Hex:4 HexNAc:5

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Rattus norvegicus (Norway rat)
• Coturnix coturnix japonica (Japanese quail)
• Gallus gallus (Chicken)
• Torpedo californica (Pacific electric ray)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• Calumenin / Homo sapiens    O43852
• Calumenin, isoform CRA_a / Homo sapiens
• Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens    P13688    P31997
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Collagen alpha-6(VI) chain / Homo sapiens    A6NMZ7
• Decorin / Homo sapiens    P07585
• Fibronectin / Homo sapiens    P02751
• Glandular kallikrein 1 / Homo sapiens    P06870
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin gamma / Homo sapiens    P01860    P01859    P01861    P01857
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin j chain / Homo sapiens    P01591
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Neural cell adhesion molecule L1 / Homo sapiens    P32004
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Prolargin / Homo sapiens    P51888
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens    Q9BYF1
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Uromodulin / Homo sapiens    P07911
• Von willebrand factor / Homo sapiens    P04275
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Lactotransferrin / Bos taurus    P24627
• Platelet glycoprotein IV / Bos taurus    P26201
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Uncharacterized protein from Milk Fat Globule Membrane / Bos taurus
• T-cell immunomodulatory protein / Mus musculus    Q99KW9
• Immunoglobulin gamma / Oryctolagus cuniculus
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Immunoglobulin y / Coturnix coturnix japonica
• Immunoglobulin gamma / Gallus gallus
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein from Egg Cell / Gallus gallus
• Acetylcholine receptor protein / Torpedo californica    P02718    P02714    P02710    P02712
• Recombinant Spike glycoprotein (FreeStyle 293-F) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Electric Organ (UBERON_0006869)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Milk (UBERON_0001913)   Plasma Membrane (GO_0005886)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Pituitary Gland (UBERON_0000007)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Spleen (UBERON_0002106)  
• Urine (UBERON_0001088)  
• 3Y1-B clone 1 (CVCL_4563)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Egg Cell  
• Microsome (GO_0005792)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 824
• N-Linked / Complex / Structure 2104
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
• N-Linked / Hybrid / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc

Composition

• Hex:4 HexNAc:5 (avg mass : 1682.5599 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Gaucher Disease (DOID:1926)
• Melanoma (DOID:1909)
• Prostate cancer (DOID:10283)

Reference

• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Unreviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Site-specific analysis of the SARS-CoV-2 glycan shield (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Unreviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
• Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed

Reported glycosite

• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-89
• Calumenin / Homo sapiens
  •        Asn-131
• Calumenin, isoform CRA_a / Homo sapiens
  •        Asn-131
• Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens
  •        Asn-173
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
• Collagen alpha-6(VI) chain / Homo sapiens
  •        Asn-2034
• Decorin / Homo sapiens
  •        Asn-211
• Fibronectin / Homo sapiens
  •        Asn-542
• Glandular kallikrein 1 / Homo sapiens
  •        Undefined site
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-869
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
  •        Asn-205
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Asn-322
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-209
• Immunoglobulin j chain / Homo sapiens
  •        Asn-71
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-215
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1022
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-378
• Neural cell adhesion molecule L1 / Homo sapiens
  •        Asn-505
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
• Prolargin / Homo sapiens
  •        Asn-289
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens
  •        Asn-53
  •        Asn-90
  •        Asn-103
  •        Asn-322
  •        Asn-546
  •        Asn-690
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-1069
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
• Uromodulin / Homo sapiens
  •        Asn-275
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Lactotransferrin / Bos taurus
  •        Asn-495
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein from Milk Fat Globule Membrane / Bos taurus
  •        Undefined site
• T-cell immunomodulatory protein / Mus musculus
  •        Asn-35
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Immunoglobulin y / Coturnix coturnix japonica
  •        Undefined site
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Egg Cell / Gallus gallus
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-615
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-602
  •        Asn-657
  •        Asn-709
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
  •        Asn-1135
  •        Asn-1159
  •        Asn-1174
  •        Asn-1194

