Hex:4 HexNAc:3 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Collocalia sp (Glossy swiftlet)
• Gallus gallus (Chicken)
• Drosophila melanogaster (Fruit fly)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Acid ceramidase / Homo sapiens    Q13510
• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-galactosidase A / Homo sapiens    P06280
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Aminopeptidase n / Homo sapiens    P15144
• Angiopoietin-1 receptor / Homo sapiens    Q02763
• Apolipoprotein B-100 / Homo sapiens    P04114
• Apolipoprotein D / Homo sapiens    P05090
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• BDNF/NT-3 growth factors receptor / Homo sapiens    Q16620
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Beta-galactosidase / Homo sapiens    P16278
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• CD166 antigen / Homo sapiens    Q13740
• CD276 antigen / Homo sapiens    Q5ZPR3
• Cell adhesion molecule 1 / Homo sapiens    Q9BY67
• Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens    O75503
• Ceruloplasmin / Homo sapiens    P00450
• Choriogonadotropin beta chain / Homo sapiens    P0DN86
• Coagulation factor V / Homo sapiens    P12259
• Coagulation factor VIII / Homo sapiens    P00451
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Complement factor b / Homo sapiens    P00751
• Complement factor h / Homo sapiens    P08603
• Contactin-4 / Homo sapiens    Q8IWV2
• Decorin / Homo sapiens    P07585
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Epidermal growth factor receptor / Homo sapiens    P00533
• Epididymis-specific alpha-mannosidase / Homo sapiens    Q9Y2E5
• Fibrinogen beta chain / Homo sapiens    P02675
• Fibrinogen gamma chain / Homo sapiens    P02679
• Fibronectin / Homo sapiens    P02751
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-glutamyl hydrolase / Homo sapiens    Q92820
• Glucosylceramidase / Homo sapiens    P04062
• Glycodelin-a / Homo sapiens    P09466
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Hepatocyte growth factor receptor / Homo sapiens    P08581
• High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens    P12314-2
• Histidine-rich glycoprotein / Homo sapiens    P04196
• Immunoglobulin alpha (non secretory) / Homo sapiens    P01877    P01876
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens    P0DOX2
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Integrin alpha-2 / Homo sapiens    P17301
• Integrin alpha-5/beta-1 / Homo sapiens    P08648    P05556
• Interleukin-1 receptor accessory protein / Homo sapiens    Q9NPH3
• Lactadherin / Homo sapiens    Q08431
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens    P12318-1
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens    P31994-3
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens    O75015
• Lumican / Homo sapiens    P51884
• Lutropin beta chain / Homo sapiens    P01229
• Lysosomal alpha-glucosidase / Homo sapiens    P10253
• Lysosomal alpha-mannosidase / Homo sapiens    O00754
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Monocyte differentiation antigen cd14 / Homo sapiens    P08571
• Myelin protein zero-like protein 1 / Homo sapiens    O95297
• Neutrophil elastase / Homo sapiens    P08246
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Periostin / Homo sapiens    Q15063
• Phospholipase D3 / Homo sapiens    Q8IV08
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prenylcysteine oxidase 1 / Homo sapiens    Q9UHG3
• Probable serine carboxypeptidase CPVL / Homo sapiens    Q9H3G5
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Prothrombin / Homo sapiens    P00734
• Putative phospholipase B-like 2 / Homo sapiens    Q8NHP8
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens    P28827
• Secreted frizzled-related protein 4 / Homo sapiens    Q6FHJ7
• Serotransferrin / Homo sapiens    P02787
• Serum paraoxonase/arylesterase 1 / Homo sapiens    P27169
• Sialic acid-binding Ig-like lectin 14 / Homo sapiens    Q08ET2
• Sparc / Homo sapiens    P09486
• Spondin-1 / Homo sapiens    Q9HCB6
• Sulfhydryl oxidase 1 / Homo sapiens    O00391
• Synaptophysin-like protein 1 / Homo sapiens    Q16563
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Tenascin / Homo sapiens    P24821
• Tenascin-N / Homo sapiens    Q9UQP3
• Tetraspanin-1 / Homo sapiens    O60635
• Thrombospondin-1 / Homo sapiens    P07996
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Transmembrane 9 superfamily member 3 / Homo sapiens    Q9HD45
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Tripeptidyl-peptidase 1 / Homo sapiens    O14773
• Vitronectin / Homo sapiens    P04004
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Mucin / Collocalia sp    
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amniotic Fluid (UBERON_0000173)  
• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)   Mature NK T cell (CL_0000814)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Embryo (UBERON_0000922)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Pituitary Gland (UBERON_0000007)  
• Placenta (UBERON_0001987)  
• Saliva (UBERON_0001836)  
• Seminal Fluid (UBERON_0006530)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• SK-BR-3 (CVCL_0033)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  

