Hex:4 HexNAc:3 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Collocalia sp
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Acid ceramidase / Homo sapiens    Q13510
• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-galactosidase A / Homo sapiens    P06280
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Aminopeptidase n / Homo sapiens    P15144
• Angiopoietin-1 receptor / Homo sapiens    Q02763
• Apolipoprotein b-100 / Homo sapiens    P04114
• Apolipoprotein d / Homo sapiens    P05090
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• BDNF/NT-3 growth factors receptor / Homo sapiens    Q16620
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Beta-galactosidase / Homo sapiens    P16278
• CD166 antigen / Homo sapiens    Q13740
• CD276 antigen / Homo sapiens    Q5ZPR3
• Cell adhesion molecule 1 / Homo sapiens    Q9BY67
• Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens    O75503
• Ceruloplasmin / Homo sapiens    P00450
• Choriogonadotropin beta chain / Homo sapiens    P0DN86
• Coagulation factor VIII / Homo sapiens    P00451
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Complement factor b / Homo sapiens    P00751
• Complement factor h / Homo sapiens    P08603
• Contactin-4 / Homo sapiens    Q8IWV2
• Decorin / Homo sapiens    P07585
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Epidermal growth factor receptor / Homo sapiens    P00533
• Epididymis-specific alpha-mannosidase / Homo sapiens    Q9Y2E5
• Fibrinogen beta chain / Homo sapiens    P02675
• Fibrinogen gamma chain / Homo sapiens    P02679
• Fibronectin / Homo sapiens    P02751
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-glutamyl hydrolase / Homo sapiens    Q92820
• Glucosylceramidase / Homo sapiens    P04062
• Glycodelin-a / Homo sapiens    P09466
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Hepatocyte growth factor receptor / Homo sapiens    P08581
• Histidine-rich glycoprotein / Homo sapiens    P04196
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin j chain / Homo sapiens    P01591
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Integrin alpha-2 / Homo sapiens    P17301
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Interleukin-1 receptor accessory protein / Homo sapiens    Q9NPH3
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Lumican / Homo sapiens    P51884
• Lutropin beta chain / Homo sapiens    P01229
• Lysosomal alpha-glucosidase / Homo sapiens    P10253
• Lysosomal alpha-mannosidase / Homo sapiens    O00754
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Myelin protein zero-like protein 1 / Homo sapiens    O95297
• Neutrophil elastase / Homo sapiens    P08246
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Periostin / Homo sapiens    Q15063
• Phospholipase D3 / Homo sapiens    Q8IV08
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prenylcysteine oxidase 1 / Homo sapiens    Q9UHG3
• Probable serine carboxypeptidase CPVL / Homo sapiens    Q9H3G5
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prothrombin / Homo sapiens    P00734
• Putative phospholipase B-like 2 / Homo sapiens    Q8NHP8
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens    P28827
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Secreted frizzled-related protein 4 / Homo sapiens    Q6FHJ7
• Serotransferrin / Homo sapiens    P02787
• Serum paraoxonase/arylesterase 1 / Homo sapiens    P27169
• Sialic acid-binding Ig-like lectin 14 / Homo sapiens    Q08ET2
• Sparc / Homo sapiens    P09486
• Spondin-1 / Homo sapiens    Q9HCB6
• Sulfhydryl oxidase 1 / Homo sapiens    O00391
• Synaptophysin-like protein 1 / Homo sapiens    Q16563
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Tenascin / Homo sapiens    P24821
• Tenascin-N / Homo sapiens    Q9UQP3
• Tetraspanin-1 / Homo sapiens    O60635
• Thrombospondin-1 / Homo sapiens    P07996
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Transmembrane 9 superfamily member 3 / Homo sapiens    Q9HD45
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Tripeptidyl-peptidase 1 / Homo sapiens    O14773
• Vitronectin / Homo sapiens    P04004
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Mucin / Collocalia sp
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amniotic Fluid (UBERON_0000173)  
• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Mammary Gland (UBERON_0001911)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Pituitary Gland (UBERON_0000007)  
• Placenta (UBERON_0001987)  
• Saliva (UBERON_0001836)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  

