Hex:5 HexNAc:5

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Canis familiaris (Dog)
• Capra hircus (Goat)
• Cavia porcellus (Domestic guinea pig)
• Oryctolagus cuniculus (Rabbit)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Coturnix coturnix japonica (Japanese quail)
• Gallus gallus (Chicken)
• Human immunodeficiency virus type 1 (lw12.3 isolate)
• Influenza a virus (strain a/fowl plague virus/rostock/34)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-fetoprotein / Homo sapiens    P02771
• Asporin / Homo sapiens    Q9BXN1
• Biglycan / Homo sapiens    P21810
• CD59 glycoprotein / Homo sapiens    P13987
• Choriogonadotropin - alpha and beta chains / Homo sapiens    P01215    P0DN86
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens    Q8TCJ2
• Erythropoietin / Homo sapiens    P01588
• Fibrillin-1 / Homo sapiens    P35555
• Fibronectin / Homo sapiens    P02751
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01857    P01860    P01861    P01859
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin j chain / Homo sapiens    P01591
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens    Q9BYF1
• Tetraspanin-3 / Homo sapiens    O60637
• Thrombospondin-1 / Homo sapiens    P07996
• Von willebrand factor / Homo sapiens    P04275
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Immunoglobulin gamma / Bos taurus
• Immunoglobulin gamma / Canis familiaris
• Immunoglobulin gamma / Capra hircus
• Immunoglobulin gamma / Cavia porcellus
• Immunoglobulin gamma / Oryctolagus cuniculus
• Immunoglobulin gamma / Ovis aries
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Immunoglobulin gamma / Rattus norvegicus
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Coagulation factor VIII / Sus scrofa    P12263
• Immunoglobulin y / Coturnix coturnix japonica
• Immunoglobulin gamma / Gallus gallus
• Immunoglobulin y / Gallus gallus
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)    Q70626
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)    P03459
• Recombinant Spike glycoprotein (FreeStyle 293-F) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Ascitic fluid (UBERON_0007795)  
• Blood (UBERON_0000178)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Mammary Gland (UBERON_0001911)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Placenta (UBERON_0001987)   JEG-3 (CVCL_0363)   Epithelium (CL_0002577)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• 3Y1-B clone 1 (CVCL_4563)  
• CE (CVCL_6D96)  
• FreeStyle 293-F (CVCL_D603)  
• H9 (CVCL_1240)   Lymphocyte (CL_0000542)  
• HEK293 (CVCL_0045)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  
• Egg Cell  
• Leukocyte (CL_0000738)  
• Lymphocyte (CL_0000542)  
• Cerebrospinal Fluid Secretion (GO_0033326)  
• Microsome (GO_0005792)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 1147
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 1586
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
• N-Linked / Complex / Structure 2950
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc

Composition

• Hex:5 HexNAc:5 (avg mass : 1844.7023 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma, Gallbladder which metastasises to the liver (DOID:4948)
• Carcinoma, Hepatocellular (DOID:684)
• Choriocarcinoma (DOID:3594)
• COVID-19 (DOID:0080600)
• Healthy
• Hyperimmune condition
• Leukemia, Acute lymphoblastic (DOID:9952)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Prostate cancer (DOID:10283)

Reference

• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Unreviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Site-specific analysis of the SARS-CoV-2 glycan shield (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
• Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
• Comparative studies of asparagine-linked sugar chains of immunoglobulin G from eleven mammalian species. (1993 - Hamako J, Matsui T, Ozeki Y, Mizuochi T, Titani K) / Status : Reviewed
• Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
• Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
• Carbohydrate structures of human alpha-fetoprotein of patients with hepatocellular carcinoma: presence of fucosylated and non-fucosylated triantennary glycans. (1993 - Aoyagi Y, Suzuki Y, Igarashi K, Saitoh A, Oguro M, Yokota T, Mori S, Suda T, Isemura M, Asakura H) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed

Reported glycosite

• Alpha-fetoprotein / Homo sapiens
  •        Undefined site
• Asporin / Homo sapiens
  •        Asn-282
• Biglycan / Homo sapiens
  •        Asn-270
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Choriogonadotropin - alpha and beta chains / Homo sapiens
  •        Undefined site
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
  •        Asn-623
• Erythropoietin / Homo sapiens
  •        Asn-51
• Fibrillin-1 / Homo sapiens
  •        Asn-2178
• Fibronectin / Homo sapiens
  •        Asn-528
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-21
  •        Asn-49
  •        Asn-99
  •        Asn-146
  •        Asn-252
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
  •        Asn-322
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-46
  •        Asn-209
• Immunoglobulin j chain / Homo sapiens
  •        Asn-71
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-356
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-469
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Ser-67
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens
  •        Asn-53
  •        Asn-546
  •        Asn-690
• Tetraspanin-3 / Homo sapiens
  •        Asn-127
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Immunoglobulin gamma / Bos taurus
  •        Undefined site
• Immunoglobulin gamma / Canis familiaris
  •        Undefined site
• Immunoglobulin gamma / Capra hircus
  •        Undefined site
• Immunoglobulin gamma / Cavia porcellus
  •        Undefined site
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Immunoglobulin gamma / Ovis aries
  •        Undefined site
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• Immunoglobulin gamma / Rattus norvegicus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Coagulation factor VIII / Sus scrofa
  •        Undefined site
• Immunoglobulin y / Coturnix coturnix japonica
  •        Undefined site
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Immunoglobulin y / Gallus gallus
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)
  •        Undefined site
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
  •        Asn-496
• Recombinant Spike glycoprotein (FreeStyle 293-F) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-615
  •        Asn-717
  •        Asn-801
  •        Asn-1098
  •        Asn-1159
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-615
  •        Asn-657
  •        Asn-709
  •        Asn-717
  •        Asn-1098
  •        Asn-1135
  •        Asn-1159
  •        Asn-1174
  •        Asn-1194

Mass spectrometry observed peptide

• FLVLLPLVSSQCVNLTTR (18aa)
  •    P0DTC2    Asn-17
• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43
• NYNTNITEENVQNMNNAGDK (20aa)
  •    Q9BYF1    Asn-53
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• SNV (3aa)
  •    P0DTC2    Asn-61
• FSNVTWFHAIHVSGTNGTK (19aa)
  •    P0DTC2    Asn-61
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Ser-67
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• IIVPINNRENISDPTSPIR (19aa)
  •    P01591    Asn-71
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74
• NGTKR (5aa)
  •    P0DTC2    Asn-74
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIKVCEFQFCNDP (26aa)
  •    P0DTC2    Asn-122
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01877    Asn-131
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140
• VCEFQFCNDPFLGVYYHKNNK (21aa)
  •    P0DTC2    Asn-149
• FCNDPFLGVYYHKNNK (16aa)
  •    P0DTC2    Asn-149
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• EEQYNSTY (8aa)
  •    P01857    Asn-180
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209
• LPIGINITRFQTLLALHR (18aa)
  •    P0DTC2    Asn-234
• DLPQGFSALEPLVDLPIGINITR (23aa)
  •    P0DTC2    Asn-234
• INITR (5aa)
  •    P0DTC2    Asn-234
• DLPQGFSALEPLVDLPIGINITRFQTLLALHRS (33aa)
  •    P0DTC2    Asn-234
• HTPINLVRDLPQGFSALEPLVDLPIGINITRFQTL (35aa)
  •    P0DTC2    Asn-234
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
  •    P01860    Asn-322
• FPNITNLCPFGEVFNATR (18aa)
  •    P0DTC2    Asn-331
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• PNITN (5aa)
  •    P0DTC2    Asn-331
• GIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNAT (35aa)
  •    P0DTC2    Asn-331
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528
• CDISNSTEAGQK (12aa)
  •    Q9BYF1    Asn-546
• DPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (57aa)
  •    P0DTC2    Asn-615
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615
• TTIVDNNTWNNSHIAIVGK (19aa)
  •    Q8TCJ2    Asn-623
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• NVSDIIPR (8aa)
  •    Q9BYF1    Asn-690
• SIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEIL (37aa)
  •    P0DTC2    Asn-709
• SIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQ (72aa)
  •    P0DTC2    Asn-717
• NFTIS (5aa)
  •    P0DTC2    Asn-717
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• AHFPREGVFVSNGTHWFVTQR (21aa)
  •    P0DTC2    Asn-1098
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098
• NFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELD (46aa)
  •    P0DTC2    Asn-1135
• YFKNHTSPDVDLGDISGINASVVNIQK (27aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGINASVVNI (22aa)
  •    P0DTC2    Asn-1159
• YFKNHTSPD (9aa)
  •    P0DTC2    Asn-1159
• YFKNHTSPDVDLGDISGIN (19aa)
  •    P0DTC2    Asn-1159
• KNH (3aa)
  •    P0DTC2    Asn-1159
• KYFKNHTS (8aa)
  •    P0DTC2    Asn-1159
• TSPDVDLGDISGINASVVNIQK (22aa)
  •    P0DTC2    Asn-1174
• NLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMV (39aa)
  •    P0DTC2    Asn-1194
• NLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCM (46aa)
  •    P0DTC2    Asn-1194
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763
• CECPFGYILAGNECVDTDECSVGNPCGNGTCK (32aa)
  •    P35555    Asn-2178