Hex:7 HexNAc:6 dHex:1 NeuAc:2

Taxonomy

• Homo sapiens (Human)
• Desmodus rotundus (Common vampire bat)
• Rattus norvegicus (Norway rat)
• Gallus gallus (Chicken)
• Friend murine leukemia virus (F-mulv)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-mannosidase 2 / Homo sapiens    Q16706
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Aminopeptidase n / Homo sapiens    P15144
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein D / Homo sapiens    P05090
• Apolipoprotein F / Homo sapiens    Q13790
• Asporin / Homo sapiens    Q9BXN1
• Attractin / Homo sapiens    O75882
• BDNF/NT-3 growth factors receptor / Homo sapiens    Q16620
• Biglycan / Homo sapiens    P21810
• Butyrophilin subfamily 1 member A1 / Homo sapiens    Q13410
• CD166 antigen / Homo sapiens    Q13740
• CD276 antigen / Homo sapiens    Q5ZPR3
• CD44 antigen / Homo sapiens    P16070
• CD59 glycoprotein / Homo sapiens    P13987
• Cell adhesion molecule 1 / Homo sapiens    Q9BY67
• Ceruloplasmin / Homo sapiens    P00450
• Clusterin / Homo sapiens    P10909
• Complement c1r subcomponent / Homo sapiens    P00736
• Complement C1r subcomponent-like protein / Homo sapiens    Q9NZP8
• Decorin / Homo sapiens    P07585
• Desmocollin-2 / Homo sapiens    Q02487
• Endothelin-converting enzyme 1 / Homo sapiens    P42892
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• ERO1-like protein beta / Homo sapiens    Q86YB8
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Fibronectin / Homo sapiens    P02751
• Galectin-3-binding protein / Homo sapiens    Q08380
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Hepatocyte growth factor / Homo sapiens    P14210
• Homeobox protein Hox-B3 / Homo sapiens    P14651
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Integrin alpha-L / Homo sapiens    P20701
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Kininogen-1 / Homo sapiens    P01042
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit beta-1 / Homo sapiens    P07942
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leptin receptor / Homo sapiens    P48357
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens    P07333
• Macrophage mannose receptor 1 / Homo sapiens    P22897
• Maltase-glucoamylase, intestinal / Homo sapiens    O43451
• Multimerin-1 / Homo sapiens    Q13201
• Neural cell adhesion molecule L1-like protein / Homo sapiens    O00533
• P-selectin / Homo sapiens    P16109
• Plexin-B2 / Homo sapiens    O15031
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolargin / Homo sapiens    P51888
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prosaposin / Homo sapiens    P07602
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Protein heg homolog 1 / Homo sapiens    Q9ULI3
• Protein-lysine 6-oxidase / Homo sapiens    P28300
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Secretogranin-3 / Homo sapiens    Q8WXD2
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens    P05026
• T-cell immunomodulatory protein / Homo sapiens    Q8TB96
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Tenascin / Homo sapiens    P24821
• Tenascin-X / Homo sapiens    P22105
• Thioredoxin domain-containing protein 15 / Homo sapiens    Q96J42
• Thrombopoietin / Homo sapiens    P40225
• Transcobalamin-1 / Homo sapiens    P20061
• Trem-like transcript 2 protein / Homo sapiens    Q5T2D2
• Tripeptidyl-peptidase 1 / Homo sapiens    O14773
• Tyrosine-protein kinase receptor UFO / Homo sapiens    P30530
• Uromodulin / Homo sapiens    P07911
• Versican core protein / Homo sapiens    P13611
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens    P54289
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Neuroligin 1 / Rattus norvegicus    Q62765
• Envelope glycoprotein / Friend murine leukemia virus    P03395
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Serum (UBERON_0001977)   Mature NK T cell (CL_0000814)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Colon (UBERON_0001155)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK570 (CVCL_6370)   Fibroblast (CL_0000057)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Seminal Fluid (UBERON_0006530)  
• Urine (UBERON_0001088)  
• Eveline (CVCL_A1LI)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293T (CVCL_0063)  
• Neutrophil (CL_0000775)  