Reported structure

• N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 3532
• N-Linked / Complex / Structure 9686
• N-Linked / Complex / Structure 9725
• N-Linked / Complex / Structure 10649
• N-Linked / Complex / Structure 10703
• N-Linked / Complex / Structure 10827
• N-Linked / Complex / Structure 10891
• N-Linked / Complex / Structure 10924
• N-Linked / Complex / Structure 10970
• N-Linked / Complex / Structure 11150
• N-Linked / Complex / Structure 11217
• N-Linked / Complex / Structure 11408
• N-Linked / Complex / Structure 11561
• N-Linked / Hybrid / Structure 9488
• N-Linked / Hybrid / Structure 9709
• N-Linked / No-core / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-3)Man(b1-4)GlcNAc
• O-Linked / Core 5 / Gal(a1-4)Gal(b1-4)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc(a1-3)GalNAc

Composition

• Hex:4 HexNAc:3 NeuAc:1 (avg mass : 1567.4278 )

Disease

• Cancer, breast (DOID:1612)
• Carbohydrate-Deficient Glycoprotein Syndrome, Type II (DOID:5212)
• Carcinoma (DOID:305)
• Carcinoma, Hepatocellular (DOID:684)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Gastritis (DOID:4029)
• Mixed phenotype acute leukemia (DOID:9953)
• Multiple myeloma (DOID:9538)
• Prostate cancer (DOID:10283)
• Prostate Disease (DOID:47)
• Sialidosis, severe infantile with abdominal ascites (DOID:3343)

Reference

• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
• Malignant tissues produce divergent antibody glycosylation of relevance for cancer gene therapy effectiveness. (2020 - Brücher D, Franc V, Smith SN, Heck AJR, Plückthun A) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Structures of the N-linked oligosaccharides on human plasma vitronectin. (1995 - Ogawa H, Yoneda A, Seno N, Hayashi M, Ishizuka I, Hase S, Matsumoto I) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
• Carbohydrate deficient glycoprotein syndrome type II: a deficiency in Golgi localised N-acetyl-glucosaminyltransferase II. (1994 - Jaeken J, Schachter H, Carchon H, De Cock P, Coddeville B, Spik G) / Status : Reviewed
• Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Severe infantile sialidosis--the characteristics of oligosaccharides isolated from the urine and the abdominal ascites. (1992 - Nakamura Y, Takahashi Y, Yamaguchi S, Omiya S, Orii T, Yara A, Gushiken M) / Status : Reviewed
• 1H and 13C-NMR assignments for sialylated oligosaccharide-alditols related to mucins. Study of thirteen components from hen ovomucin and swallow nest mucin. (1992 - Strecker G, Wieruszeski J, Cuvillier O, Michalski J, Montreuil J) / Status : Reviewed
• Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy. (1991 - Weisshaar G, Hiyama J, Renwick A) / Status : Reviewed
• NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. (1991 - Weisshaar G, Hiyama J, Renwick A, Nimtz M) / Status : Reviewed
• Structure of the monosialyl oligosaccharides derived from salivary gland mucin glycoproteins of the Chinese swiftlet (genus Collocalia). Characterization of novel types of extended core structure, Gal beta(1----3)[GlcNAc beta(1----6)] GalNAc alpha(1----3)GalNAc(-ol), and of chain termination, [Gal a (1987 - Wieruszeski J, Michalski J, Montreuil J, Strecker G, Peter-Katalinic J, Egge H, van Halbeek H, Mutsaers J, Vliegenthart J) / Status : Reviewed

