GlyConnect

taxonomy (6) protein (7) source (6) structure (9) composition (1) disease (4) reference (14) site (7) peptide (1)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:1 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1023.9486 )

Disease

Reference

Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
Structural studies on sialylated oligosaccharides of bonnet monkey (Macaca radiata) luteal phase cervical mucus glycoprotein. (1997 - Mahmood Z, Khan A, Kasi M, Kehmood K, Khan A, Hoessli D, Rungger-Braendle E, Jeanloz R, Nasir-Ud-Din) / Status : Reviewed
Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
Structures of monosialyl oligosaccharides isolated from the respiratory mucins of a non-secretor (O, Lea+b-) patient suffering from chronic bronchitis. Characterization of a novel type of mucin carbohydrate core structure. (1994 - van Halbeek H, Strang A, Lhermitte M, Rahmoune H, Lamblin G, Roussel P) / Status : Reviewed
Characterisation by mass spectrometry and 1H-NMR of novel hexasaccharides among the acidic O-linked carbohydrate chains of bovine submaxillary mucin. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Feeney J, Lawson A) / Status : Reviewed
Structural characterization of sialylated tetrasaccharides and pentasaccharides with blood group H and Le(x) activity isolated from bovine submaxillary mucin. (1990 - Savage A, Donohue J, Koeleman C, van den Eijnden D) / Status : Reviewed
Structures of O-glycosidically linked oligosaccharides isolated from human meconium glycoproteins. (1989 - Capon C, Leroy Y, Wieruszeski J, Ricart G, Strecker G, Montreuil J, Fournet B) / Status : Reviewed
Determination of the structure of a novel acidic oligosaccharide with blood-group activity isolated from bovine submaxillary-gland mucin. (1989 - D'Arcy S, Donoghue C, Koeleman C, Van den Eijnden D, Savage A) / Status : Reviewed
Isolation and structural characterization of low-molecular-mass monosialyl oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1988 - van Halbeek H, Breg J, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
Structure of sialyl-oligosaccharides isolated from bronchial mucus glycoproteins of patients (blood group O) suffering from cystic fibrosis. (1987 - Breg J, Van Halbeek H, Vliegenthart J, Lamblin G, Houvenaghel M, Roussel P) / Status : Reviewed
Structure of acidic oligosaccharides isolated from pronase-treated glycoprotein of bonnet-monkey (Macaca radiata) cervical mucus. (1987 - Nasir-ud-Din ) / Status : Reviewed
Primary structure determination of five sialylated oliogsaccharides derived from bronchial mucus glycoproteins of patients suffering from cystic fibrosis. The occurrence of the NeuAc alpha(2---3)Gal beta(1---4)[Fuc alpha(1---3)] GlcNAc beta(1---.) structural element revealed by 500-MHz 1H NMR spectr (1984 - Lamblin G, Boersma A, Klein A, Roussel P, van Halbeek H, Vliegenthart J) / Status : Reviewed

Reported glycosite

CD59 glycoprotein / Homo sapiens
- Thr-111
Mucin / Homo sapiens
- Undefined site
Mucin / Bos taurus
- Undefined site
Mucin / Macaca radiata
- Undefined site
Mucin / Bufo arenarum
- Undefined site
Mucin / Bufo bufo
- Undefined site
Mucin / Xenopus tropicalis
- Undefined site

Mass spectrometry observed peptide

DLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP (37aa)
- P13987 Thr-111

- O-Linked / Core 1 (avg mass : 1023.9486)
- O-Linked / Core 1 (avg mass : 1023.9486)
- O-Linked / Core 3 (avg mass : 1023.9486)
- O-Linked / Core 3 (avg mass : 1023.9486)
- O-Linked / Core 3 (avg mass : 1023.9486)
- O-Linked / Core 2 (avg mass : 1023.9486)
- O-Linked / Core 3 (avg mass : 1023.9486)
- O-Linked / Undefined core (avg mass : 1023.9486)
- O-Linked / Core 3 (avg mass : 1023.9486)

- Hex:1 HexNAc:2 dHex:1 NeuAc:1 / O-Linked (avg mass : 1023.9486)