Reported structure

• N-Linked / Complex / Structure 495
• N-Linked / Complex / Structure 1342
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 2 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-?) + NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3) + 2 x NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3)"
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-3)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 2 x NeuAc"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 9522
• N-Linked / Complex / Structure 10126
• N-Linked / Complex / Structure 10149
• N-Linked / Complex / Structure 10613
• N-Linked / Complex / Structure 10717
• N-Linked / Complex / Structure 10736
• N-Linked / Complex / Structure 11112
• N-Linked / Complex / Structure 11247

Composition

• Hex:7 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 3100.8409 )

Disease

• Cancer, breast (DOID:1612)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
• IgE myeloma (DOID:9538)
• Mixed phenotype acute leukemia (DOID:9953)
• Multiple myeloma (DOID:9538)
• Prostate cancer (DOID:10283)

Reference

• Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
• Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Quantitative analysis of site-specific N-glycans on sera haptoglobin β chain in liver diseases. (2013 - Zhang S, Jiang K, Sun C, Lu H, Liu Y.) / Status : Reviewed
• Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
• Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
• A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
• Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
• Structural study of the N-linked oligosaccharides of hepatocyte growth factor by two-dimensional sugar mapping. (1993 - Hara H, Nakae Y, Sogabe T, Ihara I, Ueno S, Sakai H, Inoue H, Shimizu S, Nakamura T, Shimizu N) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-381
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-88
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-127
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-414
• Alpha-mannosidase 2 / Homo sapiens
  •        Asn-78
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-261
• Aminopeptidase n / Homo sapiens
  •        Asn-818
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Apolipoprotein F / Homo sapiens
  •        Asn-118
• Asporin / Homo sapiens
  •        Asn-282
• Attractin / Homo sapiens
  •        Asn-428
  •        Asn-914
• BDNF/NT-3 growth factors receptor / Homo sapiens
  •        Asn-254
• Biglycan / Homo sapiens
  •        Asn-270
• Butyrophilin subfamily 1 member A1 / Homo sapiens
  •        Asn-55
• CD166 antigen / Homo sapiens
  •        Asn-265
  •        Asn-306
• CD276 antigen / Homo sapiens
  •        Asn-215
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Cell adhesion molecule 1 / Homo sapiens
  •        Asn-101
• Ceruloplasmin / Homo sapiens
  •        Asn-762
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
• Complement c1r subcomponent / Homo sapiens
  •        Asn-125
  •        Asn-221
• Complement C1r subcomponent-like protein / Homo sapiens
  •        Asn-296
• Decorin / Homo sapiens
  •        Asn-303
• Desmocollin-2 / Homo sapiens
  •        Asn-546
• Endothelin-converting enzyme 1 / Homo sapiens
  •        Asn-632
• Epithelial cell adhesion molecule / Homo sapiens
  •        Asn-74
• ERO1-like protein beta / Homo sapiens
  •        Asn-140
• Erythropoietin / Homo sapiens
  •        Undefined site
  •        Asn-51
