- N-Linked / Complex / Structure 10956
Reported structure
- Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )
Composition
- Cancer, breast (DOID:1612)
- Carcinoma (DOID:305)
- Carcinoma, Hepatocellular (DOID:684)
- Chondrosarcoma (DOID:3371)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Esophageal cancer (DOID:5041)
- Familial hepatic adenoma (DOID:111366)
- Gastritis (DOID:4029)
- Leukemia, Myloid, Chronic (DOID:8552)
- Maturity-onset diabetes of the young type 3 (DOID:0111102)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
- Zajdela Hepatocarcinoma (DOID:686)
Disease
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena DomÃnguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Characterisation of horse dander allergen glycoproteins using amino acid and glycan structure analyses. A mass spectrometric method for glycan chain analysis of glycoproteins separated by two-dimensional electrophoresis. (2000 - Bulone V, Rademaker G, Pergantis S, Krogstad-Johnsen T, Smestad-Paulsen B, Thomas-Oates J) / Status : Reviewed
- Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
- Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
- Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
- Sulfated di-, tri- and tetraantennary N-glycans in human Tamm-Horsfall glycoprotein. (1998 - van Rooijen J, Kamerling J, Vliegenthart J) / Status : Reviewed
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Structures of the N-linked oligosaccharides on human plasma vitronectin. (1995 - Ogawa H, Yoneda A, Seno N, Hayashi M, Ishizuka I, Hase S, Matsumoto I) / Status : Reviewed
- Structural differences between complex-type Asn-linked glycan chains of glycoproteins in rat hepatocytes and Zajdela hepatoma cells. (1995 - Goulut-Chassaing C, Bourrillon R) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
- The carbohydrate structure of the asparagine-linked oligosaccharides of rat plasma thiostatin. (1994 - Rusiniak M, Bedi G, Back N) / Status : Reviewed
- Structures of sugar chains of hen egg yolk riboflavin-binding protein. (1993 - Tarutani M, Norioka N, Mega T, Hase S, Ikenaka T) / Status : Reviewed
- N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
- Electrophoretic resolution and fluorescence detection of N-linked glycoprotein oligosaccharides after reductive amination with 8-aminonaphthalene-1,3,6-trisulphonic acid. (1992 - Stack R, Sullivan M) / Status : Reviewed
- Structure determination of the glycans of human-serum alpha 1-antichymotrypsin using 1H-NMR spectroscopy and deglycosylation by N-glycanase. (1991 - Laine A, Hachulla E, Strecker G, Michalski J, Wieruszeski J) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
- The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
- Separation of the complex asparagine-linked oligosaccharides of the glycoprotein fetuin and elucidation of three triantennary structures having sialic acids linked only to galactose residues. (1989 - Bendiak B, Harris-Brandts M, Michnick S, Carver J, Cumming D) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides of the glycoprotein fetuin having sialic acid linked to N-acetylglucosamine. (1989 - Cumming D, Hellerqvist C, Harris-Brandts M, Michnick S, Carver J, Bendiak B) / Status : Reviewed
- Protein and carbohydrate structural analysis of a recombinant soluble CD4 receptor by mass spectrometry. (1989 - Carr SA, Hemling ME, Folena-Wasserman G, Sweet RW, Anumula K, Barr JR, Huddleston MJ, Taylor P) / Status : Reviewed
- The asparagine-linked oligosaccharides on bovine fetuin. Structural analysis of N-glycanase-released oligosaccharides by 500-megahertz 1H NMR spectroscopy. (1988 - Green E, Adelt G, Baenziger J, Wilson S, Van Halbeek H) / Status : Reviewed
- The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
- Structures of N-linked and O-linked oligosaccharides on proteoglycan monomer isolated from the Swarm rat chondrosarcoma. (1982 - Nilsson B, De Luca S, Lohmander S, Hascall V) / Status : Reviewed
- The structures and microheterogeneity of the carbohydrate chains of human plasma ceruloplasmin. A study employing 500-MHz 1H-NMR spectroscopy. (1982 - Endo M, Suzuki K, Schmid K, Fournet B, Karamanos Y, Montreuil J, Dorland L, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structural studies of asparagine-linked sugar chains of human ceruloplasmin. Structural characteristics of the triantennary complex type sugar chains of human plasma glycoproteins. (1981 - Yamashita K, Liang CJ, Funakoshi S, Kobata A) / Status : Reviewed
