GlyConnect

Export CSV

taxonomy (4) protein (9) source (6) structure (12) composition (1) disease (5) reference (14) site (11) peptide (6)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:2 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1389.286 )

Disease

Reference

Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Unreviewed
Novel O-linked sialoglycan structures in human urinary glycoproteins (2020 - Adam Pap, Ervin Tasnadi, Katalin F. Medzihradszky, Zsuzsanna Darula ) / Status : Reviewed
Extended Sialylated O-Glycan Repertoire of Human Urinary Glycoproteins Discovered and Characterized Using Electron-Transfer/Higher-Energy Collision Dissociation (2019 - Zsuzsanna Darula, Ádám Pap, Katalin F. Medzihradszky) / Status : Reviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Comparative study of carbohydrate chains released from the oviducal mucins of the two very closely related amphibian species Bombina bombina and Bombina variegata. (2003 - Coppin A, Florea D, Maes E, CogÃ¡lniceanu D, Strecker G) / Status : Reviewed
Structures of monosialyl oligosaccharides isolated from the respiratory mucins of a non-secretor (O, Lea+b-) patient suffering from chronic bronchitis. Characterization of a novel type of mucin carbohydrate core structure. (1994 - van Halbeek H, Strang A, Lhermitte M, Rahmoune H, Lamblin G, Roussel P) / Status : Reviewed
Isolation and structural characterization of novel sialylated oligosaccharide-alditols from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1993 - Klein A, Carnoy C, Lamblin G, Roussel P, van Kuik J, Vliegenthart J) / Status : Reviewed
Studies on cervical glycoproteins: isolation and characterisation of oligosaccharides from luteal phase cervical glycoproteins of bonnet monkey. (1993 - Nasir-Ud-Din , Walker-Nasir E, Fayyaz-Ud-Din) / Status : Reviewed
Isolation and structural characterization of low-molecular-mass monosialyl oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1988 - van Halbeek H, Breg J, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
Structure of sialyl-oligosaccharides isolated from bronchial mucus glycoproteins of patients (blood group O) suffering from cystic fibrosis. (1987 - Breg J, Van Halbeek H, Vliegenthart J, Lamblin G, Houvenaghel M, Roussel P) / Status : Reviewed
Structure of acidic oligosaccharides isolated from pronase-treated glycoprotein of bonnet-monkey (Macaca radiata) cervical mucus. (1987 - Nasir-ud-Din ) / Status : Reviewed
Structures of the sialylated oligosaccharide chains in swine tracheal mucin glycoproteins. (1987 - Rana SS, Chandrasekaran EV, Mendicino J) / Status : Reviewed
Structure of sialyloligosaccharides isolated from bonnet monkey (Macaca radiata) cervical mucus glycoproteins exhibiting multiple blood group activities. (1986 - Nasir-Ud-Din , Jeanloz R, Lamblin G, Roussel P, van Halbeek H, Mutsaers J, Vliegenthart J) / Status : Reviewed
Primary structure determination of five sialylated oliogsaccharides derived from bronchial mucus glycoproteins of patients suffering from cystic fibrosis. The occurrence of the NeuAc alpha(2---3)Gal beta(1---4)[Fuc alpha(1---3)] GlcNAc beta(1---.) structural element revealed by 500-MHz 1H NMR spectr (1984 - Lamblin G, Boersma A, Klein A, Roussel P, van Halbeek H, Vliegenthart J) / Status : Reviewed

Reported glycosite

Fibrinogen gamma chain / Homo sapiens
- Ser-68
Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
- Ser-58
Protein YIPF3 / Homo sapiens
- Thr-346
Unspecified mucin / Homo sapiens
- Undefined site
Uromodulin / Homo sapiens
- Thr-504
- Ser-511
- Ser-512
WAP four-disulfide core domain protein 2 / Homo sapiens
- Thr-46
Mucin / Macaca radiata
- Undefined site
Mucin / Sus scrofa
- Undefined site
Mucin / Bombina variegata
- Undefined site

Mass spectrometry observed peptide

TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- Q14508 Thr-46 WAP four-disulfide core domain protein 2 / Homo sapiens
CLNWLDAQSGLASAPVSGAGNHSYCRNPDEDPR (33aa)
- Q96FE7 Ser-58 Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
DLQSLEDILHQVENKTSEVK (20aa)
- P02679 Ser-68 Fibrinogen gamma chain / Homo sapiens
AVAVTLQSH (9aa)
- Q9GZM5 Thr-346 Protein YIPF3 / Homo sapiens
FALLMTNCYATPSSNATDPLK (21aa)
- P07911 Ser-511 Uromodulin / Homo sapiens
FALLMTNCYATPSSNATDPLKYFIIQDR (28aa)
- P07911 Ser-512 Uromodulin / Homo sapiens
- P07911 Thr-504 Uromodulin / Homo sapiens

- O-Linked / Core 2 (avg mass : 1389.286)
- O-Linked / Core 2 (avg mass : 1389.286)
- O-Linked / Core 2 (avg mass : 1389.286)
- O-Linked / Core 2 (avg mass : 1389.286)
- O-Linked / Core 2 (avg mass : 1389.286)
- O-Linked / Core 2 (avg mass : 1389.286)
- O-Linked / Core 2 (avg mass : 1389.286)
- O-Linked / Core 2 (avg mass : 1389.286)
- O-Linked / Core 4 (avg mass : 1389.286)
- O-Linked / Core 4 (avg mass : 1389.286)
- O-Linked / Core 4 (avg mass : 1389.286)
- O-Linked / Undefined core (avg mass : 1389.286)

- Hex:2 HexNAc:3 dHex:1 NeuAc:1 / O-Linked (avg mass : 1389.286)