  •        Asn-65
  •        Asn-110
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-311
• Fibronectin / Homo sapiens
  •        Asn-528
• Galectin-3-binding protein / Homo sapiens
  •        Asn-398
• Haptoglobin / Homo sapiens
  •        Asn-207
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
• Hepatocyte growth factor / Homo sapiens
  •        Asn-294
  •        Asn-402
  •        Asn-566
  •        Asn-653
• Homeobox protein Hox-B3 / Homo sapiens
  •        Asn-226
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-830
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-21
  •        Asn-49
  •        Asn-99
  •        Asn-146
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-116
• Integrin alpha-L / Homo sapiens
  •        Asn-89
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
  •        Asn-577
• Kininogen-1 / Homo sapiens
  •        Asn-294
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-2568
• Laminin subunit beta-1 / Homo sapiens
  •        Asn-1279
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1223
• Leptin receptor / Homo sapiens
  •        Asn-659
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Asn-63
  •        Asn-180
  •        Asn-187
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
  •        Asn-252
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
  •        Asn-58
  •        Asn-101
  •        Asn-275
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens
  •        Asn-153
• Macrophage mannose receptor 1 / Homo sapiens
  •        Asn-104
• Maltase-glucoamylase, intestinal / Homo sapiens
  •        Asn-1603
• Multimerin-1 / Homo sapiens
  •        Asn-783
  •        Asn-981
• Neural cell adhesion molecule L1-like protein / Homo sapiens
  •        Asn-225
• P-selectin / Homo sapiens
  •        Asn-460
• Plexin-B2 / Homo sapiens
  •        Asn-127
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolargin / Homo sapiens
  •        Asn-327
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-729
• Prosaposin / Homo sapiens
  •        Asn-101
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-600
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Protein heg homolog 1 / Homo sapiens
  •        Asn-279
• Protein-lysine 6-oxidase / Homo sapiens
  •        Asn-81
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-462
• Secretogranin-3 / Homo sapiens
  •        Asn-346
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
  •        Asn-265
• T-cell immunomodulatory protein / Homo sapiens
  •        Asn-139
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-313
• Tenascin / Homo sapiens
  •        Asn-166
  •        Asn-1392
  •        Asn-1485
  •        Asn-1809
• Tenascin-X / Homo sapiens
  •        Asn-3855
• Thioredoxin domain-containing protein 15 / Homo sapiens
  •        Asn-181
• Thrombopoietin / Homo sapiens
  •        Undefined site
• Transcobalamin-1 / Homo sapiens
  •        Asn-369
• Trem-like transcript 2 protein / Homo sapiens
  •        Asn-89
• Tripeptidyl-peptidase 1 / Homo sapiens
  •        Asn-210
• Tyrosine-protein kinase receptor UFO / Homo sapiens
  •        Asn-682
• Uromodulin / Homo sapiens
  •        Asn-322
• Versican core protein / Homo sapiens
  •        Asn-330
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
  •        Asn-888
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-302
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-657
  •        Asn-1074
  •        Asn-1098