- Studies on the oligosaccharide chains of human alpha 1-protease inhibitor. II. Structure of oligosaccharides. (1980 - Mega T, Lujan E, Yoshida A) / Status : Reviewed
- Structure of the complex oligosaccharides of fetuin. (1979 - Baenziger J, Fiete D) / Status : Reviewed
Reference
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- A disintegrin and metalloproteinase with thrombospondin motifs (13adamts13) / Homo sapiens
- ADAM DEC1 / Homo sapiens
- Afamin / Homo sapiens
- Aggrecan core protein / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-1b-glycoprotein / Homo sapiens
- Alpha-2-antiplasmin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Antithrombin-III / Homo sapiens
- Apolipoprotein (a) / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Apolipoprotein M / Homo sapiens
- Asialoglycoprotein receptor 2 / Homo sapiens
- Attractin / Homo sapiens
- BDNF/NT-3 growth factors receptor / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Beta-Ala-His dipeptidase / Homo sapiens
- Biotinidase / Homo sapiens
- Bone marrow stromal antigen 2 / Homo sapiens
- C4b-binding protein alpha chain / Homo sapiens
- C4b-binding protein beta chain / Homo sapiens
- Cadherin-13 / Homo sapiens
- Carbonic anhydrase 12 / Homo sapiens
- Carboxypeptidase b2 / Homo sapiens
- Carboxypeptidase D / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cathepsin L1 / Homo sapiens
- CD166 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Cell adhesion molecule 1 / Homo sapiens
- Cerebellin-4 / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Cholesteryl ester transfer protein / Homo sapiens
- Clusterin / Homo sapiens
-
Coagulation factor IX / Homo sapiens
- Undefined site
- Coagulation factor VIII / Homo sapiens
- Coagulation factor XI / Homo sapiens
- Coagulation factor XIII B chain / Homo sapiens
- Complement factor h / Homo sapiens
- Complement factor H-related protein 3 / Homo sapiens
- Complement factor H-related protein 4 / Homo sapiens
- Complement factor i / Homo sapiens
- Contactin-3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens
- Ephrin-B2 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibroblast growth factor receptor 1 / Homo sapiens
- Fibromodulin / Homo sapiens
- Fibronectin / Homo sapiens
- Filamin-B / Homo sapiens
-
Follitropin, alpha and beta chains / Homo sapiens
- Undefined site
- G-protein coupled receptor 126 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyltranspeptidase 1 / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Hepatocyte growth factor receptor / Homo sapiens
- Histidine-rich glycoprotein / Homo sapiens
- Homeobox protein Hox-B3 / Homo sapiens
- Icos ligand / Homo sapiens
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Asn-205
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
- Inactive tyrosine-protein kinase 7 / Homo sapiens
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
- Integrin alpha-5 / Homo sapiens
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
- Integrin beta-1 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Intercellular adhesion molecule 2 / Homo sapiens
- Interferon alpha/beta receptor 2 / Homo sapiens
- Interleukin-1 receptor-like 1 / Homo sapiens
- Kallistatin / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Leucyl-cystinyl aminopeptidase / Homo sapiens
- Lipopolysaccharide-binding protein / Homo sapiens
- Lumican / Homo sapiens
- Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Maltase-glucoamylase, intestinal / Homo sapiens
- Mesothelin / Homo sapiens
- Multimerin-2 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Nectin-4 / Homo sapiens
- Oncoprotein-induced transcript 3 protein / Homo sapiens
- Plasma kallikrein / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Plasma serine protease inhibitor / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Platelet endothelial cell adhesion molecule / Homo sapiens
- Platelet glycoprotein V / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin F2 receptor negative regulator / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Protein heg homolog 1 / Homo sapiens
- Protein ITFG3 / Homo sapiens
- Protein Z-dependent protease inhibitor / Homo sapiens
- Prothrombin / Homo sapiens
- Protocadherin-9 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Reelin / Homo sapiens
- Seizure 6-like protein 2 / Homo sapiens
