Hex:6 HexNAc:5 NeuAc:3

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Canis lupus familiaris (Dog)
• Equus caballus (Domestic horse)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Gallus gallus (Chicken)
• Torpedo californica (Pacific electric ray)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• A disintegrin and metalloproteinase with thrombospondin motifs (13adamts13) / Homo sapiens    Q76LX8
• ADAM DEC1 / Homo sapiens    O15204
• Afamin / Homo sapiens    P43652
• Aggrecan core protein / Homo sapiens    P16112
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-1b-glycoprotein / Homo sapiens    P04217
• Alpha-2-antiplasmin / Homo sapiens    P08697
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Antithrombin-III / Homo sapiens    P01008
• Apolipoprotein (a) / Homo sapiens    P08519
• Apolipoprotein B-100 / Homo sapiens    P04114
• Apolipoprotein D / Homo sapiens    P05090
• Apolipoprotein M / Homo sapiens    O95445
• Asialoglycoprotein receptor 2 / Homo sapiens    P07307
• Attractin / Homo sapiens    O75882
• BDNF/NT-3 growth factors receptor / Homo sapiens    Q16620
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Beta-Ala-His dipeptidase / Homo sapiens    Q96KN2
• Biotinidase / Homo sapiens    P43251
• Bone marrow stromal antigen 2 / Homo sapiens    Q10589
• C4b-binding protein alpha chain / Homo sapiens    P04003
• C4b-binding protein beta chain / Homo sapiens    P20851
• Cadherin-13 / Homo sapiens    P55290
• Carbonic anhydrase 12 / Homo sapiens    O43570
• Carboxypeptidase b2 / Homo sapiens    Q96IY4
• Carboxypeptidase D / Homo sapiens    O75976
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Cathepsin L1 / Homo sapiens    P07711
• CD166 antigen / Homo sapiens    Q13740
• CD44 antigen / Homo sapiens    P16070
• CD59 glycoprotein / Homo sapiens    P13987
• Cell adhesion molecule 1 / Homo sapiens    Q9BY67
• Cerebellin-4 / Homo sapiens    Q9NTU7
• Ceruloplasmin / Homo sapiens    P00450
• Cholesteryl ester transfer protein / Homo sapiens    P11597
• Clusterin / Homo sapiens    P10909
• Coagulation factor IX / Homo sapiens    P00740
• Coagulation factor VIII / Homo sapiens    P00451
• Coagulation factor XI / Homo sapiens    P03951
• Coagulation factor XIII B chain / Homo sapiens    P05160
• Complement factor h / Homo sapiens    P08603
• Complement factor H-related protein 3 / Homo sapiens    Q02985
• Complement factor H-related protein 4 / Homo sapiens    Q92496
• Complement factor i / Homo sapiens    P05156
• Contactin-3 / Homo sapiens    Q9P232
• Contactin-4 / Homo sapiens    Q8IWV2
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Desmoglein-2 / Homo sapiens    Q14126
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens    P22413
• Ephrin-B2 / Homo sapiens    P52799
• Epidermal growth factor receptor / Homo sapiens    P00533
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• Erythropoietin / Homo sapiens    P01588
• Fibroblast growth factor receptor 1 / Homo sapiens    P11362
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Filamin-B / Homo sapiens    O75369
• Follitropin, alpha and beta chains / Homo sapiens    P01225    P01215
• G-protein coupled receptor 126 / Homo sapiens    Q86SQ4
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-glutamyltranspeptidase 1 / Homo sapiens    P19440
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Heparin cofactor 2 / Homo sapiens    P05546
• Hepatocyte growth factor receptor / Homo sapiens    P08581
• Histidine-rich glycoprotein / Homo sapiens    P04196
• Homeobox protein Hox-B3 / Homo sapiens    P14651
• Icos ligand / Homo sapiens    O75144
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens    P0DOX2
• Immunoglobulin gamma / Homo sapiens    P01860    P01859    P01861    P01857
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens    P01877
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens    P01880
• Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens    Q8TDY8
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens    P35858
• Integrin alpha-5 / Homo sapiens    P08648
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Integrin beta-1 / Homo sapiens    P05556
• Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens    P19827
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Intercellular adhesion molecule 2 / Homo sapiens    P13598
• Interferon alpha/beta receptor 2 / Homo sapiens    P48551
• Interleukin-1 receptor-like 1 / Homo sapiens    Q01638
• Kallistatin / Homo sapiens    P29622
• Kininogen-1 / Homo sapiens    P01042
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Leucyl-cystinyl aminopeptidase / Homo sapiens    Q9UIQ6
• Lipopolysaccharide-binding protein / Homo sapiens    P18428
• Lumican / Homo sapiens    P51884
• Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens    Q9Y5Y7
• Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens    P38571
• Lysosome membrane protein 2 / Homo sapiens    Q14108
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Maltase-glucoamylase, intestinal / Homo sapiens    O43451
• Mesothelin / Homo sapiens    Q13421
• Multimerin-2 / Homo sapiens    Q9H8L6
• Myeloperoxidase / Homo sapiens    P05164
• Nectin-4 / Homo sapiens    Q96NY8
• Oncoprotein-induced transcript 3 protein / Homo sapiens    Q8WWZ8
• Plasma kallikrein / Homo sapiens    P03952
• Plasma protease c1 inhibitor / Homo sapiens    P05155
• Plasma serine protease inhibitor / Homo sapiens    P05154
• Plasminogen / Homo sapiens    P00747
• Platelet endothelial cell adhesion molecule / Homo sapiens    P16284
• Platelet glycoprotein V / Homo sapiens    P40197
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Prosaposin / Homo sapiens    P07602
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Protein heg homolog 1 / Homo sapiens    Q9ULI3
• Protein ITFG3 / Homo sapiens    Q9H0X4