Reported structure

• N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 3532
• N-Linked / No-core / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-3)Man(b1-4)GlcNAc
• O-Linked / Core 5 / Gal(a1-4)Gal(b1-4)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc(a1-3)GalNAc

Composition

• Hex:4 HexNAc:3 NeuAc:1 (avg mass : 1567.4278 )

Disease

• Cancer, breast (DOID:1612)
• Carbohydrate-Deficient Glycoprotein Syndrome, Type II (DOID:5212)
• Carcinoma (DOID:305)
• Carcinoma, Hepatocellular (DOID:684)
• COVID-19 (DOID:0080600)
• Prostate cancer (DOID:10283)
• Sialidosis, severe infantile with abdominal ascites (DOID:3343)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
• Structures of the N-linked oligosaccharides on human plasma vitronectin. (1995 - Ogawa H, Yoneda A, Seno N, Hayashi M, Ishizuka I, Hase S, Matsumoto I) / Status : Reviewed
• Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Carbohydrate deficient glycoprotein syndrome type II: a deficiency in Golgi localised N-acetyl-glucosaminyltransferase II. (1994 - Jaeken J, Schachter H, Carchon H, De Cock P, Coddeville B, Spik G) / Status : Reviewed
• 1H and 13C-NMR assignments for sialylated oligosaccharide-alditols related to mucins. Study of thirteen components from hen ovomucin and swallow nest mucin. (1992 - Strecker G, Wieruszeski J, Cuvillier O, Michalski J, Montreuil J) / Status : Reviewed
• Severe infantile sialidosis--the characteristics of oligosaccharides isolated from the urine and the abdominal ascites. (1992 - Nakamura Y, Takahashi Y, Yamaguchi S, Omiya S, Orii T, Yara A, Gushiken M) / Status : Reviewed
• NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. (1991 - Weisshaar G, Hiyama J, Renwick A, Nimtz M) / Status : Reviewed
• Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy. (1991 - Weisshaar G, Hiyama J, Renwick A) / Status : Reviewed
• Structure of the monosialyl oligosaccharides derived from salivary gland mucin glycoproteins of the Chinese swiftlet (genus Collocalia). Characterization of novel types of extended core structure, Gal beta(1----3)[GlcNAc beta(1----6)] GalNAc alpha(1----3)GalNAc(-ol), and of chain termination, [Gal a (1987 - Wieruszeski J, Michalski J, Montreuil J, Strecker G, Peter-Katalinic J, Egge H, van Halbeek H, Mutsaers J, Vliegenthart J) / Status : Reviewed