- Selenoprotein P / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
- Tenascin / Homo sapiens
- Thyroxine-binding globulin / Homo sapiens
- Trafficking protein particle complex subunit 8 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- UDP-glucuronosyltransferase 2B15 / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Uncharacterized protein from Pleura / Homo sapiens
- Undefined site
-
Uromodulin / Homo sapiens
- Undefined site
- Asn-232
- Vitronectin / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
- Von willebrand factor / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
Alpha-1-acid glycoprotein / Bos taurus
- Undefined site
- Asn-104
- Alpha-2-hs-glycoprotein / Bos taurus
-
Alpha-1-acid glycoprotein / Canis lupus familiaris
- Undefined site
-
Uncharacterized protein from Dander / Equus caballus
- Undefined site
-
Monoclonal antibody okt3 / Mus musculus
- Undefined site
-
Alpha-1-acid glycoprotein / Ovis aries
- Undefined site
-
T-kininogen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
Uncharacterized proteoglycan / Rattus norvegicus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
Reported glycosite
- NPNATSSSSQDPESLQDRGEGK (22aa)
- NPNATSSSSQDPESLQDR (18aa)
- AQNDTEPIVLEGK (13aa)
- MDPNAAYVNMSNHHR (15aa)
- CANLVPVPITNATLDR (16aa)
- CANLVPVPITNATLDQITGK (20aa)
- LVPVPITNATLDQITGK (17aa)
- LCANLVPVPITNATLDR (17aa)
- LVPVPITNATLDR (13aa)
- SIVLEPIYWNSSNSK (15aa)
- TAVNCSSDFDACLITK (16aa)
- TAVNCSSDFDACIITK (16aa)
- YNSQNQSNNQFVLYR (15aa)
- NLSMPLLPADFHK (13aa)
- WQMNFTVR (8aa)
- ANQQLNFTEAK (11aa)
- KWFYIASAFRNEEYNKS (17aa)
- AFNSTLPTMAQMEK (14aa)
- YETTNK (6aa)
- NMTFDLPSDATVVLNR (16aa)
- IADAHIDRVENTTVYYIVIDVQESDCSVISR (31aa)
- NVTHLLQQELTEAQK (15aa)
- CIQANYSIMENGK (13aa)
- ALGFENATQALGR (13aa)
- NK (2aa)
- MLFVEPILEVSSLPTTNSTTNSATK (25aa)
- TVVTYHIPQNSSLENVDSR (19aa)
- SVQEIQATFFYFTPNK (16aa)
- FYFTPNKTEDTIFLR (15aa)
- YFTPNKTEDTIFLR (14aa)
- KSVQEIQATFFYFTPNKT (18aa)
- KQVHFFVNASDVDNVK (16aa)
- QVHFFVNASDVDNVK (15aa)
- AEMNGSK (7aa)
- TTENYPNAGLIMNYCR (16aa)
- KYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANK (40aa)
- AFITNFSMIIDGMTYPGIIK (20aa)
- EGYSNISYIVVNHQGISSR (19aa)
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKC (34aa)
- DDVLFYNISSMK (12aa)
- AHLNVSGIPC (10aa)
- KEDALNETR (9aa)
- NNATVHEQVGGPSLTSDLQAQSK (23aa)
- KNNATVHEQVGGPSLTSDLQAQSKG (25aa)
- KKKEDALNETRE (12aa)
- KKKEDALNETRESETKL (17aa)
- KEDALNETRESETKL (15aa)
- NNATVHEQVGGPSITSDIQAQSK (23aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- ICNQNSSNPNQR (12aa)
- INISENYTISISNAR (15aa)
- QNQCFYNSSYLNVQR (15aa)
- LSLGAHNTTLTEILK (15aa)
- NVIFSPLSISTALAFLSLGAHNTTLTEILK (30aa)
- SLGAHNTTLTEILK (14aa)
- QDQCIYNTTYLNVQR (15aa)
- QNQCFYNSSYINVQR (15aa)
- QDQCIYNTTYINVQR (15aa)
- AQLLQGLGFNLTER (14aa)
- AQIIQGIGFNITER (14aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- IGHCPDPVIVNGEFSSSGPVNVSDK (25aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- RPTGEVYDIEIDTLETTCHVLDPTPLANCSVR (32aa)
- IAVQFGPGFSWIANFTK (17aa)
- FQLLNFSSSELK (12aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- ELPGVCNETMMALWEECK (18aa)
- TFYWDFYTNR (10aa)
- SIDVSIQNVSVVFK (14aa)
- FNLTETSEAEIHQSFQHLLR (20aa)
- ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
- ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR (32aa)
- SQIIEGIGFNITEISESDVHR (21aa)
- SQILEGLGFNLTELSESDVHR (21aa)
- DIVEYYNDSNGSHVLQGR (18aa)
- GQALLVNSSQPWEPLQLHVDK (21aa)
- DTGELNVTSILDR (13aa)
- SANASFNIK (9aa)
- ALSHLALGAQNHTLQR (16aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- TLNQSSDELQLSMGNAMFVK (20aa)
- TLNQSSDELQLSMGN (15aa)
- TINQSSDEIQISMGNAMFVK (20aa)
- LGACNDTLQQLMEVFK (16aa)
- TELFSSSCPGGIMLNETGQGYQR (23aa)
- GEMSRPGEVCSALNLCESLQK (21aa)
- KEHEGAIYPDNTTDFQRADDKV (22aa)
- EHEGAIYPDNTTDFQR (16aa)
- YPHKPEINSTTHPGADLQENFCR (23aa)
- SRYPHKPEINSTTHPGADLQENFCR (25aa)
- QIEEFINQSSPFYFWMNGDR (20aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- LCPDCPLLAPLNDSR (15aa)
- VCQDCPIIAPINDTR (15aa)
- KVCQDCPLLAPLNDTR (16aa)
- KVCQDCPLLAPLNDTRV (17aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- RKVCQDCPLLAPLNDTRV (18aa)
- VCQDCPLLAPLNDTR (15aa)
- FINDTMAVYEAK (12aa)
- YDIPASINFIINK (13aa)
- VYKPSAGNNSLYR (13aa)
- TLYETEVFSTDFSNISAAK (19aa)
- IYIDHNNITR (10aa)
- HGIQYFNNNTQHSSLFMLNEVK (22aa)
- NGSLFAFR (8aa)
- HGIQYFNNNTQH (12aa)
- HGIQYFNNNTQHSSLFTLNEVK (22aa)
- FVACQMELLHSNGSQR (16aa)
- IINTTDVYIIPSINPDGFER (20aa)