• Protein Z-dependent protease inhibitor / Homo sapiens    Q9UK55
• Prothrombin / Homo sapiens    P00734
• Protocadherin-9 / Homo sapiens    Q9HC56
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Reelin / Homo sapiens    P78509
• Seizure 6-like protein 2 / Homo sapiens    Q6UXD5
• Selenoprotein P / Homo sapiens    P49908
• Serotransferrin / Homo sapiens    P02787
• Serum paraoxonase/arylesterase 1 / Homo sapiens    P27169
• Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens    Q4LDE5
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Tenascin / Homo sapiens    P24821
• Thyroxine-binding globulin / Homo sapiens    P05543
• Trafficking protein particle complex subunit 8 / Homo sapiens    Q9Y2L5
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• UDP-glucuronosyltransferase 2B15 / Homo sapiens    P54855
• Uncharacterized protein from Blood Serum / Homo sapiens    
• Uncharacterized protein from Pleura / Homo sapiens    
• Uromodulin / Homo sapiens    P07911
• Vitronectin / Homo sapiens    P04004
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens    P54289
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Acetylcholinesterase / Bos taurus    P23795
• Alpha-1-acid glycoprotein / Bos taurus    Q3SZR3
• Alpha-2-hs-glycoprotein / Bos taurus    P12763
• Alpha-1-acid glycoprotein / Canis lupus familiaris    F6Y713
• Uncharacterized protein from Dander / Equus caballus    
• Monoclonal antibody okt3 / Mus musculus    
• Alpha-1-acid glycoprotein / Ovis aries    W5P7S6
• T-kininogen / Rattus norvegicus    P01048    P08932
• Uncharacterized protein / Rattus norvegicus    
• Uncharacterized protein from Liver / Rattus norvegicus    
• Uncharacterized proteoglycan / Rattus norvegicus    
• Riboflavin-binding protein / Gallus gallus    P02752
• Acetylcholine receptor protein / Torpedo californica    P02714    P02712    P02718    P02710

Source

• Amniotic Fluid (UBERON_0000173)  
• Ascitic fluid (UBERON_0007795)  
• Blood (UBERON_0000178)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Colon (UBERON_0001155)  
• Dander  
• Electric Organ (UBERON_0006869)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   Sf21 (CVCL_0518)  
• Placenta (UBERON_0001987)  
• Pleura (UBERON_0000977)   K-562 (CVCL_0004)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• HEK293 (CVCL_0045)  
• Jurkat (CVCL_0065)  
• LS174T (CVCL_1384)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  
• Hepatocyte (CL_0000182)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / Gal(b1-3)GlcNAc(?1-?)[Gal(b1-3)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-3)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 251
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(?1-?) + 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3) + NeuAc(a2-6)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-3) + 2 x NeuAc(a2-6)"
• N-Linked / Complex / NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)[NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-4)]Man(a1-?)[NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 3629
• N-Linked / Complex / Structure 9339
• N-Linked / Complex / Structure 9441
• N-Linked / Complex / Structure 9829
• N-Linked / Complex / Structure 10609
• N-Linked / Complex / Structure 10724
• N-Linked / Complex / Structure 10760
• N-Linked / Complex / Structure 10769
• N-Linked / Complex / Structure 10789
• N-Linked / Complex / Structure 10791
• N-Linked / Complex / Structure 10956

Composition

• Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma (DOID:305)
• Carcinoma, Hepatocellular (DOID:684)
• Chondrosarcoma (DOID:3371)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Esophageal cancer (DOID:5041)
• Familial hepatic adenoma (DOID:111366)
• Gastritis (DOID:4029)
• Leukemia, Myloid, Chronic (DOID:8552)
• Maturity-onset diabetes of the young type 3 (DOID:0111102)
• Mixed phenotype acute leukemia (DOID:9953)
• Myeloma, Multiple (DOID:9538)
• Prostate cancer (DOID:10283)
• Prostate Disease (DOID:47)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)
• Zajdela Hepatocarcinoma (DOID:686)

Reference

• B-cell precursor acute lymphoblastic leukemia with MLL rearrangement shows extensive glycomic-related changes (2021 - Oliveira T) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
• Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
• Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
• Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Characterisation of horse dander allergen glycoproteins using amino acid and glycan structure analyses. A mass spectrometric method for glycan chain analysis of glycoproteins separated by two-dimensional electrophoresis. (2000 - Bulone V, Rademaker G, Pergantis S, Krogstad-Johnsen T, Smestad-Paulsen B, Thomas-Oates J) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Sulfated di-, tri- and tetraantennary N-glycans in human Tamm-Horsfall glycoprotein. (1998 - van Rooijen J, Kamerling J, Vliegenthart J) / Status : Reviewed
• Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• Structures of the N-linked oligosaccharides on human plasma vitronectin. (1995 - Ogawa H, Yoneda A, Seno N, Hayashi M, Ishizuka I, Hase S, Matsumoto I) / Status : Reviewed
• Structural differences between complex-type Asn-linked glycan chains of glycoproteins in rat hepatocytes and Zajdela hepatoma cells. (1995 - Goulut-Chassaing C, Bourrillon R) / Status : Reviewed
• A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
• The carbohydrate structure of the asparagine-linked oligosaccharides of rat plasma thiostatin. (1994 - Rusiniak M, Bedi G, Back N) / Status : Reviewed
• Structures of sugar chains of hen egg yolk riboflavin-binding protein. (1993 - Tarutani M, Norioka N, Mega T, Hase S, Ikenaka T) / Status : Reviewed
• N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