Mass spectrometry observed peptide

• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• TAVNCSSDFDACIITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• EAENITTGC (9aa)
  •    P01588    Asn-51     Erythropoietin / Homo sapiens
• RLSPNASAEHLELRW (15aa)
  •    Q13410    Asn-55     Butyrophilin subfamily 1 member A1 / Homo sapiens
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57     CD44 antigen / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• FHNESLISSQASSY (14aa)
  •    P08637    Asn-63     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• SVQEIQATFFYFTPNKTEDTIFLR (24aa)
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• YFTPNKTEDTIFLR (14aa)
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• SVQEIQATFFYFTPNK (16aa)
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• KSVQEIQATFFYFTPNKT (18aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• AEMNGSK (7aa)
  •    P16422    Asn-74     Epithelial cell adhesion molecule / Homo sapiens
• DSVINLSESVEDGPK (15aa)
  •    Q16706    Asn-78     Alpha-mannosidase 2 / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• DPGAAVPGAANASAQQPR (18aa)
  •    P28300    Asn-81     Protein-lysine 6-oxidase / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• KKKEDALNETRE (12aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KKKEDALNETRESETKL (17aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• GSNYTSK (7aa)
  •    P20701    Asn-89     Integrin alpha-L / Homo sapiens
• VVNITMVALK (10aa)
  •    Q5T2D2    Asn-89     Trem-like transcript 2 protein / Homo sapiens
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P19652    Asn-88     Alpha-1-acid glycoprotein 2 / Homo sapiens
• QDQCIYNTTYINVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• IAVQFGPGFSWIANFTK (17aa)
  •    P13473    Asn-101     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• FQIINFSSSEIK (12aa)
  •    Q9BY67    Asn-101     Cell adhesion molecule 1 / Homo sapiens
• TCDWIPKPNMSASCK (15aa)
  •    P07602    Asn-101     Prosaposin / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• ELPGVCNETMMALWEECK (18aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• NDTLLGIK (8aa)
  •    P22897    Asn-104     Macrophage mannose receptor 1 / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• GQALLVNSSQPWEPLQLHVDK (21aa)
  •    P01588    Asn-110     Erythropoietin / Homo sapiens
• SANASFNIK (9aa)
  •    Q13308    Asn-116     Inactive tyrosine-protein kinase 7 / Homo sapiens
• QGGVNATQVLIQHLR (15aa)
  •    Q13790    Asn-118     Apolipoprotein F / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MLLTFHTDFSNEENGTIMFYK (21aa)
  •    P00736    Asn-125     Complement c1r subcomponent / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• ALSNISLR (8aa)
  •    O15031    Asn-127     Plexin-B2 / Homo sapiens
• TINQSSDEIQISMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• SELGAVIFWGQNQTLDPNNMTILNR (25aa)
  •    Q8TB96    Asn-139     T-cell immunomodulatory protein / Homo sapiens
• IGAINSTISNQSK (13aa)
  •    Q86YB8    Asn-140     ERO1-like protein beta / Homo sapiens
• HTNYSFSPWHGFTIHR (16aa)
  •    P07333    Asn-153     Macrophage colony-stimulating factor 1 receptor / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GNFSTEGCGCVCEPGWK (17aa)
  •    P24821    Asn-166     Tenascin / Homo sapiens
• CRGLVGSKNVSSE (13aa)
  •    P08637    Asn-180     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •    VAR_003960   176:F→V   dbSNP:rs396991
• NITGLENFTLK (11aa)
  •    Q96J42    Asn-181     Thioredoxin domain-containing protein 15 / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• TVNITITQGLA (11aa)
  •    P08637    Asn-187     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
• YNITSQDVGSGTSNNSQACAQFIEQYFHDSDIAQFMR (37aa)
  •    O14773    Asn-210     Tripeptidyl-peptidase 1 / Homo sapiens
• RYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMR (38aa)
  •    O14773    Asn-210     Tripeptidyl-peptidase 1 / Homo sapiens
• VVIGANGTYSCIVR (14aa)
  •    Q5ZPR3    Asn-215     CD276 antigen / Homo sapiens
• CNYSIR (6aa)
  •    P00736    Asn-221     Complement c1r subcomponent / Homo sapiens
• LTVNSSNSIK (10aa)
  •    O00533    Asn-225     Neural cell adhesion molecule L1-like protein / Homo sapiens
• VEMANLLNLSER (12aa)