- VVHAVEVALATFNAESNGSYLQLVEISR (28aa)
- AALAAFNAQNNGSNFQLEEISR (22aa)
- NAQNNGSNFQLEEISR (16aa)
- LSDLSINSTECLHVHCR (17aa)
- ISDISINSTECIHVHCR (17aa)
- REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR (34aa)
- ETFFNLSK (8aa)
- LLDLSGNNLTHLPK (14aa)
- MVSHHNITTGATIINEQWIITTAK (24aa)
- MVSHHNLTTGATLINEQWLLTTAK (24aa)
- EHAVFTSNQEEQDPANHTCGVK (22aa)
- QVLFLDTVYGNCSTHFTVK (19aa)
- SWPAVGNCSSALR (13aa)
- SWPAVGNCSSAIR (13aa)
- NFSCLAVLDLMSR (13aa)
- DFVNASSK (8aa)
- GNMSGNFTYIIDK (13aa)
- YQFNTNVVFSNNGTIVDR (18aa)
- ALPGNLTAAVMEANQTGHEFPDR (23aa)
- ITYSIVQTNCSK (12aa)
- SIVQTNCSK (9aa)
- NLFLNHSENATAK (13aa)
- FSIIGHASISCTVENETIGVWRPSPPTCEK (30aa)
- ASISCTVENETIGVWRPSPPTCEK (24aa)
- YSVANDTGFVDIPK (14aa)
- VEMANLLNLSER (12aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- YANITVDYLYNK (12aa)
- DFYVDENTTVR (11aa)
- NTTVRVPMMLQDQE (14aa)
- VVLHPNYSQVDIGLIK (16aa)
- KVVLHPNYSQVDIGLIKL (18aa)
- VVIHPNYSQVDIGIIK (16aa)
- NISDGFDGIPDNVDAALALPAHSYSGR (27aa)
- RNGTGHGNSTHHGPEYMRC (19aa)
- KDNTTVTR (8aa)
- HANWTLTPLK (10aa)
- IGNWSAMPSCK (11aa)
- VLSNNSDANLELINTWVAK (19aa)
- LGNWSAMPSCK (11aa)
- VVGVPYQGNATALFILPSEGK (21aa)
- ISNSSDTVECECSENWKGEACDIPHCTDNCGFPHR (35aa)
- ISNSSDTVECECSENWK (17aa)
- YIGNATAIFFIPDEGK (16aa)
- YTGNASALFILPDQDK (16aa)
- YLGNATAIFFLPDEGK (16aa)
- KYTGNASALFILPDQDKM (18aa)
- KYLGNATAIFFLPDEGKL (18aa)
- DTCPPLMLYNPTTYQMDVNPEGK (23aa)
- IQQEEGQNQSFSNGLACLDMVLR (23aa)
- DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
- CLSEGQPPPSYNWTR (15aa)
- ICDLLVANNHFAHFFAPQNLTNMNK (25aa)
- MNASFSLK (8aa)
- NVSVAEGK (8aa)
- ELVGGLELFLTNTSCR (16aa)
- LNAENNATFYFK (12aa)
- INAENNATFYFK (12aa)
- GVSNGTHVNILFSLK (15aa)
- LGYNANTSILSFQAVCR (17aa)
- HVNEINATIYLLK (13aa)
- ISNMSEESANMIASALAQIPQKVLWR (26aa)
- SCPACPGSNITIR (13aa)
- VTQVYAENGTVIQGSTVASVYK (22aa)
- VTQVYAENGTVLQGSTVASVYK (22aa)
- MFSQNDTR (8aa)
- GNPKPALQWFYNGAILNESK (20aa)
- IIDNNKTEK (9aa)
- NMTSEFFAAQLR (12aa)
- NPVGLIGAENATGETDPSHSK (21aa)
- MLNTSSLLEQLNEQFNWVSR (20aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- AGIQAFFQVQECNK (14aa)
- AGLQAFFQVQECNK (14aa)
- NCTSISGDLHILPVAFR (17aa)
- NATVVWMK (8aa)
- DASSFIAEWQNITK (14aa)
- IVSPEPGGAVGPNLTCR (17aa)
- LANLTQGEDQYYLR (14aa)
- IANITQGEDQYYIR (14aa)
- RLANLTQGEDQYYLRV (16aa)
- TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- IIIAGTNSSDIQQIISIIESNK (22aa)
- LVPHMNVSAVEK (12aa)
- LSVATNVSATLTFNTSK (17aa)
- YKPDTIAVAVENGTGTDR (18aa)
- ENITAPGSDSAVFFEQGTTR (20aa)
- ENLTAPGSDSAVFFEQGTTR (20aa)
- GLNLTEDTYKPR (12aa)
- YKGLNLTEDTYKPR (14aa)
- YAEDKFNETTEK (12aa)
- TMVFPVMYLNESVHIDK (17aa)
- VAEAVSSPAGVGVTWIEPDYQVYINASK (28aa)
- SFHNFTLCYIK (11aa)
- CGIVPVIAENYNK (13aa)
- CGLVPVLAENYNK (13aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- ALPQPQNVTSLLGCTH (16aa)
- AIPQPQNVTSIIGCTH (16aa)
- VPGNVTAVIGETIK (14aa)
- IIISPEENVTITCTAENQIER (21aa)
- LETTVNYTDSQRPICLPSK (19aa)
- LQAPLNYTEFQK (12aa)
- LQAPLNYTEFQKPICLPSK (19aa)
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
- GPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPK (37aa)
- SCSLEGNPVACINLSFCLNASGK (23aa)
- ALSQQNVSMDLATFMK (16aa)
- DQCIVDDITYNVNDTFHK (18aa)
- HGVIISSTVDTYENGSSVEYR (21aa)
- LGYNANTSVLSFQAVCR (17aa)
- NQALNLSLAYSFVTPLTSMVVTK (23aa)
- NQALNLSLAY (10aa)
- FVQAICEGDDCQPPAYTYNNITCASPPEVVGIDIR (35aa)
- RPPGLEYCYNPSHNPEEQLSSK (22aa)
- ISNSSHSEYSSFFHAQTER (19aa)
- MSISPNTTYPSLLEDGR (17aa)
- QQQHLFGSNVTDCSGNF (17aa)
- QQQHLFGSNVTDCSGNFCLFR (21aa)
- QQQHLFGSNVTDCSGN (16aa)
- QQQHIFGSNVTDCSGNFCIFR (21aa)
- TVYLYPNQTGLPDPLSR (17aa)
- DTCTQECSYFNITK (14aa)
- ANYNLPIMVTDSGKPPMTNITDLR (24aa)
- VTINVMDVNDNSPVVISPPSNTSFK (25aa)
- TEEALPEVTPANVSGGGGSK (20aa)
- DQDPASFGADSLLLNSSR (18aa)
- NHSCSEGQISIFR (13aa)
- EIHHIQEQNVSNAFIDKGEFYIGSK (25aa)
- ELHHLQEQNVSNAFLDKGEFYIGSK (25aa)
- LHHLQEQNVSNAFLDKGE (18aa)
- ELHHLQEQNVSNAFLDK (17aa)
- KELHHLQEQNVSNAFLDKG (19aa)
- NESVHPFSPFEVK (13aa)
- SLDNDNYVFTAPYFNK (16aa)
- NASLVTYYTSSGEDILIGGLKPFTK (25aa)
- IQNVSSSDLLMLLR (14aa)
- DNIGSQYLLNWCVQIAK (17aa)
- SHNMTTTLNYR (11aa)
- IFDDWMASNGTQSIPTDVMTTVFK (24aa)
- IPCSQPPQIEHGTINSSR (18aa)
- TPPSQPPGNVVWNATDTK (18aa)
- ISEENETTCYMGK (13aa)
- NDTLEWENQQR (11aa)
- SVSPTTEMVSNESVDYR (17aa)
- SLSSSSIGSNSTYLTSK (17aa)
- LISNCSK (7aa)
- VEAAQNLTLPGSLR (14aa)
- VSNQTLSLFFTVLQDVPVR (19aa)
- NESGIILLGSGGTPAPPR (18aa)
- HVGNQQYNVTYVVKER (16aa)
- ADILDVVGMLYVGGLPINYTTR (22aa)
- IGSENNMTSCHRPICR (16aa)
- HDYILLPEDALTNTTR (16aa)
- VEGSHNSTVSLTTK (14aa)
- FEVDSPVYNATWSASLK (17aa)