Mass spectrometry observed peptide

• FVFLVLLPLVSSQCVNLTTRTQLP (24aa)
  •    P0DTC2    Asn-17
• FLVLLPLVSSQCVNLTTRTQLPPAYTNSFTR (31aa)
  •    P0DTC2    Asn-17
• VFLVLLPLVSSQCVNLTTR (19aa)
  •    P0DTC2    Asn-17
• LVLLPLVSSQCVNLTTRTQLPPAYTNSFTR (30aa)
  •    P0DTC2    Asn-17
• LLPLVSSQCVNLTTR (15aa)
  •    P0DTC2    Asn-17
• ALHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLR (36aa)
  •    Q99KW9    Asn-35
• WFSAGLASNSSWLREK (16aa)
  •    P41222    Asn-51
• NYNTNITEENVQNMNNAGDK (20aa)
  •    Q9BYF1    Asn-53
• NTNITEENVQNMNNAGDK (18aa)
  •    Q9BYF1    Asn-53
• SSVLHSTQDLFLPFFSNV (18aa)
  •    P0DTC2    Asn-61
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• IIVPINNRENISDPTSPIR (19aa)
  •    P01591    Asn-71
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74
• IHVSGTNGTKR (11aa)
  •    P0DTC2    Asn-74
• AIVNFTR (7aa)
  •    P98160    Asn-89
• AQMYPLQEIQNL (12aa)
  •    Q9BYF1    Asn-90
• QQNGSSVLSEDK (12aa)
  •    Q9BYF1    Asn-103
• TQSLLIVNNATNVVIKVC (18aa)
  •    P0DTC2    Asn-122
• SNIIRGWIFGTTLDSKTQSLLIVNN (25aa)
  •    P0DTC2    Asn-122
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNAT (11aa)
  •    P0DTC2    Asn-122
• GTTLDSKTQSLLIVNNATNVVIK (23aa)
  •    P0DTC2    Asn-122
• KTQSLLIVNNATNVVIK (17aa)
  •    P0DTC2    Asn-122
• IVNNATNVVIKVCEF (15aa)
  •    P0DTC2    Asn-122
• NVTYGTYIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131
• NVTYGTYIDDPDPDDGFNYK (20aa)
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01877    Asn-131
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144
• YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
  •    P43307    Asn-136
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140
• HKNNK (5aa)
  •    P0DTC2    Asn-149
• TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
  •    P02788    Asn-156
• VYSSANNCTFEYVSQPFLM (19aa)
  •    P0DTC2    Asn-165
• SSANNCTF (8aa)
  •    P0DTC2    Asn-165
• DAVAFTCEPETQNTTYLWWVNGQSLPVSPR (30aa)
  •    P13688    Asn-173
  •    P31997    Asn-173
• EEQFNSTFR (9aa)
  •    P01859    Asn-176
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• TPLTANITK (9aa)
  •    P01877    Asn-205
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211
• NTTGFK (6aa)
  •    Q16363    Asn-215
• DLPQGFSALEPLVDLPIGINITRFQTLLALH (31aa)
  •    P0DTC2    Asn-234
• HTPINLVRDLPQGFSALEPLVDLPIGINITR (31aa)
  •    P0DTC2    Asn-234
• VDLPIGINITRFQTLLALHR (20aa)
  •    P0DTC2    Asn-234
• IGINITRFQTLLALHR (16aa)
  •    P0DTC2    Asn-234
• PQGFSALEPLVDLPIGINITR (21aa)
  •    P0DTC2    Asn-234
• DLPQGFSALEPLVDLPIGINI (21aa)
  •    P0DTC2    Asn-234
• LPIGINITR (9aa)
  •    P0DTC2    Asn-234
• LPIGINITRFQTLLALHR (18aa)
  •    P0DTC2    Asn-234
• HTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLL (36aa)
  •    P0DTC2    Asn-234
• EPLVDLPIGINITRFQTLLALHR (23aa)
  •    P0DTC2    Asn-234
• PIGINITR (8aa)
  •    P0DTC2    Asn-234
• DLPIGINITRFQTL (14aa)
  •    P0DTC2    Asn-234
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Asn-275
• NENGTIT (7aa)
  •    P0DTC2    Asn-282
• KYNENGTIT (9aa)
  •    P0DTC2    Asn-282
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• NSFNISNLLVLHLSHNR (17aa)
  •    P51888    Asn-289
• GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
  •    P01860    Asn-322
• PNMTQGFWENSMLTDPGNVQK (21aa)
  •    Q9BYF1    Asn-322
• VSVGLPNMTQGFW (13aa)
  •    Q9BYF1    Asn-322
• VQPTESIVRFPNITNL (16aa)
  •    P0DTC2    Asn-331
• RFPNIT (6aa)
  •    P0DTC2    Asn-331
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340
• IAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340
• FNATRFASVYAWNR (14aa)
  •    P0DTC2    Asn-343
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• GNTTTLISENGHAADTLTATNFR (23aa)
  •    Q14766    Asn-378
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497
• NVTIMANLK (9aa)
  •    P32004    Asn-505
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• CDISNSTEAGQK (12aa)
  •    Q9BYF1    Asn-546
• DPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVN (39aa)
  •    P0DTC2    Asn-602
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615
• AGCLIGAEHVNNSYECDIPIGAGIC (25aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• NVSDIIPR (8aa)
  •    Q9BYF1    Asn-690
• IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTT (33aa)
  •    P0DTC2    Asn-709
• SIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYG (67aa)
  •    P0DTC2    Asn-717
• TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
  •    P0DTC2    Asn-801
• FGGFNFSQILPDPSK (15aa)
  •    P0DTC2    Asn-801
• NATLAEQAK (9aa)
  •    Q9Y4L1    Asn-869
• CDQCEENYFYNR (12aa)
  •    P11047    Asn-1022
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• VVNSTTGPGEHL (12aa)
  •    P07996    Asn-1067
• VVNSTTGTGEHIR (13aa)
  •    P35442    Asn-1069
• NFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQ (33aa)
  •    P0DTC2    Asn-1098
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098
• KNFTTAPAICHDGK (14aa)
  •    P0DTC2    Asn-1074
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098
• NFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFK (50aa)
  •    P0DTC2    Asn-1135
• GIVNNTVYDPLQPELDSFK (19aa)
  •    P0DTC2    Asn-1135
• KYFKNHTS (8aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGIN (16aa)
  •    P0DTC2    Asn-1159
• EELDKYFKNHTSPDVDLGDISGIN (24aa)
  •    P0DTC2    Asn-1159
• ISGINASVVNIQK (13aa)
  •    P0DTC2    Asn-1174
• NASVVNIQKEIDR (13aa)
  •    P0DTC2    Asn-1174
• NLNESLIDLQELGKYEQYIKWPWYIWLGFI (30aa)
  •    P0DTC2    Asn-1194
• NLNESLIDLQELGKYEQYIKWPWYIW (26aa)
  •    P0DTC2    Asn-1194
• EIDRLNEVAKNLNESLIDL (19aa)
  •    P0DTC2    Asn-1194
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763
• AEFNLTTYR (9aa)
  •    A6NMZ7    Asn-2034