GlyConnect

Export CSV

taxonomy (6) protein (8) source (7) structure (9) composition (1) disease (4) reference (15) site (8) peptide (2)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:1 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1023.9486 )

Disease

Reference

Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
Structural studies on sialylated oligosaccharides of bonnet monkey (Macaca radiata) luteal phase cervical mucus glycoprotein. (1997 - Mahmood Z, Khan A, Kasi M, Kehmood K, Khan A, Hoessli D, Rungger-Braendle E, Jeanloz R, Nasir-Ud-Din) / Status : Reviewed
Structures of monosialyl oligosaccharides isolated from the respiratory mucins of a non-secretor (O, Lea+b-) patient suffering from chronic bronchitis. Characterization of a novel type of mucin carbohydrate core structure. (1994 - van Halbeek H, Strang A, Lhermitte M, Rahmoune H, Lamblin G, Roussel P) / Status : Reviewed
Characterisation by mass spectrometry and 1H-NMR of novel hexasaccharides among the acidic O-linked carbohydrate chains of bovine submaxillary mucin. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Feeney J, Lawson A) / Status : Reviewed
Structural characterization of sialylated tetrasaccharides and pentasaccharides with blood group H and Le(x) activity isolated from bovine submaxillary mucin. (1990 - Savage A, Donohue J, Koeleman C, van den Eijnden D) / Status : Reviewed
Structures of O-glycosidically linked oligosaccharides isolated from human meconium glycoproteins. (1989 - Capon C, Leroy Y, Wieruszeski J, Ricart G, Strecker G, Montreuil J, Fournet B) / Status : Reviewed
Determination of the structure of a novel acidic oligosaccharide with blood-group activity isolated from bovine submaxillary-gland mucin. (1989 - D'Arcy S, Donoghue C, Koeleman C, Van den Eijnden D, Savage A) / Status : Reviewed
Isolation and structural characterization of low-molecular-mass monosialyl oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1988 - van Halbeek H, Breg J, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
Structure of sialyl-oligosaccharides isolated from bronchial mucus glycoproteins of patients (blood group O) suffering from cystic fibrosis. (1987 - Breg J, Van Halbeek H, Vliegenthart J, Lamblin G, Houvenaghel M, Roussel P) / Status : Reviewed
Structure of acidic oligosaccharides isolated from pronase-treated glycoprotein of bonnet-monkey (Macaca radiata) cervical mucus. (1987 - Nasir-ud-Din ) / Status : Reviewed
Primary structure determination of five sialylated oliogsaccharides derived from bronchial mucus glycoproteins of patients suffering from cystic fibrosis. The occurrence of the NeuAc alpha(2---3)Gal beta(1---4)[Fuc alpha(1---3)] GlcNAc beta(1---.) structural element revealed by 500-MHz 1H NMR spectr (1984 - Lamblin G, Boersma A, Klein A, Roussel P, van Halbeek H, Vliegenthart J) / Status : Reviewed

Reported glycosite

CD59 glycoprotein / Homo sapiens
- Thr-111
Complement c4-a / Homo sapiens
- Thr-1244
Unspecified mucin / Homo sapiens
- Undefined site
Mucin / Bos taurus
- Undefined site
Mucin / Macaca radiata
- Undefined site
Mucin / Bufo arenarum
- Undefined site
Mucin / Bufo bufo
- Undefined site
Mucin / Xenopus tropicalis
- Undefined site

Mass spectrometry observed peptide

DLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP (37aa)
- P13987 Thr-111 CD59 glycoprotein / Homo sapiens
APVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR (44aa)
- P0C0L4 Thr-1244 Complement c4-a / Homo sapiens

- O-Linked / Core 1 (avg mass : 1023.9486)
- O-Linked / Core 1 (avg mass : 1023.9486)
- O-Linked / Core 2 (avg mass : 1023.9486)
- O-Linked / Core 3 (avg mass : 1023.9486)
- O-Linked / Core 3 (avg mass : 1023.9486)
- O-Linked / Core 3 (avg mass : 1023.9486)
- O-Linked / Core 3 (avg mass : 1023.9486)
- O-Linked / Core 3 (avg mass : 1023.9486)
- O-Linked / Undefined core (avg mass : 1023.9486)

- Hex:1 HexNAc:2 dHex:1 NeuAc:1 / O-Linked (avg mass : 1023.9486)