Reported glycosite

• Acid ceramidase / Homo sapiens
  •        Asn-286
• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-922
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-103
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-271
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-869
• Alpha-galactosidase A / Homo sapiens
  •        Asn-139
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
  •        Asn-177
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-503
• Aminopeptidase n / Homo sapiens
  •        Asn-681
• Angiopoietin-1 receptor / Homo sapiens
  •        Asn-158
• Apolipoprotein B-100 / Homo sapiens
  •        Asn-1523
  •        Asn-3411
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-89
• BDNF/NT-3 growth factors receptor / Homo sapiens
  •        Asn-254
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
• Beta-galactosidase / Homo sapiens
  •        Asn-498
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• CD166 antigen / Homo sapiens
  •        Asn-480
• CD276 antigen / Homo sapiens
  •        Asn-104
• Cell adhesion molecule 1 / Homo sapiens
  •        Asn-308
• Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
  •        Asn-255
• Ceruloplasmin / Homo sapiens
  •        Asn-762
• Choriogonadotropin beta chain / Homo sapiens
  •        Asn-33
  •        Asn-50
• Coagulation factor V / Homo sapiens
  •        Asn-1074
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
• Complement factor b / Homo sapiens
  •        Asn-122
• Complement factor h / Homo sapiens
  •        Asn-882
• Contactin-4 / Homo sapiens
  •        Asn-764
• Decorin / Homo sapiens
  •        Asn-211
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-53
  •        Asn-119
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-816
• Epididymis-specific alpha-mannosidase / Homo sapiens
  •        Asn-336
• Fibrinogen beta chain / Homo sapiens
  •        Asn-394
• Fibrinogen gamma chain / Homo sapiens
  •        Asn-78
• Fibronectin / Homo sapiens
  •        Asn-542
  •        Asn-1236
• Galectin-3-binding protein / Homo sapiens
  •        Asn-69
  •        Asn-551
• Gamma-glutamyl hydrolase / Homo sapiens
  •        Asn-203
  •        Asn-307
• Glucosylceramidase / Homo sapiens
  •        Asn-185
• Glycodelin-a / Homo sapiens
  •        Asn-46
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Undefined site
  •        Asn-76
  •        Asn-102
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-207
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
  •        Asn-240
• Hepatocyte growth factor receptor / Homo sapiens
  •        Asn-998
• High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens
  •        Undefined site
• Histidine-rich glycoprotein / Homo sapiens
  •        Asn-125
• Immunoglobulin alpha (non secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Asn-144
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Undefined site
  •        Asn-131
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-439
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-116
• Integrin alpha-2 / Homo sapiens
  •        Asn-343
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Interleukin-1 receptor accessory protein / Homo sapiens
  •        Asn-118
• Lactadherin / Homo sapiens
  •        Asn-238
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-1366
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1205
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Undefined site
  •        Asn-63
  •        Asn-180
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
  •        Undefined site
• Lumican / Homo sapiens
  •        Asn-127
• Lutropin beta chain / Homo sapiens
  •        Asn-50
• Lysosomal alpha-glucosidase / Homo sapiens
  •        Asn-390
• Lysosomal alpha-mannosidase / Homo sapiens
  •        Asn-692
  •        Asn-766
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-49
  •        Asn-58
  •        Asn-275
  •        Asn-356
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2500
• Monocyte differentiation antigen cd14 / Homo sapiens
  •        Asn-151
• Myelin protein zero-like protein 1 / Homo sapiens
  •        Asn-50
• Neutrophil elastase / Homo sapiens
  •        Asn-88
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-197
• Periostin / Homo sapiens
  •        Asn-599
• Phospholipase D3 / Homo sapiens
  •        Asn-236
• Plexin-B2 / Homo sapiens
  •        Asn-528
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-90
  •        Asn-186
  •        Asn-499
• Prenylcysteine oxidase 1 / Homo sapiens
  •        Asn-196
• Probable serine carboxypeptidase CPVL / Homo sapiens
  •        Asn-307
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-1763
• Prosaposin / Homo sapiens
  •        Asn-80
  •        Asn-101
  •        Asn-332
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Prothrombin / Homo sapiens
  •        Asn-143
• Putative phospholipase B-like 2 / Homo sapiens
  •        Asn-465
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
  •        Asn-131
• Secreted frizzled-related protein 4 / Homo sapiens
  •        Asn-194
• Serotransferrin / Homo sapiens
  •        Undefined site
  •        Asn-630
• Serum paraoxonase/arylesterase 1 / Homo sapiens
  •        Asn-253
• Sialic acid-binding Ig-like lectin 14 / Homo sapiens
  •        Asn-100
• Sparc / Homo sapiens
  •        Asn-116
• Spondin-1 / Homo sapiens
  •        Asn-214
• Sulfhydryl oxidase 1 / Homo sapiens
  •        Asn-575
• Synaptophysin-like protein 1 / Homo sapiens
  •        Asn-71
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-878
• Tenascin / Homo sapiens
  •        Asn-1018
• Tenascin-N / Homo sapiens
  •        Asn-1149
• Tetraspanin-1 / Homo sapiens
  •        Asn-154
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
• Transmembrane 9 superfamily member 3 / Homo sapiens
  •        Asn-174
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-200
  •        Asn-249
  •        Asn-275
• Tripeptidyl-peptidase 1 / Homo sapiens
  •        Asn-443
• Vitronectin / Homo sapiens
  •        Undefined site
  •        Asn-169
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-153
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-238
• Mucin / Collocalia sp
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-1098

