Hex:2 HexNAc:3 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Macaca radiata (Bonnet macaque)
• Sus scrofa (Pig)
• Bombina variegata (Yellow-bellied toad)

Protein

• Fibrinogen gamma chain / Homo sapiens    P02679
• Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens    Q96FE7
• Unspecified mucin / Homo sapiens
• Uromodulin / Homo sapiens    P07911
• WAP four-disulfide core domain protein 2 / Homo sapiens    Q14508
• Mucin / Macaca radiata
• Mucin / Sus scrofa
• Mucin / Bombina variegata

Source

• Cervical Mucosa (UBERON_0012248)  
• Pulmonary Mucosa  
• Trachea (UBERON_0003126)  
• Urine (UBERON_0001088)  
• Egg Cell   Jelly Coat  

Reported structure

• O-Linked / Core 2 / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / GlcNAc(b1-3)[Fuc(a1-4)]GlcNAc(b1-6)[Gal(b1-4)[NeuAc(a2-3)]Gal(b1-3)]GalNAc
• O-Linked / Core 2 / GlcNAc(b1-3)[NeuAc(a2-6)]Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / NeuAc(a2-3)[GalNAc(b1-4)Gal(b1-4)]GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
• O-Linked / Core 4 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 4 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 4 / NeuAc(a2-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-3)]GalNAc
• O-Linked / Undefined core / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(?1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc

Composition

• Hex:2 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1389.286 )

Disease

• Bronchiectasis, due to Kartagener's Syndrome
• Bronchitis, Chronic (DOID:6132)
• Cystic Fibrosis (DOID:1485)
• Prostate cancer (DOID:10283)

Reference

• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Comparative study of carbohydrate chains released from the oviducal mucins of the two very closely related amphibian species Bombina bombina and Bombina variegata. (2003 - Coppin A, Florea D, Maes E, Cogálniceanu D, Strecker G) / Status : Reviewed
• Structures of monosialyl oligosaccharides isolated from the respiratory mucins of a non-secretor (O, Lea+b-) patient suffering from chronic bronchitis. Characterization of a novel type of mucin carbohydrate core structure. (1994 - van Halbeek H, Strang A, Lhermitte M, Rahmoune H, Lamblin G, Roussel P) / Status : Reviewed
• Studies on cervical glycoproteins: isolation and characterisation of oligosaccharides from luteal phase cervical glycoproteins of bonnet monkey. (1993 - Nasir-Ud-Din , Walker-Nasir E, Fayyaz-Ud-Din) / Status : Reviewed
• Isolation and structural characterization of novel sialylated oligosaccharide-alditols from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1993 - Klein A, Carnoy C, Lamblin G, Roussel P, van Kuik J, Vliegenthart J) / Status : Reviewed
• Isolation and structural characterization of low-molecular-mass monosialyl oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1988 - van Halbeek H, Breg J, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
• Structure of acidic oligosaccharides isolated from pronase-treated glycoprotein of bonnet-monkey (Macaca radiata) cervical mucus. (1987 - Nasir-ud-Din ) / Status : Reviewed
• Structure of sialyl-oligosaccharides isolated from bronchial mucus glycoproteins of patients (blood group O) suffering from cystic fibrosis. (1987 - Breg J, Van Halbeek H, Vliegenthart J, Lamblin G, Houvenaghel M, Roussel P) / Status : Reviewed
• Structures of the sialylated oligosaccharide chains in swine tracheal mucin glycoproteins. (1987 - Rana SS, Chandrasekaran EV, Mendicino J) / Status : Reviewed
• Structure of sialyloligosaccharides isolated from bonnet monkey (Macaca radiata) cervical mucus glycoproteins exhibiting multiple blood group activities. (1986 - Nasir-Ud-Din , Jeanloz R, Lamblin G, Roussel P, van Halbeek H, Mutsaers J, Vliegenthart J) / Status : Reviewed
• Primary structure determination of five sialylated oliogsaccharides derived from bronchial mucus glycoproteins of patients suffering from cystic fibrosis. The occurrence of the NeuAc alpha(2---3)Gal beta(1---4)[Fuc alpha(1---3)] GlcNAc beta(1---.) structural element revealed by 500-MHz 1H NMR spectr (1984 - Lamblin G, Boersma A, Klein A, Roussel P, van Halbeek H, Vliegenthart J) / Status : Reviewed

Reported glycosite

• Fibrinogen gamma chain / Homo sapiens
  •        Ser-68
• Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
  •        Ser-58
• Unspecified mucin / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Thr-504
  •        Ser-511
  •        Ser-512
• WAP four-disulfide core domain protein 2 / Homo sapiens
  •        Thr-46
• Mucin / Macaca radiata
  •        Undefined site
• Mucin / Sus scrofa
  •        Undefined site
• Mucin / Bombina variegata
  •        Undefined site

Mass spectrometry observed peptide

• TGVCPELQADQNCTQECVSDSECADNLK (28aa)
  •    Q14508    Thr-46
• CLNWLDAQSGLASAPVSGAGNHSYCRNPDEDPR (33aa)
  •    Q96FE7    Ser-58
• DLQSLEDILHQVENKTSEVK (20aa)
  •    P02679    Ser-68
• FALLMTNCYATPSSNATDPLKYFIIQDR (28aa)
  •    P07911    Ser-512
• FALLMTNCYATPSSNATDPLKYFIIQDR (28aa)
  •    P07911    Thr-504
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Ser-511