• Electrophoretic resolution and fluorescence detection of N-linked glycoprotein oligosaccharides after reductive amination with 8-aminonaphthalene-1,3,6-trisulphonic acid. (1992 - Stack R, Sullivan M) / Status : Reviewed
• Structure determination of the glycans of human-serum alpha 1-antichymotrypsin using 1H-NMR spectroscopy and deglycosylation by N-glycanase. (1991 - Laine A, Hachulla E, Strecker G, Michalski J, Wieruszeski J) / Status : Reviewed
• Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
• The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
• Separation of the complex asparagine-linked oligosaccharides of the glycoprotein fetuin and elucidation of three triantennary structures having sialic acids linked only to galactose residues. (1989 - Bendiak B, Harris-Brandts M, Michnick S, Carver J, Cumming D) / Status : Reviewed
• Structures of asparagine-linked oligosaccharides of the glycoprotein fetuin having sialic acid linked to N-acetylglucosamine. (1989 - Cumming D, Hellerqvist C, Harris-Brandts M, Michnick S, Carver J, Bendiak B) / Status : Reviewed
• Protein and carbohydrate structural analysis of a recombinant soluble CD4 receptor by mass spectrometry. (1989 - Carr SA, Hemling ME, Folena-Wasserman G, Sweet RW, Anumula K, Barr JR, Huddleston MJ, Taylor P) / Status : Reviewed
• The asparagine-linked oligosaccharides on bovine fetuin. Structural analysis of N-glycanase-released oligosaccharides by 500-megahertz 1H NMR spectroscopy. (1988 - Green E, Adelt G, Baenziger J, Wilson S, Van Halbeek H) / Status : Reviewed
• The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
• Structures of N-linked and O-linked oligosaccharides on proteoglycan monomer isolated from the Swarm rat chondrosarcoma. (1982 - Nilsson B, De Luca S, Lohmander S, Hascall V) / Status : Reviewed
• The structures and microheterogeneity of the carbohydrate chains of human plasma ceruloplasmin. A study employing 500-MHz 1H-NMR spectroscopy. (1982 - Endo M, Suzuki K, Schmid K, Fournet B, Karamanos Y, Montreuil J, Dorland L, van Halbeek H, Vliegenthart J) / Status : Reviewed
• Structural studies of asparagine-linked sugar chains of human ceruloplasmin. Structural characteristics of the triantennary complex type sugar chains of human plasma glycoproteins. (1981 - Yamashita K, Liang CJ, Funakoshi S, Kobata A) / Status : Reviewed
• Studies on the oligosaccharide chains of human alpha 1-protease inhibitor. II. Structure of oligosaccharides. (1980 - Mega T, Lujan E, Yoshida A) / Status : Reviewed
• Structure of the complex oligosaccharides of fetuin. (1979 - Baenziger J, Fiete D) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-365
  •        Asn-381
• A disintegrin and metalloproteinase with thrombospondin motifs (13adamts13) / Homo sapiens
  •        Asn-614
• ADAM DEC1 / Homo sapiens
  •        Asn-184
• Afamin / Homo sapiens
  •        Asn-402
• Aggrecan core protein / Homo sapiens
  •        Asn-658
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-56
  •        Asn-72
  •        Asn-93
  •        Asn-103
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-56
  •        Asn-72
  •        Asn-88
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Undefined site
  •        Asn-93
  •        Asn-106
  •        Asn-127
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Undefined site
  •        Asn-107
  •        Asn-271
• Alpha-1b-glycoprotein / Homo sapiens
  •        Asn-179
• Alpha-2-antiplasmin / Homo sapiens
  •        Asn-126
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
  •        Asn-176
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-1424
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Antithrombin-III / Homo sapiens
  •        Asn-128
• Apolipoprotein (a) / Homo sapiens
  •        Asn-75
  •        Asn-4057
• Apolipoprotein B-100 / Homo sapiens
  •        Asn-185
  •        Asn-3411
  •        Asn-3895
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Apolipoprotein M / Homo sapiens
  •        Asn-135
• Asialoglycoprotein receptor 2 / Homo sapiens
  •        Asn-170
• Attractin / Homo sapiens
  •        Asn-264
  •        Asn-731
• BDNF/NT-3 growth factors receptor / Homo sapiens
  •        Asn-325
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
  •        Asn-253
• Beta-Ala-His dipeptidase / Homo sapiens
  •        Asn-382
• Biotinidase / Homo sapiens
  •        Asn-203
  •        Asn-349
• Bone marrow stromal antigen 2 / Homo sapiens
  •        Asn-65
• C4b-binding protein alpha chain / Homo sapiens
  •        Asn-221
• C4b-binding protein beta chain / Homo sapiens
  •        Asn-98
• Cadherin-13 / Homo sapiens
  •        Asn-671
• Carbonic anhydrase 12 / Homo sapiens
  •        Asn-80
• Carboxypeptidase b2 / Homo sapiens
  •        Asn-73
  •        Asn-85
• Carboxypeptidase D / Homo sapiens
  •        Asn-172
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Cathepsin L1 / Homo sapiens
  •        Asn-221
• CD166 antigen / Homo sapiens
  •        Asn-91
  •        Asn-361
  •        Asn-480
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Cell adhesion molecule 1 / Homo sapiens
  •        Asn-101
• Cerebellin-4 / Homo sapiens
  •        Asn-29
• Ceruloplasmin / Homo sapiens
  •        Undefined site
  •        Asn-138
  •        Asn-358
  •        Asn-397
  •        Asn-762
• Cholesteryl ester transfer protein / Homo sapiens
  •        Asn-105
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
  •        Asn-145
  •        Asn-354
  •        Asn-374
• Coagulation factor IX / Homo sapiens
  •        Undefined site
• Coagulation factor VIII / Homo sapiens
  •        Asn-803
• Coagulation factor XI / Homo sapiens
  •        Asn-90
  •        Asn-126
  •        Asn-491
• Coagulation factor XIII B chain / Homo sapiens
  •        Asn-545
• Complement factor h / Homo sapiens
  •        Asn-822
  •        Asn-882
  •        Asn-911
• Complement factor H-related protein 3 / Homo sapiens
