taxonomy (12)
protein (83)
source (38)
structure (32)
composition (1)
disease (13)
reference (62)
site (107)
peptide (64)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Human immunodeficiency virus type 1 (HIV-1)
- Human betacoronavirus 2c EMC/2012
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- Calumenin / Homo sapiens O43852
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens P31997
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Collagen alpha-6(VI) chain / Homo sapiens A6NMZ7
- Decorin / Homo sapiens P07585
- Fibronectin / Homo sapiens P02751
- Glandular kallikrein 1 / Homo sapiens P06870
- High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens P12314-2
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens P01880
- Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens P01854
- Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens P01854
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Laminin subunit gamma-1 / Homo sapiens P11047
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens P12318-1
- Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens P31994-3
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens P08637
- Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens O75015
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Prolargin / Homo sapiens P51888
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Tissue-type plasminogen activator / Homo sapiens P00750
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Uromodulin / Homo sapiens P07911
- Von willebrand factor / Homo sapiens P04275
- Collagen alpha-1(IV) chain / Bos taurus Q7SIB2
- Collagen alpha-2 (IV) chain / Bos taurus Q7SIB3
- Lactotransferrin / Bos taurus P24627
- Platelet glycoprotein IV / Bos taurus P26201
- Thyrotropin-aplha and beta chains / Bos taurus P01217 P01223
- Uncharacterized protein from Milk / Bos taurus
- T-cell immunomodulatory protein / Mus musculus Q99KW9
- Immunoglobulin gamma / Oryctolagus cuniculus
- Immunoglobulin gamma / Ovis aries
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012 K0BRG7
- Immunoglobulin y / Coturnix coturnix japonica
- Immunoglobulin gamma / Gallus gallus
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Acetylcholine receptor protein / Torpedo californica P02718 P02712 P02710 P02714
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Cerebellum (UBERON_0002037)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Colostrum (UBERON_0001914)
- Electric Organ (UBERON_0006869)
- Frontal Cortex (UBERON_0001870)
- Glomerular Basement Membrane (UBERON_0005777)
- Hippocampul formation (UBERON:0002421)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Milk (UBERON_0001913) Plasma Membrane (GO_0005886)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Pituitary Gland (UBERON_0000007)
- Prefrontal Cortex (UBERON:0000451)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Spleen (UBERON_0002106)
- Striatum (UBERON_0002345)
- Urine (UBERON_0001088)
- 3Y1-B clone 1 (CVCL_4563)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- HEK293SF-3F6 (CVCL_4V95)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Microsome (GO_0005792)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 824
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2104
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9418
- N-Linked / Complex / Structure 9554
- N-Linked / Complex / Structure 9716
- N-Linked / Complex / Structure 10021
- N-Linked / Complex / Structure 10145
- N-Linked / Complex / Structure 10292
- N-Linked / Complex / Structure 10885
- N-Linked / Complex / Structure 10902
- N-Linked / Complex / Structure 10945
- N-Linked / Complex / Structure 10988
- N-Linked / Complex / Structure 11227
- N-Linked / Complex / Structure 11415
- N-Linked / Complex / Structure 11501
- N-Linked / Complex / Structure 11538
- N-Linked / Complex / Structure 11709
- N-Linked / Complex / Structure 11801
- N-Linked / Complex / Structure 11822
- N-Linked / Hybrid / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 11918
Reported structure
- Hex:4 HexNAc:5 (avg mass : 1682.5599 )
Composition
- Alzheimer's disease (DOID:10652)
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Gaucher Disease (DOID:1926)
- Melanoma (DOID:1909)
- Middle East respiratory syndrome (DOID:0080642)
- Mild Cognitive Impairment (DOID:0080832)
- Multiple myeloma (DOID:9538)
- Prostate cancer (DOID:10283)
- Schizophrenia (DOID:5419)
Disease
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
- Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- CSF N-glycoproteomics for early diagnosis in Alzheimer's disease (2016 - Palmigiano A, Barone R, Sturiale L, Sanfilippo C, Bua RO, Romeo DA, Messina A, Capuana ML, Maci T, Le Pira F, Zappia M, Garozzo D) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
Reference
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Calumenin / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-6(VI) chain / Homo sapiens
- Decorin / Homo sapiens
- Fibronectin / Homo sapiens
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens
- Undefined site
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Asn-144