  •    P14651    Asn-226     Homeobox protein Hox-B3 / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
  •    P51884    Asn-252     Lumican / Homo sapiens
• ITNISSDDSGK (11aa)
  •    Q16620    Asn-254     BDNF/NT-3 growth factors receptor / Homo sapiens
• VFPQVNVTK (9aa)
  •    P54802    Asn-261     Alpha-n-acetylglucosaminidase / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• NAIKEGDNITIK (12aa)
  •    Q13740    Asn-265     CD166 antigen / Homo sapiens
• YIQPIIAVQFTNITMDTEIR (20aa)
  •    P05026    Asn-265     Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
• EGDNITIK (8aa)
  •    Q13740    Asn-265     CD166 antigen / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• NSSGPDLSWLHFYR (14aa)
  •    Q9ULI3    Asn-279     Protein heg homolog 1 / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• NQSVNVFLGHTAIDEMLK (18aa)
  •    Q9NZP8    Asn-296     Complement C1r subcomponent-like protein / Homo sapiens
• YIQVVYLHNNNISVVGSSDFCPPGHNTK (28aa)
  •    P07585    Asn-303     Decorin / Homo sapiens
• NATGDYK (7aa)
  •    Q13740    Asn-306     CD166 antigen / Homo sapiens
• NICHLR (6aa)
  •    Q16610    Asn-311     Extracellular matrix protein 1 / Homo sapiens
• NETLALPAESK (11aa)
  •    Q7Z7G0    Asn-313     Target of Nesh-SH3 / Homo sapiens
• QDFNITDISLLEHR (14aa)
  •    P07911    Asn-322     Uromodulin / Homo sapiens
• INGTQICPNDIVAFHDFSSDIENVPHIR (28aa)
  •    P51888    Asn-327     Prolargin / Homo sapiens
• FENQTGFPPPDSR (13aa)
  •    P13611    Asn-330     Versican core protein / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NATDNISK (8aa)
  •    Q8WXD2    Asn-346     Secretogranin-3 / Homo sapiens
• MNDTIFGFTMEER (13aa)
  •    P20061    Asn-369     Transcobalamin-1 / Homo sapiens
• IIIAGTNSSDIQQIISIIESNK (22aa)
  •    P08195    Asn-381     4F2 cell-surface antigen heavy chain / Homo sapiens
• YKGLNLTEDTYKPR (14aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• VVNPTQK (7aa)
  •    P01009    Asn-414     Alpha-1-antitrypsin / Homo sapiens
• VFHIHNESWVLLTPK (15aa)
  •    O75882    Asn-428     Attractin / Homo sapiens
• VNCSHPFGAFR (11aa)
  •    P16109    Asn-460     P-selectin / Homo sapiens
• APQHVVNHLPPYTNVSLK (18aa)
  •    Q15262    Asn-462     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• NGIYNITVLASDQGGR (16aa)
  •    Q02487    Asn-546     Desmocollin-2 / Homo sapiens
• YSVLIMAEKPVGDLSSPNETK (21aa)
  •    Q9P2B2    Asn-600     Prostaglandin F2 receptor negative regulator / Homo sapiens
• NSSVEAFK (8aa)
  •    P42892    Asn-632     Endothelin-converting enzyme 1 / Homo sapiens
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NVTLLWK (7aa)
  •    P48357    Asn-659     Leptin receptor / Homo sapiens
• NCMLNENMSVCVADFGLSK (19aa)
  •    P30530    Asn-682     Tyrosine-protein kinase receptor UFO / Homo sapiens
• IETILLNGTDR (11aa)
  •    Q07954    Asn-729     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• LNDSIQTLVNDNQR (14aa)
  •    Q13201    Asn-783     Multimerin-1 / Homo sapiens
• NATLVNEADK (10aa)
  •    P15144    Asn-818     Aminopeptidase n / Homo sapiens
• NATIVNEADKIR (12aa)
  •    P15144    Asn-818     Aminopeptidase n / Homo sapiens
• LSALDNLLNHSSMFLK (16aa)
  •    Q9Y4L1    Asn-830     Hypoxia up-regulated protein 1 / Homo sapiens
• HLVNISVYAFNK (12aa)
  •    P54289    Asn-888     Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
• AATCINPINGSVCERPANHSAK (22aa)
  •    O75882    Asn-914     Attractin / Homo sapiens
• TQAALSNLTCCIDR (14aa)
  •    Q13201    Asn-981     Multimerin-1 / Homo sapiens
• VPAQEKNFTTAPAICHDGKAHFPREGVF (28aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TLAGENQTAFEIEELNRK (18aa)
  •    P11047    Asn-1223     Laminin subunit gamma-1 / Homo sapiens
• LSDTTSQSNSTAK (13aa)
  •    P07942    Asn-1279     Laminin subunit beta-1 / Homo sapiens
• VEAAQNITIPGSIR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• IIETVEYNISGAER (14aa)
  •    P24821    Asn-1485     Tenascin / Homo sapiens
• QDPVSWDVAFVNISR (15aa)
  •    O43451    Asn-1603     Maltase-glucoamylase, intestinal / Homo sapiens
• GFEESEPVSGSFTTAIDGPSGIVTANITDSEAIAR (35aa)
  •    P24821    Asn-1809     Tenascin / Homo sapiens
• AQQIIANSTAIEEAMIQEQQR (21aa)
  •    O15230    Asn-2568     Laminin subunit alpha-5 / Homo sapiens
• ALNLTEGFAVLHWK (14aa)
  •    P22105    Asn-3855     Tenascin-X / Homo sapiens