  •        Asn-309
• Complement factor H-related protein 4 / Homo sapiens
  •        Asn-557
• Complement factor i / Homo sapiens
  •        Asn-177
• Contactin-3 / Homo sapiens
  •        Asn-909
• Contactin-4 / Homo sapiens
  •        Asn-705
  •        Asn-764
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-31
  •        Asn-96
• Desmoglein-2 / Homo sapiens
  •        Asn-112
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-378
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens
  •        Asn-285
• Ephrin-B2 / Homo sapiens
  •        Asn-36
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-271
  •        Asn-361
  •        Asn-816
• Epithelial cell adhesion molecule / Homo sapiens
  •        Asn-74
• Erythropoietin / Homo sapiens
  •        Asn-110
• Fibroblast growth factor receptor 1 / Homo sapiens
  •        Asn-586
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-528
• Filamin-B / Homo sapiens
  •        Asn-2570
• Follitropin, alpha and beta chains / Homo sapiens
  •        Undefined site
• G-protein coupled receptor 126 / Homo sapiens
  •        Asn-1169
• Galectin-3-binding protein / Homo sapiens
  •        Asn-69
  •        Asn-398
• Gamma-glutamyltranspeptidase 1 / Homo sapiens
  •        Asn-344
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-207
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
  •        Asn-246
  •        Asn-453
• Heparin cofactor 2 / Homo sapiens
  •        Asn-49
  •        Asn-188
• Hepatocyte growth factor receptor / Homo sapiens
  •        Asn-998
• Histidine-rich glycoprotein / Homo sapiens
  •        Asn-63
• Homeobox protein Hox-B3 / Homo sapiens
  •        Asn-226
• Icos ligand / Homo sapiens
  •        Asn-70
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Undefined site
  •        Asn-205
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
  •        Asn-794
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-116
• Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
  •        Asn-580
• Integrin alpha-5 / Homo sapiens
  •        Asn-518
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Integrin beta-1 / Homo sapiens
  •        Asn-669
• Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens
  •        Asn-285
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
  •        Asn-517
  •        Asn-577
• Intercellular adhesion molecule 2 / Homo sapiens
  •        Asn-187
• Interferon alpha/beta receptor 2 / Homo sapiens
  •        Asn-188
• Interleukin-1 receptor-like 1 / Homo sapiens
  •        Asn-273
• Kallistatin / Homo sapiens
  •        Asn-108
  •        Asn-157
  •        Asn-238
• Kininogen-1 / Homo sapiens
  •        Asn-48
  •        Asn-169
  •        Asn-205
  •        Asn-294
• Lactotransferrin / Homo sapiens
  •        Asn-156
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-89
  •        Asn-2558
  •        Asn-2893
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-315
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Leucyl-cystinyl aminopeptidase / Homo sapiens
  •        Asn-850
• Lipopolysaccharide-binding protein / Homo sapiens
  •        Asn-386
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
• Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
  •        Asn-53
• Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
  •        Asn-161
• Lysosome membrane protein 2 / Homo sapiens
  •        Asn-412
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-62
  •        Asn-249
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-49
  •        Asn-58
  •        Asn-101
• Maltase-glucoamylase, intestinal / Homo sapiens
  •        Asn-707
• Mesothelin / Homo sapiens
  •        Asn-523
• Multimerin-2 / Homo sapiens
  •        Asn-205
• Myeloperoxidase / Homo sapiens
  •        Asn-323
• Nectin-4 / Homo sapiens
  •        Asn-281
• Oncoprotein-induced transcript 3 protein / Homo sapiens
  •        Asn-291
  •        Asn-299
• Plasma kallikrein / Homo sapiens
  •        Asn-494
• Plasma protease c1 inhibitor / Homo sapiens
  •        Asn-25
  •        Asn-69
  •        Asn-253
• Plasma serine protease inhibitor / Homo sapiens
  •        Asn-262
• Plasminogen / Homo sapiens
  •        Undefined site
• Platelet endothelial cell adhesion molecule / Homo sapiens
  •        Asn-84
• Platelet glycoprotein V / Homo sapiens
  •        Asn-181
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-469
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prosaposin / Homo sapiens
  •        Asn-136
  •        Asn-332
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-286
  •        Asn-413
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Protein heg homolog 1 / Homo sapiens
  •        Asn-592
• Protein ITFG3 / Homo sapiens
  •        Asn-389
• Protein Z-dependent protease inhibitor / Homo sapiens
  •        Asn-180
• Prothrombin / Homo sapiens
  •        Asn-143
• Protocadherin-9 / Homo sapiens
  •        Asn-681
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Asn-234
  •        Asn-421
• Reelin / Homo sapiens
  •        Asn-2961
  •        Asn-3015
• Seizure 6-like protein 2 / Homo sapiens
  •        Asn-373
• Selenoprotein P / Homo sapiens
  •        Asn-83
• Serotransferrin / Homo sapiens
  •        Undefined site
  •        Asn-432
  •        Asn-630
• Serum paraoxonase/arylesterase 1 / Homo sapiens
  •        Asn-253
  •        Asn-324
• Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
  •        Asn-931
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Undefined site
• Tenascin / Homo sapiens
  •        Asn-1392
• Thyroxine-binding globulin / Homo sapiens
  •        Asn-165
• Trafficking protein particle complex subunit 8 / Homo sapiens
  •        Asn-1340
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-275
• UDP-glucuronosyltransferase 2B15 / Homo sapiens
  •        Asn-316