Mass spectrometry observed peptide

• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• EIFVANGTQGK (11aa)
  •    O95297    Asn-50     Myelin protein zero-like protein 1 / Homo sapiens
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53     Dipeptidyl peptidase 1 / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHNESLISSQASSY (14aa)
  •    P08637    Asn-63     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• AVCGGVLVHPQWVLTAAHCIRNK (23aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• AIGFENATQAIGR (13aa)
  •    Q08380    Asn-69     Galectin-3-binding protein / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• IIVPINNRENISDPTSPIR (19aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• RIIVPLNNRENISDPTSPLRT (21aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• RENISDPTSPLRT (13aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• GQTEIQVNCPPAVTENK (17aa)
  •    Q16563    Asn-71     Synaptophysin-like protein 1 / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• DLQSLEDILHQVENK (15aa)
  •    P02679    Asn-78     Fibrinogen gamma chain / Homo sapiens
• DLQSLEDILHQVENKT (16aa)
  •    P02679    Asn-78     Fibrinogen gamma chain / Homo sapiens
• DNATEEEILVYLEK (14aa)
  •    P07602    Asn-80     Prosaposin / Homo sapiens
• ENTSDPSIVIAFGR (14aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• VVIGAHNISR (10aa)
  •    P08246    Asn-88     Neutrophil elastase / Homo sapiens
• AIVNFTR (7aa)
  •    P98160    Asn-89     Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
• KYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKC (34aa)
  •    P01833    Asn-90     Polymeric immunoglobulin receptor / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ADGTVNQIEGEATPVNLTEPA (21aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• NCSLSIGDAR (10aa)
  •    Q08ET2    Asn-100     Sialic acid-binding Ig-like lectin 14 / Homo sapiens
• TCDWIPKPNMSASCK (15aa)
  •    P07602    Asn-101     Prosaposin / Homo sapiens
• ENGTISR (7aa)
  •    P02763    Asn-103     Alpha-1-acid glycoprotein 1 / Homo sapiens
• TAIFPDIIAQGNASIR (16aa)
  •    Q5ZPR3    Asn-104     CD276 antigen / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• VCSNDNK (7aa)
  •    P09486    Asn-116     Sparc / Homo sapiens
• SANASFNIK (9aa)
  •    Q13308    Asn-116     Inactive tyrosine-protein kinase 7 / Homo sapiens
• NTTYCSK (7aa)
  •    Q9NPH3    Asn-118     Interleukin-1 receptor accessory protein / Homo sapiens
• VTTYCNETMTGWVHDVIGR (19aa)
  •    P53634    Asn-119     Dipeptidyl peptidase 1 / Homo sapiens
• SPYYNVSDEISFHCYDGYTIR (21aa)
  •    P00751    Asn-122     Complement factor b / Homo sapiens
• VIDFNCTTSSVSSAIANTK (19aa)
  •    P04196    Asn-125     Histidine-rich glycoprotein / Homo sapiens
• VIDFNCTTSSVSSALANTK (19aa)
  •    P04196    Asn-125     Histidine-rich glycoprotein / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• VNNGPLGNPIWNISGDPTR (19aa)
  •    P28827    Asn-131     Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01877    Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
  •    P43307    Asn-136     Translocon-associated protein subunit alpha / Homo sapiens
• IGIYADVGNK (10aa)
  •    P06280    Asn-139     Alpha-galactosidase A / Homo sapiens
• YPHKPEINSTTHPGADLQENFCR (23aa)
  •    P00734    Asn-143     Prothrombin / Homo sapiens
• PALEDLLLGSEANLTCTLTGLR (22aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLRNVSWATGRS (12aa)
  •    P08571    Asn-151     Monocyte differentiation antigen cd14 / Homo sapiens
• RNVSWATGRS (10aa)
  •    P08571    Asn-151     Monocyte differentiation antigen cd14 / Homo sapiens