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-316
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Undefined site
- Asn-180
-
Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
- Undefined site
- Neural cell adhesion molecule L1 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Prolargin / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- Translocon-associated protein subunit alpha / Homo sapiens
- Uromodulin / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
- Lactotransferrin / Bos taurus
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Uncharacterized protein from Milk / Bos taurus
- Undefined site
- T-cell immunomodulatory protein / Mus musculus
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- Asn-293
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- NSGALTSGVHTFPAVLQSSGLY (22aa)
- ALHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLR (36aa)
- WFSAGLASNSSWLREK (16aa)
- FSNVTWF (7aa)
- NKSVLLGR (8aa)
- NK (2aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- RIIVPLNNRENISDPTSPLRTRF (23aa)
- IIVPINNRENISDPTSPIR (19aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- AIVNFTR (7aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- GTFTDCALANMTEQIR (16aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- P01877 Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
- P01876 Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01877 Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
- P01876 Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
- HKNNK (5aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- SSANNCTF (8aa)
- DAVAFTCEPETQNTTYLWWVNGQSLPVSPR (30aa)
- EEQFNSTFR (9aa)
- IYVIDGTQNDTAFVFPR (17aa)
- EEQYNSTYR (9aa)
- CRGLVGSKNVSSE (13aa)
- TKPREEQYNSTYR (13aa)
- EEQYNSTYR (10aa)
- TPLTANITK (9aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- NTTGFK (6aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- KYNENGTIT (9aa)
- FLLKYNENGTIT (12aa)
- NSFNISNLLVLHLSHNR (17aa)
- YNLT (4aa)
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- GNTTTLISENGHAADTLTATNFR (23aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- NVTIMANLK (9aa)
- RHEEGHMINCTCFGQGR (17aa)
- LYQDVNCT (8aa)
- NATLAEQAK (9aa)
- CDQCEENYFYNR (12aa)
- VVNSTTGPGEHIR (13aa)
- VVNSTTGPGEHL (12aa)
- VVNSTTGTGEHIR (13aa)
- VPAQEKNF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- NLQVYNATSNSLTVK (15aa)
- AEFNLTTYR (9aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Control/Healthy
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Electric Organ (UBERON_0006869)
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Mammary Gland (UBERON_0001911)
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Glomerular Basement Membrane (UBERON_0005777)
- Yolk (GO_0060417)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Mammary Gland (UBERON_0001911)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Urine (UBERON_0001088)
- Melanoma (DOID:1909)
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Glomerular Basement Membrane (UBERON_0005777)
- Liver (UBERON_0002107)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Yolk (GO_0060417)
- Alzheimer's disease (DOID:10652)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- Mild Cognitive Impairment (DOID:0080832)
- Multiple myeloma (DOID:9538)
- Schizophrenia (DOID:5419)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- CSF N-glycoproteomics for early diagnosis in Alzheimer's disease (2016 - Palmigiano A, Barone R, Sturiale L, Sanfilippo C, Bua RO, Romeo DA, Messina A, Capuana ML, Maci T, Le Pira F, Zappia M, Garozzo D) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-316
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Colostrum (UBERON_0001914)
- Control/Healthy
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Asn-144
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- P01877 Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
- P01876 Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01877 Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
- P01876 Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
- EEQFNSTFR (9aa)
- CRGLVGSKNVSSE (13aa)
- TKPREEQYNSTYR (13aa)
- EEQYNSTYR (10aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Spleen (UBERON_0002106)
- Gaucher Disease (DOID:1926)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
-
Uncharacterized protein from Milk / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Microsome (GO_0005792)
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- COVID-19 (DOID:0080600)
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- RIIVPLNNRENISDPTSPLRTRF (23aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Colostrum (UBERON_0001914)
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Colostrum (UBERON_0001914)
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Control/Healthy
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Blood Plasma (UBERON_0001969)
- Multiple myeloma (DOID:9538)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Blood Plasma (UBERON_0001969)
- Multiple myeloma (DOID:9538)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- HEK293-F (CVCL_6642)