• Uncharacterized protein from Blood Serum / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Pleura / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Undefined site
  •        Asn-232
• Vitronectin / Homo sapiens
  •        Undefined site
  •        Asn-86
  •        Asn-169
  •        Asn-242
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
  •        Asn-781
• Von willebrand factor / Homo sapiens
  •        Asn-156
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Alpha-1-acid glycoprotein / Bos taurus
  •        Undefined site
  •        Asn-104
• Alpha-2-hs-glycoprotein / Bos taurus
  •        Undefined site
  •        Asn-99
  •        Asn-156
  •        Asn-176
• Alpha-1-acid glycoprotein / Canis lupus familiaris
  •        Undefined site
• Uncharacterized protein from Dander / Equus caballus
  •        Undefined site
• Monoclonal antibody okt3 / Mus musculus
  •        Undefined site
• Alpha-1-acid glycoprotein / Ovis aries
  •        Undefined site
• T-kininogen / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Liver / Rattus norvegicus
  •        Undefined site
• Uncharacterized proteoglycan / Rattus norvegicus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site

Mass spectrometry observed peptide

• NPNATSSSSQDPESLQDRGEGK (22aa)
  •    P05155    Asn-25     Plasma protease c1 inhibitor / Homo sapiens
• NPNATSSSSQDPESLQDR (18aa)
  •    P05155    Asn-25     Plasma protease c1 inhibitor / Homo sapiens
• AQNDTEPIVLEGK (13aa)
  •    Q9NTU7    Asn-29     Cerebellin-4 / Homo sapiens
• MDPNAAYVNMSNHHR (15aa)
  •    P08185    Asn-31     Corticosteroid-binding globulin / Homo sapiens
• CANLVPVPITNATLDR (16aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• CANLVPVPITNATLDQITGK (20aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• LCANLVPVPITNATLDR (17aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• SIVLEPIYWNSSNSK (15aa)
  •    P52799    Asn-36     Ephrin-B2 / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• TAVNCSSDFDACIITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• YNSQNQSNNQFVLYR (15aa)
  •    P01042    Asn-48     Kininogen-1 / Homo sapiens
• NLSMPLLPADFHK (13aa)
  •    P05546    Asn-49     Heparin cofactor 2 / Homo sapiens
• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• ANQQLNFTEAK (11aa)
  •    Q9Y5Y7    Asn-53     Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
• KWFYIASAFRNEEYNKS (17aa)
  •    P02763    Asn-56     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-56     Alpha-1-acid glycoprotein 2 / Homo sapiens
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57     CD44 antigen / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• NMTFDLPSDATVVLNR (16aa)
  •    P11279    Asn-62     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• IADAHIDRVENTTVYYIVIDVQESDCSVISR (31aa)
  •    P04196    Asn-63     Histidine-rich glycoprotein / Homo sapiens
• NVTHLLQQELTEAQK (15aa)
  •    Q10589    Asn-65     Bone marrow stromal antigen 2 / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• ALGFENATQALGR (13aa)
  •    Q08380    Asn-69     Galectin-3-binding protein / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• MLFVEPILEVSSLPTTNSTTNSATK (25aa)
  •    P05155    Asn-69     Plasma protease c1 inhibitor / Homo sapiens
• TVVTYHIPQNSSLENVDSR (19aa)
  •    O75144    Asn-70     Icos ligand / Homo sapiens
• SVQEIQATFFYFTPNK (16aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• FYFTPNKTEDTIFLR (15aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• YFTPNKTEDTIFLR (14aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• KSVQEIQATFFYFTPNKT (18aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• KQVHFFVNASDVDNVK (16aa)
  •    Q96IY4    Asn-73     Carboxypeptidase b2 / Homo sapiens
• QVHFFVNASDVDNVK (15aa)
  •    Q96IY4    Asn-73     Carboxypeptidase b2 / Homo sapiens
• AEMNGSK (7aa)
  •    P16422    Asn-74     Epithelial cell adhesion molecule / Homo sapiens
• TTENYPNAGLIMNYCR (16aa)
  •    P08519    Asn-75     Apolipoprotein (a) / Homo sapiens
• KYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANK (40aa)
  •    O43570    Asn-80     Carbonic anhydrase 12 / Homo sapiens
• AFITNFSMIIDGMTYPGIIK (20aa)
  •    Q14624    Asn-81     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• EGYSNISYIVVNHQGISSR (19aa)
  •    P49908    Asn-83     Selenoprotein P / Homo sapiens
• KYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKC (34aa)
  •    P01833    Asn-83     Polymeric immunoglobulin receptor / Homo sapiens
• DDVLFYNISSMK (12aa)
  •    P16284    Asn-84     Platelet endothelial cell adhesion molecule / Homo sapiens
• AHLNVSGIPC (10aa)
  •    Q96IY4    Asn-85     Carboxypeptidase b2 / Homo sapiens
• KEDALNETR (9aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• NNATVHEQVGGPSLTSDLQAQSK (23aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• KNNATVHEQVGGPSLTSDLQAQSKG (25aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• KKKEDALNETRE (12aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KKKEDALNETRESETKL (17aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRESETKL (15aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• NNATVHEQVGGPSITSDIQAQSK (23aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• ICNQNSSNPNQR (12aa)
  •    P24043    Asn-89     Laminin subunit alpha-2 / Homo sapiens
• INISENYTISISNAR (15aa)
  •    Q13740    Asn-91     CD166 antigen / Homo sapiens
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-88     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
• LSLGAHNTTLTEILK (15aa)
  •    P01011    Asn-93     Alpha-1-antichymotrypsin / Homo sapiens
• NVIFSPLSISTALAFLSLGAHNTTLTEILK (30aa)
  •    P01011    Asn-93     Alpha-1-antichymotrypsin / Homo sapiens
• SLGAHNTTLTEILK (14aa)
  •    P01011    Asn-93     Alpha-1-antichymotrypsin / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QNQCFYNSSYINVQR (15aa)