• CCGFTNYTDFEDSPYFK (17aa)
  •    O60635    Asn-154     Tetraspanin-1 / Homo sapiens
• NGSFIHSVPR (10aa)
  •    Q02763    Asn-158     Angiopoietin-1 receptor / Homo sapiens
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• IVDVNITSEGK (11aa)
  •    Q9HD45    Asn-174     Transmembrane 9 superfamily member 3 / Homo sapiens
• MAAAINATGR (10aa)
  •    P17050    Asn-177     Alpha-n-acetylgalactosaminidase / Homo sapiens
• TKPREEQFNSTYR (13aa)
  •        Asn-177     Immunoglobulin heavy constant gamma 4 (nivolumab) / Homo sapiens
• CRGLVGSKNVSSE (13aa)
  •    P08637    Asn-180     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •    VAR_003960   176:F→V   dbSNP:rs396991
• TYTYADTPDDFQIHNFSIPEEDTK (24aa)
  •    P04062    Asn-185     Glucosylceramidase / Homo sapiens
• QIGLYPVLVIDSSGYVNPNYTGR (23aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• NYSYVIHAK (9aa)
  •    Q6FHJ7    Asn-194     Secreted frizzled-related protein 4 / Homo sapiens
• IIHAIGGDDFIGMINR (16aa)
  •    Q9UHG3    Asn-196     Prenylcysteine oxidase 1 / Homo sapiens
• NHSIFLADINQER (13aa)
  •    P50897    Asn-197     Palmitoyl-protein thioesterase 1 / Homo sapiens
• VSVNTANVTIGPQIMEVTVYR (21aa)
  •    Q14956    Asn-200     Transmembrane glycoprotein NMB / Homo sapiens
• VSVNTANVTLGPQLMEVTVYRR (22aa)
  •    Q14956    Asn-200     Transmembrane glycoprotein NMB / Homo sapiens
• NFTMNEK (7aa)
  •    Q92820    Asn-203     Gamma-glutamyl hydrolase / Homo sapiens
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• ITFYGNWSEK (10aa)
  •    Q9HCB6    Asn-214     Spondin-1 / Homo sapiens
• EIGVVMYNCSCIAR (14aa)
  •    Q8IV08    Asn-236     Phospholipase D3 / Homo sapiens
• KFHVNYTQPLVAVK (14aa)
  •    P14231    Asn-238     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• KNNSIPDKQ (9aa)
  •    Q08431    Asn-238     Lactadherin / Homo sapiens
• RNGTGHGNSTHHGPEYMRC (19aa)
  •    P02790    Asn-240     Hemopexin / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• NSSDETFLK (9aa)
  •    Q14956    Asn-249     Transmembrane glycoprotein NMB / Homo sapiens
• HANWTITPIK (10aa)
  •    P27169    Asn-253     Serum paraoxonase/arylesterase 1 / Homo sapiens
• HANWTLTPLK (10aa)
  •    P27169    Asn-253     Serum paraoxonase/arylesterase 1 / Homo sapiens
• ITNISSDDSGK (11aa)
  •    Q16620    Asn-254     BDNF/NT-3 growth factors receptor / Homo sapiens
• NIETNYTR (8aa)
  •    O75503    Asn-255     Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• KYLGNATAIFFLPDEGKL (18aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
  •    Q14956    Asn-275     Transmembrane glycoprotein NMB / Homo sapiens
• IIAPAYFIIGGNQSGEGCVITR (22aa)
  •    Q13510    Asn-286     Acid ceramidase / Homo sapiens
• VIYQNHNK (8aa)
  •    P11627    Asn-293     Neural cell adhesion molecule L1 / Mus musculus
• IIDGDITSDPSYFQNVTGCSNYYNFIR (27aa)
  •    Q9H3G5    Asn-307     Probable serine carboxypeptidase CPVL / Homo sapiens
• ALIYQFSPIYTGNISSFQQCYIFD (24aa)
  •    Q92820    Asn-307     Gamma-glutamyl hydrolase / Homo sapiens
• TDNGTYR (7aa)
  •    Q9BY67    Asn-308     Cell adhesion molecule 1 / Homo sapiens
• MFSQNDTR (8aa)
  •    P02750    Asn-325     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• LIDNNK (6aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• ALHALNVTWR (10aa)
  •    Q9Y2E5    Asn-336     Epididymis-specific alpha-mannosidase / Homo sapiens
• YFFNVSDEAAIIEK (14aa)
  •    P17301    Asn-343     Integrin alpha-2 / Homo sapiens
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• QVVENMTR (8aa)
  •    P10253    Asn-390     Lysosomal alpha-glucosidase / Homo sapiens
