GlyConnect

taxonomy (13) protein (54) source (22) structure (13) composition (1) disease (9) reference (35) site (65) peptide (22)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:5 HexNAc:5 (avg mass : 1844.7023 )

Disease

Reference

Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
Carbohydrate structures of human alpha-fetoprotein of patients with hepatocellular carcinoma: presence of fucosylated and non-fucosylated triantennary glycans. (1993 - Aoyagi Y, Suzuki Y, Igarashi K, Saitoh A, Oguro M, Yokota T, Mori S, Suda T, Isemura M, Asakura H) / Status : Reviewed
Comparative studies of asparagine-linked sugar chains of immunoglobulin G from eleven mammalian species. (1993 - Hamako J, Matsui T, Ozeki Y, Mizuochi T, Titani K) / Status : Reviewed
Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed

Reported glycosite

Alpha-fetoprotein / Homo sapiens
- Undefined site
Asporin / Homo sapiens
- Asn-282
Biglycan / Homo sapiens
- Asn-270
CD59 glycoprotein / Homo sapiens
- Asn-43
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
Collagen alpha-1(XII) chain / Homo sapiens
- Asn-1763
Collagen alpha-2(VI) chain / Homo sapiens
- Asn-140
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
- Asn-623
Erythropoietin / Homo sapiens
- Asn-51
Fibrillin-1 / Homo sapiens
- Asn-2178
Fibronectin / Homo sapiens
- Asn-528
Immunoglobulin epsilon chain c region / Homo sapiens
- Asn-21
- Asn-49
- Asn-99
- Asn-146
- Asn-252
Immunoglobulin gamma / Homo sapiens
- Undefined site
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Asn-144
- Asn-340
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Asn-131
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Asn-180
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Asn-176
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Asn-322
Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Asn-177
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Asn-46
- Asn-209
Immunoglobulin j chain / Homo sapiens
- Asn-71
Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Asn-81
Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Asn-356
Polymeric immunoglobulin receptor / Homo sapiens
- Asn-469
Prostaglandin-h2 d-isomerase / Homo sapiens
- Asn-51
- Ser-67
- Asn-78
Prostate-specific antigen (psa-1) / Homo sapiens
- Asn-69
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
Tetraspanin-3 / Homo sapiens
- Asn-127
Thrombospondin-1 / Homo sapiens
- Asn-360
- Asn-1067
Von willebrand factor / Homo sapiens
- Undefined site
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
Immunoglobulin gamma / Bos taurus
- Undefined site
Immunoglobulin gamma / Canis familiaris
- Undefined site
Immunoglobulin gamma / Capra hircus
- Undefined site
Immunoglobulin gamma / Cavia porcellus
- Undefined site
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
Immunoglobulin gamma / Ovis aries
- Undefined site
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
Immunoglobulin gamma / Rattus norvegicus
- Undefined site
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
Coagulation factor VIII / Sus scrofa
- Undefined site
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
Immunoglobulin gamma / Gallus gallus
- Undefined site
Immunoglobulin y / Gallus gallus
- Undefined site
Ovalbumin / Gallus gallus
- Undefined site
Ovomucoid / Gallus gallus
- Undefined site
Riboflavin-binding protein / Gallus gallus
- Undefined site
Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Asn-496

Mass spectrometry observed peptide

TAVNCSSDFDACLITK (16aa)
- P13987 Asn-43
SVVAPATDGGLNLTSTFLRK (20aa)
- P41222 Ser-67
SVVAPATDGGLNLTSTFLR (19aa)
- P41222 Asn-78
IIVPINNRENISDPTSPIR (19aa)
- P01591 Asn-71
LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- P01877 Asn-131
LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- P01876 Asn-144
GTFTDCALANMTEQIR (16aa)
- P12110 Asn-140
EEQYNSTYR (9aa)
- P01857 Asn-180
EEQYNSTY (8aa)
- P01857 Asn-180
GLTFQQNASSMCVPDQDTAIR (21aa)
- P01871 Asn-209
GITFQQNASSMCVPDQDTAIR (21aa)
- P01871 Asn-209
MIENGSISFIPTIR (14aa)
- P21810 Asn-270
ITDIENGSIANIPR (14aa)
- Q9BXN1 Asn-282
GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- P01860 Asn-322
LAGKPTHVNVSVVMAEVDGTC (21aa)
- P01876 Asn-340
VQPFNVTQGK (10aa)
- P13473 Asn-356
VSCPIMPCSNATVPDGECCPR (21aa)
- P07996 Asn-360
VPGNVTAVIGETIK (14aa)
- P01833 Asn-469
DQCIVDDITYNVNDTFHK (18aa)
- P02751 Asn-528
TTIVDNNTWNNSHIAIVGK (19aa)
- Q8TCJ2 Asn-623
VVNSTTGPGEHIR (13aa)
- P07996 Asn-1067
NLQVYNATSNSLTVK (15aa)
- Q99715 Asn-1763
CECPFGYILAGNECVDTDECSVGNPCGNGTCK (32aa)
- P35555 Asn-2178

- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- O-Linked / Core 2 (avg mass : 1844.7023)
- N-Linked / Hybrid (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Hybrid (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)

- Hex:5 HexNAc:5 / N-Linked (avg mass : 1844.7023)
- Hex:5 HexNAc:5 / O-Linked (avg mass : 1844.7023)