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
• QDQCIYNTTYINVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• AQLLQGLGFNLTER (14aa)
  •    P08185    Asn-96     Corticosteroid-binding globulin / Homo sapiens
• AQIIQGIGFNITER (14aa)
  •    P08185    Asn-96     Corticosteroid-binding globulin / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• IGHCPDPVIVNGEFSSSGPVNVSDK (25aa)
  •    P20851    Asn-98     C4b-binding protein beta chain / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• IAVQFGPGFSWIANFTK (17aa)
  •    P13473    Asn-101     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• FQLLNFSSSELK (12aa)
  •    Q9BY67    Asn-101     Cell adhesion molecule 1 / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• ELPGVCNETMMALWEECK (18aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• SIDVSIQNVSVVFK (14aa)
  •    P11597    Asn-105     Cholesteryl ester transfer protein / Homo sapiens
• FNLTETSEAEIHQSFQHLLR (20aa)
  •    P01011    Asn-106     Alpha-1-antichymotrypsin / Homo sapiens
• ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
  •    P01009    Asn-107     Alpha-1-antitrypsin / Homo sapiens
• ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR (32aa)
  •    P01009    Asn-107     Alpha-1-antitrypsin / Homo sapiens
• SQIIEGIGFNITEISESDVHR (21aa)
  •    P29622    Asn-108     Kallistatin / Homo sapiens
• SQILEGLGFNLTELSESDVHR (21aa)
  •    P29622    Asn-108     Kallistatin / Homo sapiens
• DIVEYYNDSNGSHVLQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• GQALLVNSSQPWEPLQLHVDK (21aa)
  •    P01588    Asn-110     Erythropoietin / Homo sapiens
• DTGELNVTSILDR (13aa)
  •    Q14126    Asn-112     Desmoglein-2 / Homo sapiens
• SANASFNIK (9aa)
  •    Q13308    Asn-116     Inactive tyrosine-protein kinase 7 / Homo sapiens
• ALSHLALGAQNHTLQR (16aa)
  •    P08697    Asn-126     Alpha-2-antiplasmin / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• TLNQSSDELQLSMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• TLNQSSDELQLSMGN (15aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• TINQSSDEIQISMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• LGACNDTLQQLMEVFK (16aa)
  •    P01008    Asn-128     Antithrombin-III / Homo sapiens
• TELFSSSCPGGIMLNETGQGYQR (23aa)
  •    O95445    Asn-135     Apolipoprotein M / Homo sapiens
• GEMSRPGEVCSALNLCESLQK (21aa)
  •    P07602    Asn-136     Prosaposin / Homo sapiens
• KEHEGAIYPDNTTDFQRADDKV (22aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• YPHKPEINSTTHPGADLQENFCR (23aa)
  •    P00734    Asn-143     Prothrombin / Homo sapiens
• SRYPHKPEINSTTHPGADLQENFCR (25aa)
  •    P00734    Asn-143     Prothrombin / Homo sapiens
• QIEEFINQSSPFYFWMNGDR (20aa)
  •    P10909    Asn-145     Clusterin / Homo sapiens
• TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• VCQDCPIIAPINDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• KVCQDCPLLAPLNDTR (16aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• KVCQDCPLLAPLNDTRV (17aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• RKVCQDCPLLAPLNDTRV (18aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• FINDTMAVYEAK (12aa)
  •    P29622    Asn-157     Kallistatin / Homo sapiens
• YDIPASINFIINK (13aa)
  •    P38571    Asn-161     Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• TLYETEVFSTDFSNISAAK (19aa)
  •    P05543    Asn-165     Thyroxine-binding globulin / Homo sapiens
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• HGIQYFNNNTQHSSLFMLNEVK (22aa)
  •    P01042    Asn-169     Kininogen-1 / Homo sapiens
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• HGIQYFNNNTQH (12aa)
  •    P01042    Asn-169     Kininogen-1 / Homo sapiens
• HGIQYFNNNTQHSSLFTLNEVK (22aa)
  •    P01042    Asn-169     Kininogen-1 / Homo sapiens
  •    VAR_019278   178:M→T   dbSNP:rs1656922
• FVACQMELLHSNGSQR (16aa)
  •    P07307    Asn-170     Asialoglycoprotein receptor 2 / Homo sapiens
• IINTTDVYIIPSINPDGFER (20aa)
  •    O75976    Asn-172     Carboxypeptidase D / Homo sapiens
• AALAAFNAQNNGSNFQLEEISR (22aa)
  •    P02765    Asn-176     Alpha-2-HS-glycoprotein / Homo sapiens
• NAQNNGSNFQLEEISR (16aa)
  •    P02765    Asn-176     Alpha-2-HS-glycoprotein / Homo sapiens
• LSDLSINSTECLHVHCR (17aa)
  •    P05156    Asn-177     Complement factor i / Homo sapiens
• ISDISINSTECIHVHCR (17aa)
  •    P05156    Asn-177     Complement factor i / Homo sapiens
• REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR (34aa)
  •    P04217    Asn-179     Alpha-1b-glycoprotein / Homo sapiens
• ETFFNLSK (8aa)
  •    Q9UK55    Asn-180     Protein Z-dependent protease inhibitor / Homo sapiens
• LLDLSGNNLTHLPK (14aa)
  •    P40197    Asn-181     Platelet glycoprotein V / Homo sapiens
• MVSHHNITTGATIINEQWIITTAK (24aa)
  •    P00738    Asn-184     Haptoglobin / Homo sapiens
• MVSHHNLTTGATLINEQWLLTTAK (24aa)
  •    P00738    Asn-184     Haptoglobin / Homo sapiens
• EHAVFTSNQEEQDPANHTCGVK (22aa)
  •    O15204    Asn-184     ADAM DEC1 / Homo sapiens
• QVLFLDTVYGNCSTHFTVK (19aa)
  •    P04114    Asn-185     Apolipoprotein B-100 / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• SWPAVGNCSSAIR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• NFSCLAVLDLMSR (13aa)
  •    P13598    Asn-187     Intercellular adhesion molecule 2 / Homo sapiens
• DFVNASSK (8aa)
  •    P05546    Asn-188     Heparin cofactor 2 / Homo sapiens
• GNMSGNFTYIIDK (13aa)
  •    P48551    Asn-188     Interferon alpha/beta receptor 2 / Homo sapiens
• YQFNTNVVFSNNGTIVDR (18aa)
  •    P43251    Asn-203     Biotinidase / Homo sapiens
• ALPGNLTAAVMEANQTGHEFPDR (23aa)
  •    Q9H8L6    Asn-205     Multimerin-2 / Homo sapiens
• ITYSIVQTNCSK (12aa)
  •    P01042    Asn-205     Kininogen-1 / Homo sapiens
• SIVQTNCSK (9aa)
  •    P01042    Asn-205     Kininogen-1 / Homo sapiens
• NLFLNHSENATAK (13aa)
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
• FSIIGHASISCTVENETIGVWRPSPPTCEK (30aa)