- FEVDSPVYNATWSASIK (17aa)
- TPENYPNAGLTENYCR (16aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein / Canis lupus familiaris
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Electric Organ (UBERON_0006869)
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Electric Organ (UBERON_0006869)
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
Plasminogen / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Vitronectin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
-
Alpha-1-acid glycoprotein / Bos taurus
- Undefined site
-
Alpha-1-acid glycoprotein / Ovis aries
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
-
Plasminogen / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Plasma (UBERON_0001969)
-
Coagulation factor IX / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
-
Plasminogen / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Structures of sugar chains of hen egg yolk riboflavin-binding protein. (1993 - Tarutani M, Norioka N, Mega T, Hase S, Ikenaka T) / Status : Reviewed
- The asparagine-linked oligosaccharides on bovine fetuin. Structural analysis of N-glycanase-released oligosaccharides by 500-megahertz 1H NMR spectroscopy. (1988 - Green E, Adelt G, Baenziger J, Wilson S, Van Halbeek H) / Status : Reviewed
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Chondrosarcoma (DOID:3371)
- Sulfated di-, tri- and tetraantennary N-glycans in human Tamm-Horsfall glycoprotein. (1998 - van Rooijen J, Kamerling J, Vliegenthart J) / Status : Reviewed
- The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
- Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
- The asparagine-linked oligosaccharides on bovine fetuin. Structural analysis of N-glycanase-released oligosaccharides by 500-megahertz 1H NMR spectroscopy. (1988 - Green E, Adelt G, Baenziger J, Wilson S, Van Halbeek H) / Status : Reviewed
- Structures of N-linked and O-linked oligosaccharides on proteoglycan monomer isolated from the Swarm rat chondrosarcoma. (1982 - Nilsson B, De Luca S, Lohmander S, Hascall V) / Status : Reviewed
-
Follitropin, alpha and beta chains / Homo sapiens
- Undefined site
-
Uromodulin / Homo sapiens
- Undefined site
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
Uncharacterized proteoglycan / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Plasma (UBERON_0001969)
-
Vitronectin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
-
Follitropin, alpha and beta chains / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Amniotic Fluid (UBERON_0000173)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Colon adenocarcinoma (DOID:234)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- Electrophoretic resolution and fluorescence detection of N-linked glycoprotein oligosaccharides after reductive amination with 8-aminonaphthalene-1,3,6-trisulphonic acid. (1992 - Stack R, Sullivan M) / Status : Reviewed
- The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
- Separation of the complex asparagine-linked oligosaccharides of the glycoprotein fetuin and elucidation of three triantennary structures having sialic acids linked only to galactose residues. (1989 - Bendiak B, Harris-Brandts M, Michnick S, Carver J, Cumming D) / Status : Reviewed
- The asparagine-linked oligosaccharides on bovine fetuin. Structural analysis of N-glycanase-released oligosaccharides by 500-megahertz 1H NMR spectroscopy. (1988 - Green E, Adelt G, Baenziger J, Wilson S, Van Halbeek H) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
Monoclonal antibody okt3 / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Amniotic Fluid (UBERON_0000173)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Liver (UBERON_0002107)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Yolk (GO_0060417)
- Colon adenocarcinoma (DOID:234)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
- Structures of sugar chains of hen egg yolk riboflavin-binding protein. (1993 - Tarutani M, Norioka N, Mega T, Hase S, Ikenaka T) / Status : Reviewed
- N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed
- Electrophoretic resolution and fluorescence detection of N-linked glycoprotein oligosaccharides after reductive amination with 8-aminonaphthalene-1,3,6-trisulphonic acid. (1992 - Stack R, Sullivan M) / Status : Reviewed
- Structure determination of the glycans of human-serum alpha 1-antichymotrypsin using 1H-NMR spectroscopy and deglycosylation by N-glycanase. (1991 - Laine A, Hachulla E, Strecker G, Michalski J, Wieruszeski J) / Status : Reviewed