Reported glycosite

• Acid ceramidase / Homo sapiens
  •        Asn-286
• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-922
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-103
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-271
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-869
• Alpha-galactosidase A / Homo sapiens
  •        Asn-139
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
  •        Asn-177
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-503
• Aminopeptidase n / Homo sapiens
  •        Asn-681
• Angiopoietin-1 receptor / Homo sapiens
  •        Asn-158
• Apolipoprotein b-100 / Homo sapiens
  •        Asn-1523
  •        Asn-3411
• Apolipoprotein d / Homo sapiens
  •        Asn-65
  •        Asn-98
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-89
• BDNF/NT-3 growth factors receptor / Homo sapiens
  •        Asn-254
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
• Beta-galactosidase / Homo sapiens
  •        Asn-498
• CD166 antigen / Homo sapiens
  •        Asn-480
• CD276 antigen / Homo sapiens
  •        Asn-104
• Cell adhesion molecule 1 / Homo sapiens
  •        Asn-291
• Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
  •        Asn-255
• Ceruloplasmin / Homo sapiens
  •        Asn-762
• Choriogonadotropin beta chain / Homo sapiens
  •        Asn-33
  •        Asn-50
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
• Complement factor b / Homo sapiens
  •        Asn-122
• Complement factor h / Homo sapiens
  •        Asn-882
• Contactin-4 / Homo sapiens
  •        Asn-764
• Decorin / Homo sapiens
  •        Asn-211
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-53
  •        Asn-119
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-816
• Epididymis-specific alpha-mannosidase / Homo sapiens
  •        Asn-336
• Fibrinogen beta chain / Homo sapiens
  •        Asn-394
• Fibrinogen gamma chain / Homo sapiens
  •        Asn-78
• Fibronectin / Homo sapiens
  •        Asn-542
  •        Asn-1236
• Galectin-3-binding protein / Homo sapiens
  •        Asn-69
  •        Asn-551
• Gamma-glutamyl hydrolase / Homo sapiens
  •        Asn-203
  •        Asn-307
• Glucosylceramidase / Homo sapiens
  •        Asn-185
• Glycodelin-a / Homo sapiens
  •        Asn-46
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Undefined site
  •        Asn-76
  •        Asn-102
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-207
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
• Hepatocyte growth factor receptor / Homo sapiens
  •        Asn-998
• Histidine-rich glycoprotein / Homo sapiens
  •        Asn-125
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
• Immunoglobulin j chain / Homo sapiens
  •        Asn-71
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-116
• Integrin alpha-2 / Homo sapiens
  •        Asn-343
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Interleukin-1 receptor accessory protein / Homo sapiens
  •        Asn-118
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-1366
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1205
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Lumican / Homo sapiens
  •        Asn-127
• Lutropin beta chain / Homo sapiens
  •        Asn-50
• Lysosomal alpha-glucosidase / Homo sapiens
  •        Asn-390
• Lysosomal alpha-mannosidase / Homo sapiens
  •        Asn-692
  •        Asn-766
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-49
  •        Asn-58
  •        Asn-275
  •        Asn-356
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2500
• Myelin protein zero-like protein 1 / Homo sapiens
  •        Asn-50
• Neutrophil elastase / Homo sapiens
  •        Asn-88
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-197
• Periostin / Homo sapiens
  •        Asn-599
• Phospholipase D3 / Homo sapiens
  •        Asn-236
• Plexin-B2 / Homo sapiens
  •        Asn-528
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-186
  •        Asn-499
• Prenylcysteine oxidase 1 / Homo sapiens
  •        Asn-196
• Probable serine carboxypeptidase CPVL / Homo sapiens
  •        Asn-307
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-1763
• Prosaposin / Homo sapiens
  •        Asn-80
  •        Asn-101
  •        Asn-332
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prothrombin / Homo sapiens
  •        Asn-143
• Putative phospholipase B-like 2 / Homo sapiens
  •        Asn-465
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
  •        Asn-121
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
  •        Asn-690
• Secreted frizzled-related protein 4 / Homo sapiens
  •        Asn-194
• Serotransferrin / Homo sapiens
  •        Undefined site
  •        Asn-630
• Serum paraoxonase/arylesterase 1 / Homo sapiens
  •        Asn-253
• Sialic acid-binding Ig-like lectin 14 / Homo sapiens
  •        Asn-100
• Sparc / Homo sapiens
  •        Asn-116
• Spondin-1 / Homo sapiens
  •        Asn-214
• Sulfhydryl oxidase 1 / Homo sapiens
  •        Asn-575
• Synaptophysin-like protein 1 / Homo sapiens
  •        Asn-71
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-878
• Tenascin / Homo sapiens
  •        Asn-1018
• Tenascin-N / Homo sapiens
  •        Asn-1149
• Tetraspanin-1 / Homo sapiens
  •        Asn-154
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
• Transmembrane 9 superfamily member 3 / Homo sapiens
  •        Asn-174
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-200
  •        Asn-249
  •        Asn-275
• Tripeptidyl-peptidase 1 / Homo sapiens
  •        Asn-443
• Vitronectin / Homo sapiens
  •        Undefined site
  •        Asn-169
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-153
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-238
• Mucin / Collocalia sp
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-331
  •        Asn-602