  •    P04003    Asn-221     C4b-binding protein alpha chain / Homo sapiens
• ASISCTVENETIGVWRPSPPTCEK (24aa)
  •    P04003    Asn-221     C4b-binding protein alpha chain / Homo sapiens
• YSVANDTGFVDIPK (14aa)
  •    P07711    Asn-221     Cathepsin L1 / Homo sapiens
• VEMANLLNLSER (12aa)
  •    P14651    Asn-226     Homeobox protein Hox-B3 / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• YANITVDYLYNK (12aa)
  •    P08575    Asn-234     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• DFYVDENTTVR (11aa)
  •    P29622    Asn-238     Kallistatin / Homo sapiens
• NTTVRVPMMLQDQE (14aa)
  •    P29622    Asn-238     Kallistatin / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• KVVLHPNYSQVDIGLIKL (18aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• VVIHPNYSQVDIGIIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• NISDGFDGIPDNVDAALALPAHSYSGR (27aa)
  •    P04004    Asn-242     Vitronectin / Homo sapiens
• RNGTGHGNSTHHGPEYMRC (19aa)
  •    P02790    Asn-246     Hemopexin / Homo sapiens
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• HANWTLTPLK (10aa)
  •    P27169    Asn-253     Serum paraoxonase/arylesterase 1 / Homo sapiens
• IGNWSAMPSCK (11aa)
  •    P02749    Asn-253     Beta-2-glycoprotein 1 / Homo sapiens
• VLSNNSDANLELINTWVAK (19aa)
  •    P05155    Asn-253     Plasma protease c1 inhibitor / Homo sapiens
• LGNWSAMPSCK (11aa)
  •    P02749    Asn-253     Beta-2-glycoprotein 1 / Homo sapiens
• VVGVPYQGNATALFILPSEGK (21aa)
  •    P05154    Asn-262     Plasma serine protease inhibitor / Homo sapiens
• ISNSSDTVECECSENWKGEACDIPHCTDNCGFPHR (35aa)
  •    O75882    Asn-264     Attractin / Homo sapiens
• ISNSSDTVECECSENWK (17aa)
  •    O75882    Asn-264     Attractin / Homo sapiens
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• YTGNASALFILPDQDK (16aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• KYTGNASALFILPDQDKM (18aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• KYLGNATAIFFLPDEGKL (18aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• DTCPPLMLYNPTTYQMDVNPEGK (23aa)
  •    P00533    Asn-271     Epidermal growth factor receptor / Homo sapiens
• IQQEEGQNQSFSNGLACLDMVLR (23aa)
  •    Q01638    Asn-273     Interleukin-1 receptor-like 1 / Homo sapiens
• DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
  •    Q14956    Asn-275     Transmembrane glycoprotein NMB / Homo sapiens
• CLSEGQPPPSYNWTR (15aa)
  •    Q96NY8    Asn-281     Nectin-4 / Homo sapiens
• ICDLLVANNHFAHFFAPQNLTNMNK (25aa)
  •    P19827    Asn-285     Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens
• MNASFSLK (8aa)
  •    P22413    Asn-285     Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens
• NVSVAEGK (8aa)
  •    Q9P2B2    Asn-286     Prostaglandin F2 receptor negative regulator / Homo sapiens
• ELVGGLELFLTNTSCR (16aa)
  •    Q8WWZ8    Asn-291     Oncoprotein-induced transcript 3 protein / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• INAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• GVSNGTHVNILFSLK (15aa)
  •    Q8WWZ8    Asn-299     Oncoprotein-induced transcript 3 protein / Homo sapiens
• LGYNANTSILSFQAVCR (17aa)
  •    Q02985    Asn-309     Complement factor H-related protein 3 / Homo sapiens
• HVNEINATIYLLK (13aa)
  •    Q16363    Asn-315     Laminin subunit alpha-4 / Homo sapiens
• ISNMSEESANMIASALAQIPQKVLWR (26aa)
  •    P54855    Asn-316     UDP-glucuronosyltransferase 2B15 / Homo sapiens
• SCPACPGSNITIR (13aa)
  •    P05164    Asn-323     Myeloperoxidase / Homo sapiens
• VTQVYAENGTVIQGSTVASVYK (22aa)
  •    P27169    Asn-324     Serum paraoxonase/arylesterase 1 / Homo sapiens
• VTQVYAENGTVLQGSTVASVYK (22aa)
  •    P27169    Asn-324     Serum paraoxonase/arylesterase 1 / Homo sapiens
• MFSQNDTR (8aa)
  •    P02750    Asn-325     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• GNPKPALQWFYNGAILNESK (20aa)
  •    Q16620    Asn-325     BDNF/NT-3 growth factors receptor / Homo sapiens
• IIDNNKTEK (9aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• NMTSEFFAAQLR (12aa)
  •    P19440    Asn-344     Gamma-glutamyltranspeptidase 1 / Homo sapiens
• NPVGLIGAENATGETDPSHSK (21aa)
  •    P43251    Asn-349     Biotinidase / Homo sapiens
• MLNTSSLLEQLNEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• AGIQAFFQVQECNK (14aa)
  •    P00450    Asn-358     Ceruloplasmin / Homo sapiens
• AGLQAFFQVQECNK (14aa)
  •    P00450    Asn-358     Ceruloplasmin / Homo sapiens
• NCTSISGDLHILPVAFR (17aa)
  •    P00533    Asn-361     Epidermal growth factor receptor / Homo sapiens
• NATVVWMK (8aa)
  •    Q13740    Asn-361     CD166 antigen / Homo sapiens
• DASSFIAEWQNITK (14aa)
  •    P08195    Asn-365     4F2 cell-surface antigen heavy chain / Homo sapiens
• IVSPEPGGAVGPNLTCR (17aa)
  •    Q6UXD5    Asn-373     Seizure 6-like protein 2 / Homo sapiens
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• RLANLTQGEDQYYLRV (16aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
  •    Q9Y5L3    Asn-378     Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
• IIIAGTNSSDIQQIISIIESNK (22aa)
  •    P08195    Asn-381     4F2 cell-surface antigen heavy chain / Homo sapiens
• LVPHMNVSAVEK (12aa)
  •    Q96KN2    Asn-382     Beta-Ala-His dipeptidase / Homo sapiens
• LSVATNVSATLTFNTSK (17aa)
  •    P18428    Asn-386     Lipopolysaccharide-binding protein / Homo sapiens
• YKPDTIAVAVENGTGTDR (18aa)
  •    Q9H0X4    Asn-389     Protein ITFG3 / Homo sapiens
• ENITAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397     Ceruloplasmin / Homo sapiens
• ENLTAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397     Ceruloplasmin / Homo sapiens
• GLNLTEDTYKPR (12aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• YKGLNLTEDTYKPR (14aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• YAEDKFNETTEK (12aa)
  •    P43652    Asn-402     Afamin / Homo sapiens
• TMVFPVMYLNESVHIDK (17aa)