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
- Undefined site
- NSGALTSGVHTFPAVLQSSGLY (22aa)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- HEK293 (CVCL_0045)
-
High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
-
- N-Linked / Complex
(avg mass : 1682.5599)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Schizophrenia (DOID:5419)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- HEK293SF-3F6 (CVCL_4V95)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Alzheimer's disease (DOID:10652)
-
- N-Linked / Hybrid
(avg mass : 1682.5599)
- Egg Cell
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1682.5599)
- Cerebellum (UBERON_0002037)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Striatum (UBERON_0002345)
-
- Hex:4 HexNAc:5 / N-Linked
(avg mass : 1682.5599)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 824
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2104
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9418
- N-Linked / Complex / Structure 9554
- N-Linked / Complex / Structure 9716
- N-Linked / Complex / Structure 10021
- N-Linked / Complex / Structure 10145
- N-Linked / Complex / Structure 10292
- N-Linked / Complex / Structure 10885
- N-Linked / Complex / Structure 10902
- N-Linked / Complex / Structure 10945
- N-Linked / Complex / Structure 10988
- N-Linked / Complex / Structure 11227
- N-Linked / Complex / Structure 11415
- N-Linked / Complex / Structure 11501
- N-Linked / Complex / Structure 11538
- N-Linked / Complex / Structure 11709
- N-Linked / Complex / Structure 11801
- N-Linked / Complex / Structure 11822
- N-Linked / Hybrid / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 11918
- Ovalbumin / Gallus gallus
- YNLT (4aa)
-
- Hex:4 HexNAc:5 / N-Linked
(avg mass : 1682.5599)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 824
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2104
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9418
- N-Linked / Complex / Structure 9554
- N-Linked / Complex / Structure 9716
- N-Linked / Complex / Structure 10021
- N-Linked / Complex / Structure 10145
- N-Linked / Complex / Structure 10292
- N-Linked / Complex / Structure 10885
- N-Linked / Complex / Structure 10902
- N-Linked / Complex / Structure 10945
- N-Linked / Complex / Structure 10988
- N-Linked / Complex / Structure 11227
- N-Linked / Complex / Structure 11415
- N-Linked / Complex / Structure 11501
- N-Linked / Complex / Structure 11538
- N-Linked / Complex / Structure 11709
- N-Linked / Complex / Structure 11801
- N-Linked / Complex / Structure 11822
- N-Linked / Hybrid / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 11918
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Calumenin / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-6(VI) chain / Homo sapiens
- Decorin / Homo sapiens
- Fibronectin / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Prolargin / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Uromodulin / Homo sapiens
- Lactotransferrin / Bos taurus
- T-cell immunomodulatory protein / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- ALHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLR (36aa)
- WFSAGLASNSSWLREK (16aa)
- FSNVTWF (7aa)
- IIVPINNRENISDPTSPIR (19aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- AIVNFTR (7aa)
- IVNNATNVVIKVCEF (15aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- GTFTDCALANMTEQIR (16aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- P01877 Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
- P01876 Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01877 Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
- P01876 Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
- HKNNK (5aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- SSANNCTF (8aa)
- DAVAFTCEPETQNTTYLWWVNGQSLPVSPR (30aa)
- EEQFNSTFR (9aa)
- IYVIDGTQNDTAFVFPR (17aa)
- EEQYNSTYR (9aa)
- TPLTANITK (9aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- NTTGFK (6aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- KYNENGTIT (9aa)
- FLLKYNENGTIT (12aa)
- NSFNISNLLVLHLSHNR (17aa)
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- GNTTTLISENGHAADTLTATNFR (23aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- NVTIMANLK (9aa)
- RHEEGHMINCTCFGQGR (17aa)
- LYQDVNCT (8aa)
- NATLAEQAK (9aa)
- CDQCEENYFYNR (12aa)
- VVNSTTGPGEHIR (13aa)
- VVNSTTGPGEHL (12aa)
- VVNSTTGTGEHIR (13aa)
- VPAQEKNF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- NLQVYNATSNSLTVK (15aa)
- AEFNLTTYR (9aa)
-
- Hex:4 HexNAc:5 / Undefined type
(avg mass : 1682.5599)
- HEK293 (CVCL_0045)
-
Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012
- Undefined site
Source
Suggested structure
Reported glycosite
- Hex:4 HexNAc:5 / Undefined type
(avg mass : 1682.5599)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:5 / N-Linked
(avg mass : 1682.5599)
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:5 / N-Linked
(avg mass : 1682.5599)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1682.5599)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1682.5599)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1682.5599)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)