Mass spectrometry observed peptide

• WQMNFTVR (8aa)
  •    P13473    Asn-49
• EIFVANGTQGK (11aa)
  •    O95297    Asn-50
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53
• YETTNK (6aa)
  •    P13473    Asn-58
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65
• AIGFENATQAIGR (13aa)
  •    Q08380    Asn-69
• IIVPINNRENISDPTSPIR (19aa)
  •    P01591    Asn-71
• GQTEIQVNCPPAVTENK (17aa)
  •    Q16563    Asn-71
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74
• DLQSLEDILHQVENK (15aa)
  •    P02679    Asn-78
• DLQSLEDILHQVENKT (16aa)
  •    P02679    Asn-78
• DNATEEEILVYLEK (14aa)
  •    P07602    Asn-80
• ENTSDPSIVIAFGR (14aa)
  •    P11279    Asn-84
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98
• VVIGAHNISR (10aa)
  •    P08246    Asn-88
• AIVNFTR (7aa)
  •    P98160    Asn-89
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98
• ADGTVNQIEGEATPVNLTEPA (21aa)
  •    P05090    Asn-98
• NCSLSIGDAR (10aa)
  •    Q08ET2    Asn-100
• TCDWIPKPNMSASCK (15aa)
  •    P07602    Asn-101
• ENGTISR (7aa)
  •    P02763    Asn-103
• TAIFPDIIAQGNASIR (16aa)
  •    Q5ZPR3    Asn-104
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105
• VCSNDNK (7aa)
  •    P09486    Asn-116
• SANASFNIK (9aa)
  •    Q13308    Asn-116
• NTTYCSK (7aa)
  •    Q9NPH3    Asn-118
• VTTYCNETMTGWVHDVIGR (19aa)
  •    P53634    Asn-119
• VNNGPLGNPIWNISGDPTR (19aa)
  •    P28827    Asn-121
• SPYYNVSDEISFHCYDGYTIR (21aa)
  •    P00751    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127
• VIDFNCTTSSVSSAIANTK (19aa)
  •    P04196    Asn-125
• VIDFNCTTSSVSSALANTK (19aa)
  •    P04196    Asn-125
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01877    Asn-131
• YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
  •    P43307    Asn-136
• IGIYADVGNK (10aa)
  •    P06280    Asn-139
• YPHKPEINSTTHPGADLQENFCR (23aa)
  •    P00734    Asn-143
• CCGFTNYTDFEDSPYFK (17aa)
  •    O60635    Asn-154
• NGSFIHSVPR (10aa)
  •    Q02763    Asn-158
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162
• IVDVNITSEGK (11aa)
  •    Q9HD45    Asn-174
• MAAAINATGR (10aa)
  •    P17050    Asn-177
• TYTYADTPDDFQIHNFSIPEEDTK (24aa)
  •    P04062    Asn-185
• QIGLYPVLVIDSSGYVNPNYTGR (23aa)
  •    P01833    Asn-186
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187
• NYSYVIHAK (9aa)
  •    Q6FHJ7    Asn-194
• IIHAIGGDDFIGMINR (16aa)
  •    Q9UHG3    Asn-196
• NHSIFLADINQER (13aa)
  •    P50897    Asn-197
• VSVNTANVTIGPQIMEVTVYR (21aa)
  •    Q14956    Asn-200
• VSVNTANVTLGPQLMEVTVYRR (22aa)
  •    Q14956    Asn-200
• NFTMNEK (7aa)
  •    Q92820    Asn-203
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211
• ITFYGNWSEK (10aa)
  •    Q9HCB6    Asn-214
• EIGVVMYNCSCIAR (14aa)
  •    Q8IV08    Asn-236
• KFHVNYTQPLVAVK (14aa)
  •    P14231    Asn-238
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241
• NSSDETFLK (9aa)
  •    Q14956    Asn-249
• HANWTITPIK (10aa)
  •    P27169    Asn-253
• HANWTLTPLK (10aa)
  •    P27169    Asn-253
• ITNISSDDSGK (11aa)
  •    Q16620    Asn-254
• NIETNYTR (8aa)
  •    O75503    Asn-255
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Asn-271
• LNSSTIK (7aa)
  •    P13473    Asn-275
• DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
  •    Q14956    Asn-275
• IIAPAYFIIGGNQSGEGCVITR (22aa)
  •    Q13510    Asn-286
• TDNGTYR (7aa)
  •    Q9BY67    Asn-291
• VIYQNHNK (8aa)
  •    P11627    Asn-293
• IIDGDITSDPSYFQNVTGCSNYYNFIR (27aa)
  •    Q9H3G5    Asn-307
• ALIYQFSPIYTGNISSFQQCYIFD (24aa)
  •    Q92820    Asn-307
• MFSQNDTR (8aa)
  •    P02750    Asn-325
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• LIDNNK (6aa)
  •    P07602    Asn-332
• ALHALNVTWR (10aa)
  •    Q9Y2E5    Asn-336
• YFFNVSDEAAIIEK (14aa)
  •    P17301    Asn-343
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• QVVENMTR (8aa)
  •    P10253    Asn-390
• GTAGNAIMDGASQIMGENR (19aa)
  •    P02675    Asn-394
• FISSSPHIPPSSYFNASGR (19aa)
  •    O14773    Asn-443
• NQSLVQDMDSMVR (13aa)
  •    Q8NHP8    Asn-465
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497
• GLVSNLTLSSN (11aa)
  •    P16278    Asn-498
• WNNTGCQALPSQDEGPSK (18aa)
  •    P01833    Asn-499
• SVYNCSGEACR (11aa)
  •    P54802    Asn-503
• SCVAVTSAQPQNMSR (15aa)
  •    O15031    Asn-528
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• HEEGHMLNCTCFGQGR (16aa)
  •    P02751    Asn-542
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551
• NSTLDPGKPEMMK (13aa)
  •    O00391    Asn-575
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
  •    P0DTC2    Asn-602
• QQQHLFGSNVTDCSGNFCLFR (21aa)
  •    P02787    Asn-630
• VPVTIAINNTIFIIEER (17aa)
  •    P15144    Asn-681
• VTAPKNVSDII (11aa)
  •    Q9BYF1    Asn-690
• NVSDIIPR (8aa)
  •    Q9BYF1    Asn-690
• TPIVQEVHQNFSAWCSQVVR (20aa)
  •    O00754    Asn-692
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762
• NESVHPFSPFEVK (13aa)
  •    Q8IWV2    Asn-764
• INQTEPVAGNYYPVNTR (17aa)
  •    O00754    Asn-766
• NVTAQICIDK (10aa)
  •    P12109    Asn-804
• DNIGSQYLLNWCVQIAK (17aa)
  •    P00533    Asn-816
• SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK (33aa)
  •    P01023    Asn-869
• ENGSFSGK (8aa)
  •    Q7Z7G0    Asn-878
• IPCSQPPQIEHGTINSSR (18aa)
  •    P08603    Asn-882
• GVVTDEQGIPIANATISVSGINHGVK (26aa)
  •    Q8IUX7    Asn-922
• SVSPTTEMVSNESVDYR (17aa)
  •    P08581    Asn-998
• INYSIPTGQWVGVQIPR (17aa)
  •    P24821    Asn-1018
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098
• LHNLTTGTPAR (11aa)
  •    Q9UQP3    Asn-1149
• TANDTSTEAYNIIIR (15aa)
  •    P11047    Asn-1205
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236
• FYFGGSPISAQYANFTGCISNAYFTR (26aa)
  •    Q16363    Asn-1366
• FNSSYLQGTNQITGR (15aa)
  •    P04114    Asn-1523
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763
• LYWISSGNHTINR (13aa)
  •    Q07954    Asn-1763
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411