• GTAGNAIMDGASQIMGENR (19aa)
  •    P02675    Asn-394     Fibrinogen beta chain / Homo sapiens
• KSTGKPTLYNVSLVMSDTAGTCY- (24aa)
  •    P01871    Asn-439     Immunoglobulin heavy constant mu / Homo sapiens
• FISSSPHIPPSSYFNASGR (19aa)
  •    O14773    Asn-443     Tripeptidyl-peptidase 1 / Homo sapiens
• NQSLVQDMDSMVR (13aa)
  •    Q8NHP8    Asn-465     Putative phospholipase B-like 2 / Homo sapiens
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480     CD166 antigen / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• GLVSNLTLSSN (11aa)
  •    P16278    Asn-498     Beta-galactosidase / Homo sapiens
• KYWCKWNNTGCQALPSQDEGPSKA (24aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• WNNTGCQALPSQDEGPSK (18aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• SVYNCSGEACR (11aa)
  •    P54802    Asn-503     Alpha-n-acetylglucosaminidase / Homo sapiens
• SCVAVTSAQPQNMSR (15aa)
  •    O15031    Asn-528     Plexin-B2 / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• HEEGHMLNCTCFGQGR (16aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• NSTLDPGKPEMMK (13aa)
  •    O00391    Asn-575     Sulfhydryl oxidase 1 / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• QQQHLFGSNVTDCSGNFCLFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• VPVTIAINNTIFIIEER (17aa)
  •    P15144    Asn-681     Aminopeptidase n / Homo sapiens
• TPIVQEVHQNFSAWCSQVVR (20aa)
  •    O00754    Asn-692     Lysosomal alpha-mannosidase / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• NESVHPFSPFEVK (13aa)
  •    Q8IWV2    Asn-764     Contactin-4 / Homo sapiens
• INQTEPVAGNYYPVNTR (17aa)
  •    O00754    Asn-766     Lysosomal alpha-mannosidase / Homo sapiens
• NVTAQICIDK (10aa)
  •    P12109    Asn-804     Collagen alpha-1(VI) chain / Homo sapiens
• DNIGSQYLLNWCVQIAK (17aa)
  •    P00533    Asn-816     Epidermal growth factor receptor / Homo sapiens
• SLGNVNFTVSAEALESQELCGTEVPSVPEHGR (32aa)
  •    P01023    Asn-869     Alpha-2-macroglobulin / Homo sapiens
• SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK (33aa)
  •    P01023    Asn-869     Alpha-2-macroglobulin / Homo sapiens
• ENGSFSGK (8aa)
  •    Q7Z7G0    Asn-878     Target of Nesh-SH3 / Homo sapiens
• IPCSQPPQIEHGTINSSR (18aa)
  •    P08603    Asn-882     Complement factor h / Homo sapiens
• GVVTDEQGIPIANATISVSGINHGVK (26aa)
  •    Q8IUX7    Asn-922     Adipocyte enhancer-binding protein 1 / Homo sapiens
• SVSPTTEMVSNESVDYR (17aa)
  •    P08581    Asn-998     Hepatocyte growth factor receptor / Homo sapiens
• INYSIPTGQWVGVQIPR (17aa)
  •    P24821    Asn-1018     Tenascin / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LHNLTTGTPAR (11aa)
  •    Q9UQP3    Asn-1149     Tenascin-N / Homo sapiens
• TANDTSTEAYNIIIR (15aa)
  •    P11047    Asn-1205     Laminin subunit gamma-1 / Homo sapiens
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236     Fibronectin / Homo sapiens
• FYFGGSPISAQYANFTGCISNAYFTR (26aa)
  •    Q16363    Asn-1366     Laminin subunit alpha-4 / Homo sapiens
• RFNSSYLQGTNQITGRY (17aa)
  •    P04114    Asn-1523     Apolipoprotein B-100 / Homo sapiens
• FNSSYLQGTNQITGR (15aa)
  •    P04114    Asn-1523     Apolipoprotein B-100 / Homo sapiens
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763     Collagen alpha-1(XII) chain / Homo sapiens
• LYWISSGNHTINR (13aa)
  •    Q07954    Asn-1763     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500     Matrix-remodeling-associated protein 5 / Homo sapiens
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens
• KFVEGSHNSTVSLTTKN (17aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens