taxonomy (15)
protein (71)
source (36)
structure (18)
composition (1)
disease (18)
reference (62)
site (102)
peptide (49)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis lupus familiaris (Dog)
- Capra hircus (Goat)
- Cavia porcellus (Domestic guinea pig)
- Oryctolagus cuniculus (Rabbit)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Human immunodeficiency virus type 1 (HIV-1)
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-fetoprotein / Homo sapiens P02771
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Asporin / Homo sapiens Q9BXN1
- Biglycan / Homo sapiens P21810
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- CD59 glycoprotein / Homo sapiens P13987
- Choriogonadotropin - alpha and beta chains / Homo sapiens P0DN86 P01215
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens Q8TCJ2
- Erythropoietin / Homo sapiens P01588
- Fibrillin-1 / Homo sapiens P35555
- Fibronectin / Homo sapiens P02751
- Haptoglobin / Homo sapiens P00738
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Lactotransferrin / Homo sapiens P02788
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Tetraspanin-3 / Homo sapiens O60637
- Thrombospondin-1 / Homo sapiens P07996
- Von willebrand factor / Homo sapiens P04275
- Collagen alpha-1(IV) chain / Bos taurus Q7SIB2
- Collagen alpha-2 (IV) chain / Bos taurus Q7SIB3
- Immunoglobulin gamma / Bos taurus
- Immunoglobulin gamma / Canis lupus familiaris
- Immunoglobulin gamma / Capra hircus
- Immunoglobulin gamma / Cavia porcellus
- Immunoglobulin gamma / Oryctolagus cuniculus
- Immunoglobulin gamma / Ovis aries
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Immunoglobulin gamma / Rattus norvegicus
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Coagulation factor VIII / Sus scrofa P12263
- Immunoglobulin y / Coturnix coturnix japonica
- Immunoglobulin gamma / Gallus gallus
- Immunoglobulin y / Gallus gallus
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Ascitic fluid (UBERON_0007795)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Glomerular Basement Membrane (UBERON_0005777)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- Prefrontal Cortex (UBERON:0000451)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- 3Y1-B clone 1 (CVCL_4563)
- CE (CVCL_6D96)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- HEK293SF-3F6 (CVCL_4V95)
- LS174T (CVCL_1384)
- RPMI-1788 (CVCL_2710) B-Lymphocyte (CL_0000236)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Leukocyte (CL_0000738)
- Lymphocyte (CL_0000542)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1147
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 1586
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 2950
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9474
- N-Linked / Complex / Structure 9726
- N-Linked / Complex / Structure 11453
- N-Linked / Complex / Structure 11728
- N-Linked / Complex / Structure 11799
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
Reported structure
- Hex:5 HexNAc:5 (avg mass : 1844.7023 )
Composition
- Alzheimer's disease (DOID:10652)
- Amyotrophic lateral sclerosis (DOID:0080917)
- Cancer, breast (DOID:1612)
- Carcinoma, Gallbladder which metastasises to the liver (DOID:4948)
- Carcinoma, Hepatocellular (DOID:684)
- Choriocarcinoma (DOID:3594)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Mild Cognitive Impairment (DOID:0080832)
- Multiple myeloma (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Prostate cancer (DOID:10283)
- Systemic lupus erythematosus (DOID:9074)
Disease
- Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Exploring Cerebrospinal Fluid IgG N-Glycosylation as Potential Biomarker for Amyotrophic Lateral Sclerosis (2019 - Costa J, Streich L, Pinto S, Pronto-Laborinho A, Nimtz M, Conradt HS, de Carvalho M) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- CSF N-glycoproteomics for early diagnosis in Alzheimer's disease (2016 - Palmigiano A, Barone R, Sturiale L, Sanfilippo C, Bua RO, Romeo DA, Messina A, Capuana ML, Maci T, Le Pira F, Zappia M, Garozzo D) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
- Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Carbohydrate structures of human alpha-fetoprotein of patients with hepatocellular carcinoma: presence of fucosylated and non-fucosylated triantennary glycans. (1993 - Aoyagi Y, Suzuki Y, Igarashi K, Saitoh A, Oguro M, Yokota T, Mori S, Suda T, Isemura M, Asakura H) / Status : Reviewed
- Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
- Comparative studies of asparagine-linked sugar chains of immunoglobulin G from eleven mammalian species. (1993 - Hamako J, Matsui T, Ozeki Y, Mizuochi T, Titani K) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
Reference
-
Alpha-fetoprotein / Homo sapiens
- Undefined site
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- CD59 glycoprotein / Homo sapiens
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Haptoglobin / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Asn-144
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Asn-131
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-367
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Tetraspanin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Capra hircus
- Undefined site
-
Immunoglobulin gamma / Cavia porcellus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Immunoglobulin gamma / Rattus norvegicus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Coagulation factor VIII / Sus scrofa
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- Asn-293
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- TAVNCSSDFDACLITK (16aa)
- FSNVTWF (7aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- NKSVLLGR (8aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- ENISDPTSPLR (11aa)
- IIVPINNRENISDPTSPIR (19aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR (38aa)
- TQSLLIVNNATNVVIK (16aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- GTFTDCALANMTEQIR (16aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- VCEFQFCNDPFLGVYYHKNNK (21aa)
- VYSSANNCTFE (11aa)
- EEQYNSTYR (9aa)
- KTKPREEQYNSTYRV (15aa)
- TKPREEQYNSTYR (13aa)
- EEQYNSTY (8aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- KNLFLNHSENATAKD (15aa)
- MIENGSISFIPTIR (14aa)
- ITDIENGSIANIPR (14aa)
- YNLT (4aa)
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- FPNITNLCPFGE (12aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- VPGNVTAVIGETIK (14aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- DQCIVDDITYNVNDTFHK (18aa)
- LYQDVNCT (8aa)
- TTIVDNNTWNNSHIAIVGK (19aa)
- NFTIS (5aa)
- FGGFNFS (7aa)
- VVNSTTGPGEHIR (13aa)
- NGTHWFVT (8aa)
- KNH (3aa)
- KYFKNHTS (8aa)
- NLQVYNATSNSLTVK (15aa)
- CECPFGYILAGNECVDTDECSVGNPCGNGTCK (32aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Microsome (GO_0005792)
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Ascitic fluid (UBERON_0007795)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Glomerular Basement Membrane (UBERON_0005777)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- CE (CVCL_6D96)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Leukocyte (CL_0000738)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
- Alzheimer's disease (DOID:10652)
- Amyotrophic lateral sclerosis (DOID:0080917)
- Carcinoma, Gallbladder which metastasises to the liver (DOID:4948)
- Carcinoma, Hepatocellular (DOID:684)
- Choriocarcinoma (DOID:3594)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Mild Cognitive Impairment (DOID:0080832)
- Multiple myeloma (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Exploring Cerebrospinal Fluid IgG N-Glycosylation as Potential Biomarker for Amyotrophic Lateral Sclerosis (2019 - Costa J, Streich L, Pinto S, Pronto-Laborinho A, Nimtz M, Conradt HS, de Carvalho M) / Status : Reviewed
- CSF N-glycoproteomics for early diagnosis in Alzheimer's disease (2016 - Palmigiano A, Barone R, Sturiale L, Sanfilippo C, Bua RO, Romeo DA, Messina A, Capuana ML, Maci T, Le Pira F, Zappia M, Garozzo D) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
- Comparative studies of asparagine-linked sugar chains of immunoglobulin G from eleven mammalian species. (1993 - Hamako J, Matsui T, Ozeki Y, Mizuochi T, Titani K) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Carbohydrate structures of human alpha-fetoprotein of patients with hepatocellular carcinoma: presence of fucosylated and non-fucosylated triantennary glycans. (1993 - Aoyagi Y, Suzuki Y, Igarashi K, Saitoh A, Oguro M, Yokota T, Mori S, Suda T, Isemura M, Asakura H) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
-
Alpha-fetoprotein / Homo sapiens
- Undefined site
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-367
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Capra hircus
- Undefined site
-
Immunoglobulin gamma / Cavia porcellus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Immunoglobulin gamma / Rattus norvegicus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Coagulation factor VIII / Sus scrofa
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- Systemic lupus erythematosus (DOID:9074)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Asn-144
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Immunoglobulin J chain / Homo sapiens
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- ENISDPTSPLR (11aa)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- FPNITNLCPFGE (12aa)
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Lymphocyte (CL_0000542)
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1844.7023)
- 3Y1-B clone 1 (CVCL_4563)
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Control/Healthy
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Lymphocyte (CL_0000542)
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Haptoglobin / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- KDTRNESTQNCVVAEPEKM (19aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- KTKPREEQYNSTYRV (15aa)
- KNLFLNHSENATAKD (15aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
-
- N-Linked / Complex
(avg mass : 1844.7023)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- HEK293SF-3F6 (CVCL_4V95)
- Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- TKPREEQYNSTYR (13aa)
-
- N-Linked / Complex
(avg mass : 1844.7023)
-
- N-Linked / Complex
(avg mass : 1844.7023)
-
- N-Linked / Hybrid
(avg mass : 1844.7023)
- Egg Cell
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1844.7023)
- Egg Cell
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1844.7023)
- Leukocyte (CL_0000738)
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
- Hex:5 HexNAc:5 / N-Linked
(avg mass : 1844.7023)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1147
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 1586
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 2950
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9474
- N-Linked / Complex / Structure 9726
- N-Linked / Complex / Structure 11453
- N-Linked / Complex / Structure 11728
- N-Linked / Complex / Structure 11799
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Ovalbumin / Gallus gallus
- YNLT (4aa)
-
- Hex:5 HexNAc:5 / N-Linked
(avg mass : 1844.7023)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Mammary Gland (UBERON_0001911)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1147
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 1586
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 2950
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9474
- N-Linked / Complex / Structure 9726
- N-Linked / Complex / Structure 11453
- N-Linked / Complex / Structure 11728
- N-Linked / Complex / Structure 11799
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- CD59 glycoprotein / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- TAVNCSSDFDACLITK (16aa)
- FSNVTWF (7aa)
- NKSVLLGR (8aa)
- IIVPINNRENISDPTSPIR (19aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- GTFTDCALANMTEQIR (16aa)
- VCEFQFCNDPFLGVYYHKNNK (21aa)
- EEQYNSTYR (9aa)
- EEQYNSTY (8aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- MIENGSISFIPTIR (14aa)
- ITDIENGSIANIPR (14aa)
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- VPGNVTAVIGETIK (14aa)
- DQCIVDDITYNVNDTFHK (18aa)
- LYQDVNCT (8aa)
- TTIVDNNTWNNSHIAIVGK (19aa)
- NFTIS (5aa)
- FGGFNFS (7aa)
- VVNSTTGPGEHIR (13aa)
- NGTHWFVT (8aa)
- KNH (3aa)
- KYFKNHTS (8aa)
- NLQVYNATSNSLTVK (15aa)
- CECPFGYILAGNECVDTDECSVGNPCGNGTCK (32aa)
-
- Hex:5 HexNAc:5 / O-Linked
(avg mass : 1844.7023)
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- Prostate cancer (DOID:10283)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Suggested structure
Disease
Reference
- Hex:5 HexNAc:5 / O-Linked
(avg mass : 1844.7023)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:5 / N-Linked
(avg mass : 1844.7023)
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:5 / N-Linked
(avg mass : 1844.7023)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1844.7023)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1844.7023)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1844.7023)
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)