- The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
- Separation of the complex asparagine-linked oligosaccharides of the glycoprotein fetuin and elucidation of three triantennary structures having sialic acids linked only to galactose residues. (1989 - Bendiak B, Harris-Brandts M, Michnick S, Carver J, Cumming D) / Status : Reviewed
- The asparagine-linked oligosaccharides on bovine fetuin. Structural analysis of N-glycanase-released oligosaccharides by 500-megahertz 1H NMR spectroscopy. (1988 - Green E, Adelt G, Baenziger J, Wilson S, Van Halbeek H) / Status : Reviewed
- The structures and microheterogeneity of the carbohydrate chains of human plasma ceruloplasmin. A study employing 500-MHz 1H-NMR spectroscopy. (1982 - Endo M, Suzuki K, Schmid K, Fournet B, Karamanos Y, Montreuil J, Dorland L, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structural studies of asparagine-linked sugar chains of human ceruloplasmin. Structural characteristics of the triantennary complex type sugar chains of human plasma glycoproteins. (1981 - Yamashita K, Liang CJ, Funakoshi S, Kobata A) / Status : Reviewed
-
Alpha-1-antichymotrypsin / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Ceruloplasmin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
Monoclonal antibody okt3 / Mus musculus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
-
Alpha-1-antitrypsin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Amniotic Fluid (UBERON_0000173)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Liver (UBERON_0002107)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Structures of the N-linked oligosaccharides on human plasma vitronectin. (1995 - Ogawa H, Yoneda A, Seno N, Hayashi M, Ishizuka I, Hase S, Matsumoto I) / Status : Reviewed
- The asparagine-linked oligosaccharides on bovine fetuin. Structural analysis of N-glycanase-released oligosaccharides by 500-megahertz 1H NMR spectroscopy. (1988 - Green E, Adelt G, Baenziger J, Wilson S, Van Halbeek H) / Status : Reviewed
- The structures and microheterogeneity of the carbohydrate chains of human plasma ceruloplasmin. A study employing 500-MHz 1H-NMR spectroscopy. (1982 - Endo M, Suzuki K, Schmid K, Fournet B, Karamanos Y, Montreuil J, Dorland L, van Halbeek H, Vliegenthart J) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Ceruloplasmin / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Vitronectin / Homo sapiens
- Undefined site
-
Alpha-2-hs-glycoprotein / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Plasma (UBERON_0001969)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- Hepatocyte (CL_0000182)
- Zajdela Hepatocarcinoma (DOID:686)
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Structural differences between complex-type Asn-linked glycan chains of glycoproteins in rat hepatocytes and Zajdela hepatoma cells. (1995 - Goulut-Chassaing C, Bourrillon R) / Status : Reviewed
- The carbohydrate structure of the asparagine-linked oligosaccharides of rat plasma thiostatin. (1994 - Rusiniak M, Bedi G, Back N) / Status : Reviewed
-
T-kininogen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Zajdela Hepatocarcinoma (DOID:686)
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Structural differences between complex-type Asn-linked glycan chains of glycoproteins in rat hepatocytes and Zajdela hepatoma cells. (1995 - Goulut-Chassaing C, Bourrillon R) / Status : Reviewed
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Leukemia, Myloid, Chronic (DOID:8552)
-
Uncharacterized protein from Pleura / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Dander
-
Uncharacterized protein from Dander / Equus caballus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Kidney (UBERON_0002113)
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Alpha-1-antichymotrypsin / Homo sapiens
- Coagulation factor XI / Homo sapiens
- Haptoglobin / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Vitronectin / Homo sapiens
- Alpha-2-hs-glycoprotein / Bos taurus
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Erythropoietin / Homo sapiens
- GQALLVNSSQPWEPLQLHVDK (21aa)
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Milk (UBERON_0001913)
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Clusterin / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Vitronectin / Homo sapiens