  •    Q14108    Asn-412     Lysosome membrane protein 2 / Homo sapiens
• VAEAVSSPAGVGVTWIEPDYQVYINASK (28aa)
  •    Q9P2B2    Asn-413     Prostaglandin F2 receptor negative regulator / Homo sapiens
• SFHNFTLCYIK (11aa)
  •    P08575    Asn-421     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• CGIVPVIAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• CGLVPVLAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• ALPQPQNVTSLLGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• AIPQPQNVTSIIGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480     CD166 antigen / Homo sapiens
• LETTVNYTDSQRPICLPSK (19aa)
  •    P03951    Asn-491     Coagulation factor XI / Homo sapiens
• LQAPLNYTEFQK (12aa)
  •    P03952    Asn-494     Plasma kallikrein / Homo sapiens
• LQAPLNYTEFQKPICLPSK (19aa)
  •    P03952    Asn-494     Plasma kallikrein / Homo sapiens
• LPTQNITFQTESSVAEQEAEFQSPK (25aa)
  •    Q14624    Asn-517     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• GPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPK (37aa)
  •    Q14624    Asn-517     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• SCSLEGNPVACINLSFCLNASGK (23aa)
  •    P08648    Asn-518     Integrin alpha-5 / Homo sapiens
• ALSQQNVSMDLATFMK (16aa)
  •    Q13421    Asn-523     Mesothelin / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• HGVIISSTVDTYENGSSVEYR (21aa)
  •    P05160    Asn-545     Coagulation factor XIII B chain / Homo sapiens
• LGYNANTSVLSFQAVCR (17aa)
  •    Q92496    Asn-557     Complement factor H-related protein 4 / Homo sapiens
• NQALNLSLAYSFVTPLTSMVVTK (23aa)
  •    Q14624    Asn-577     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• NQALNLSLAY (10aa)
  •    Q14624    Asn-577     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• FVQAICEGDDCQPPAYTYNNITCASPPEVVGIDIR (35aa)
  •    P35858    Asn-580     Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
• RPPGLEYCYNPSHNPEEQLSSK (22aa)
  •    P11362    Asn-586     Fibroblast growth factor receptor 1 / Homo sapiens
• ISNSSHSEYSSFFHAQTER (19aa)
  •    Q9ULI3    Asn-592     Protein heg homolog 1 / Homo sapiens
• MSISPNTTYPSLLEDGR (17aa)
  •    Q76LX8    Asn-614     A disintegrin and metalloproteinase with thrombospondin motifs (13adamts13) / Homo sapiens
• QQQHLFGSNVTDCSGNF (17aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• QQQHLFGSNVTDCSGNFCLFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• QQQHLFGSNVTDCSGN (16aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• QQQHIFGSNVTDCSGNFCIFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• TVYLYPNQTGLPDPLSR (17aa)
  •    P16112    Asn-658     Aggrecan core protein / Homo sapiens
• DTCTQECSYFNITK (14aa)
  •    P05556    Asn-669     Integrin beta-1 / Homo sapiens
• ANYNLPIMVTDSGKPPMTNITDLR (24aa)
  •    P55290    Asn-671     Cadherin-13 / Homo sapiens
• VTINVMDVNDNSPVVISPPSNTSFK (25aa)
  •    Q9HC56    Asn-681     Protocadherin-9 / Homo sapiens
• TEEALPEVTPANVSGGGGSK (20aa)
  •    Q8IWV2    Asn-705     Contactin-4 / Homo sapiens
• DQDPASFGADSLLLNSSR (18aa)
  •    O43451    Asn-707     Maltase-glucoamylase, intestinal / Homo sapiens
• NHSCSEGQISIFR (13aa)
  •    O75882    Asn-731     Attractin / Homo sapiens
• EIHHIQEQNVSNAFIDKGEFYIGSK (25aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• ELHHLQEQNVSNAFLDKGEFYIGSK (25aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• LHHLQEQNVSNAFLDKGE (18aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• KELHHLQEQNVSNAFLDKG (19aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• NESVHPFSPFEVK (13aa)
  •    Q8IWV2    Asn-764     Contactin-4 / Homo sapiens
• SLDNDNYVFTAPYFNK (16aa)
  •    P54289    Asn-781     Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
• NASLVTYYTSSGEDILIGGLKPFTK (25aa)
  •    Q8TDY8    Asn-794     Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
• IQNVSSSDLLMLLR (14aa)
  •    P00451    Asn-803     Coagulation factor VIII / Homo sapiens
• DNIGSQYLLNWCVQIAK (17aa)
  •    P00533    Asn-816     Epidermal growth factor receptor / Homo sapiens
• SHNMTTTLNYR (11aa)
  •    P08603    Asn-822     Complement factor h / Homo sapiens
• IFDDWMASNGTQSIPTDVMTTVFK (24aa)
  •    Q9UIQ6    Asn-850     Leucyl-cystinyl aminopeptidase / Homo sapiens
• IPCSQPPQIEHGTINSSR (18aa)
  •    P08603    Asn-882     Complement factor h / Homo sapiens
• TPPSQPPGNVVWNATDTK (18aa)
  •    Q9P232    Asn-909     Contactin-3 / Homo sapiens
• ISEENETTCYMGK (13aa)
  •    P08603    Asn-911     Complement factor h / Homo sapiens
• NDTLEWENQQR (11aa)
  •    Q4LDE5    Asn-931     Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
• SVSPTTEMVSNESVDYR (17aa)
  •    P08581    Asn-998     Hepatocyte growth factor receptor / Homo sapiens
• SLSSSSIGSNSTYLTSK (17aa)
  •    Q86SQ4    Asn-1169     G-protein coupled receptor 126 / Homo sapiens
• LISNCSK (7aa)
  •    Q9Y2L5    Asn-1340     Trafficking protein particle complex subunit 8 / Homo sapiens
• VEAAQNLTLPGSLR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• VSNQTLSLFFTVLQDVPVR (19aa)
  •    P01023    Asn-1424     Alpha-2-macroglobulin / Homo sapiens
• NESGIILLGSGGTPAPPR (18aa)
  •    P24043    Asn-2558     Laminin subunit alpha-2 / Homo sapiens
• HVGNQQYNVTYVVKER (16aa)
  •    O75369    Asn-2570     Filamin-B / Homo sapiens
• ADILDVVGMLYVGGLPINYTTR (22aa)
  •    P24043    Asn-2893     Laminin subunit alpha-2 / Homo sapiens
• IGSENNMTSCHRPICR (16aa)
  •    P78509    Asn-2961     Reelin / Homo sapiens
• HDYILLPEDALTNTTR (16aa)
  •    P78509    Asn-3015     Reelin / Homo sapiens
• VEGSHNSTVSLTTK (14aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens
• FEVDSPVYNATWSASLK (17aa)
  •    P04114    Asn-3895     Apolipoprotein B-100 / Homo sapiens
• FEVDSPVYNATWSASIK (17aa)
  •    P04114    Asn-3895     Apolipoprotein B-100 / Homo sapiens
• TPENYPNAGLTENYCR (16aa)
  •    P08519    Asn-4057     Apolipoprotein (a) / Homo sapiens