- KWFYIASAFRNEEYNKS (17aa)
- KSVQEIQATFFYFTPNKT (18aa)
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKC (34aa)
- KEDALNETRESETKL (15aa)
- KKKEDALNETRE (12aa)
- KKKEDALNETRESETKL (17aa)
- KNNATVHEQVGGPSLTSDLQAQSKG (25aa)
- KEHEGAIYPDNTTDFQRADDKV (22aa)
- KVCQDCPLLAPLNDTRV (17aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- RKVCQDCPLLAPLNDTRV (18aa)
- KVVLHPNYSQVDIGLIKL (18aa)
- RNGTGHGNSTHHGPEYMRC (19aa)
- KYLGNATAIFFLPDEGKL (18aa)
- KYTGNASALFILPDQDKM (18aa)
- RLANLTQGEDQYYLRV (16aa)
- KELHHLQEQNVSNAFLDKG (19aa)
-
- N-Linked / Complex
(avg mass : 2880.6184)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Bone Marrow (UBERON_0002371)
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- Familial hepatic adenoma (DOID:111366)
- Maturity-onset diabetes of the young type 3 (DOID:0111102)
-
Alpha-1-acid glycoprotein 1 / Homo sapiens
- Undefined site
-
Alpha-1-antitrypsin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
- Hex:6 HexNAc:5 NeuAc:3 / N-Linked
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
- N-Linked / Complex / Gal(b1-3)GlcNAc(?1-?)[Gal(b1-3)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-3)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 251
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(?1-?) + 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-3) + 2 x NeuAc(a2-6)"
- N-Linked / Complex / NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)[NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-4)]Man(a1-?)[NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 3629
- N-Linked / Complex / Structure 9339
- N-Linked / Complex / Structure 9441
- N-Linked / Complex / Structure 9829
- N-Linked / Complex / Structure 10609
- N-Linked / Complex / Structure 10724
- N-Linked / Complex / Structure 10760
- N-Linked / Complex / Structure 10769
- N-Linked / Complex / Structure 10789
- N-Linked / Complex / Structure 10791
- N-Linked / Complex / Structure 10956
- Alpha-2-hs-glycoprotein / Bos taurus
- RPTGEVYDIEIDTLETTCHVLDPTPLANCSVR (32aa)
- LCPDCPLLAPLNDSR (15aa)
- VVHAVEVALATFNAESNGSYLQLVEISR (28aa)
-
- Hex:6 HexNAc:5 NeuAc:3 / N-Linked
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Jurkat (CVCL_0065)
- N-Linked / Complex / Gal(b1-3)GlcNAc(?1-?)[Gal(b1-3)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-3)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 251
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(?1-?) + 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-3) + 2 x NeuAc(a2-6)"
- N-Linked / Complex / NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)[NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-4)]Man(a1-?)[NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 3629
- N-Linked / Complex / Structure 9339
- N-Linked / Complex / Structure 9441
- N-Linked / Complex / Structure 9829
- N-Linked / Complex / Structure 10609
- N-Linked / Complex / Structure 10724
- N-Linked / Complex / Structure 10760
- N-Linked / Complex / Structure 10769
- N-Linked / Complex / Structure 10789
- N-Linked / Complex / Structure 10791
- N-Linked / Complex / Structure 10956
- Cancer, breast (DOID:1612)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- A disintegrin and metalloproteinase with thrombospondin motifs (13adamts13) / Homo sapiens
- ADAM DEC1 / Homo sapiens
- Afamin / Homo sapiens
- Aggrecan core protein / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-1b-glycoprotein / Homo sapiens
- Alpha-2-antiplasmin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Antithrombin-III / Homo sapiens
- Apolipoprotein (a) / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Apolipoprotein M / Homo sapiens
- Asialoglycoprotein receptor 2 / Homo sapiens
- Attractin / Homo sapiens
- BDNF/NT-3 growth factors receptor / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Beta-Ala-His dipeptidase / Homo sapiens
- Biotinidase / Homo sapiens
- Bone marrow stromal antigen 2 / Homo sapiens
- C4b-binding protein alpha chain / Homo sapiens
- C4b-binding protein beta chain / Homo sapiens
- Cadherin-13 / Homo sapiens
- Carbonic anhydrase 12 / Homo sapiens
- Carboxypeptidase b2 / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Cathepsin L1 / Homo sapiens
- CD166 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Cell adhesion molecule 1 / Homo sapiens
- Cerebellin-4 / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Cholesteryl ester transfer protein / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor VIII / Homo sapiens
- Coagulation factor XI / Homo sapiens
- Coagulation factor XIII B chain / Homo sapiens
- Complement factor h / Homo sapiens
- Complement factor H-related protein 3 / Homo sapiens
- Complement factor H-related protein 4 / Homo sapiens
- Complement factor i / Homo sapiens
- Contactin-3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens
- Ephrin-B2 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Fibroblast growth factor receptor 1 / Homo sapiens
- Fibromodulin / Homo sapiens
- Fibronectin / Homo sapiens
- Filamin-B / Homo sapiens
- G-protein coupled receptor 126 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyltranspeptidase 1 / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Hepatocyte growth factor receptor / Homo sapiens
- Histidine-rich glycoprotein / Homo sapiens
- Homeobox protein Hox-B3 / Homo sapiens
- Icos ligand / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
- Inactive tyrosine-protein kinase 7 / Homo sapiens
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
- Integrin alpha-5 / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Intercellular adhesion molecule 2 / Homo sapiens
- Interferon alpha/beta receptor 2 / Homo sapiens
- Interleukin-1 receptor-like 1 / Homo sapiens
- Kallistatin / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Leucyl-cystinyl aminopeptidase / Homo sapiens
- Lipopolysaccharide-binding protein / Homo sapiens
- Lumican / Homo sapiens
- Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Maltase-glucoamylase, intestinal / Homo sapiens
- Mesothelin / Homo sapiens
- Multimerin-2 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Nectin-4 / Homo sapiens
- Oncoprotein-induced transcript 3 protein / Homo sapiens
- Plasma kallikrein / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Plasma serine protease inhibitor / Homo sapiens
- Platelet endothelial cell adhesion molecule / Homo sapiens
- Platelet glycoprotein V / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin F2 receptor negative regulator / Homo sapiens
- Protein heg homolog 1 / Homo sapiens
- Protein ITFG3 / Homo sapiens
- Protein Z-dependent protease inhibitor / Homo sapiens
- Prothrombin / Homo sapiens
- Protocadherin-9 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Reelin / Homo sapiens
- Seizure 6-like protein 2 / Homo sapiens
- Selenoprotein P / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
- Tenascin / Homo sapiens
- Thyroxine-binding globulin / Homo sapiens
- Trafficking protein particle complex subunit 8 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- UDP-glucuronosyltransferase 2B15 / Homo sapiens
- Uromodulin / Homo sapiens
- Vitronectin / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
- Von willebrand factor / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Alpha-1-acid glycoprotein / Bos taurus
- Alpha-2-hs-glycoprotein / Bos taurus
- NPNATSSSSQDPESLQDRGEGK (22aa)
- NPNATSSSSQDPESLQDR (18aa)
- AQNDTEPIVLEGK (13aa)
- MDPNAAYVNMSNHHR (15aa)
- CANLVPVPITNATLDR (16aa)
- CANLVPVPITNATLDQITGK (20aa)
- LVPVPITNATLDQITGK (17aa)
- LCANLVPVPITNATLDR (17aa)
- LVPVPITNATLDR (13aa)
- SIVLEPIYWNSSNSK (15aa)
- TAVNCSSDFDACLITK (16aa)
- TAVNCSSDFDACIITK (16aa)
- YNSQNQSNNQFVLYR (15aa)
- NLSMPLLPADFHK (13aa)
- WQMNFTVR (8aa)
- ANQQLNFTEAK (11aa)
- AFNSTLPTMAQMEK (14aa)
- YETTNK (6aa)
- NMTFDLPSDATVVLNR (16aa)
- IADAHIDRVENTTVYYIVIDVQESDCSVISR (31aa)
- NVTHLLQQELTEAQK (15aa)
- CIQANYSIMENGK (13aa)
- ALGFENATQALGR (13aa)
- MLFVEPILEVSSLPTTNSTTNSATK (25aa)
- TVVTYHIPQNSSLENVDSR (19aa)
- SVQEIQATFFYFTPNK (16aa)
- FYFTPNKTEDTIFLR (15aa)
- YFTPNKTEDTIFLR (14aa)
- KQVHFFVNASDVDNVK (16aa)
- QVHFFVNASDVDNVK (15aa)
- AEMNGSK (7aa)
- TTENYPNAGLIMNYCR (16aa)
- KYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANK (40aa)
- AFITNFSMIIDGMTYPGIIK (20aa)
- EGYSNISYIVVNHQGISSR (19aa)
- DDVLFYNISSMK (12aa)
- AHLNVSGIPC (10aa)
- KEDALNETR (9aa)
- NNATVHEQVGGPSLTSDLQAQSK (23aa)
- NNATVHEQVGGPSITSDIQAQSK (23aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- ICNQNSSNPNQR (12aa)
- INISENYTISISNAR (15aa)
- QNQCFYNSSYLNVQR (15aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:5 NeuAc:3 / N-Linked
(avg mass : 2880.6184)
Source
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:5 NeuAc:3 / N-Linked
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2880.6184)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2880.6184)