HexNAc:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Equus caballus (Domestic horse)
• Macaca mulatta (Rhesus monkey)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Bufo arenarum
• Rana temporaria (Common frog)
• Xenopus laevis (African clawed frog)
• Styela plicata
• Gallus gallus (Chicken)
• Rhea americana (Greater rhea)
• Sturnus vulgaris (Common starling)
• Autographa californica nucleopolyhedrovirus
• Human adenovirus type 2
• Human adenovirus type 5
• Human cytomegalovirus (strain 751)
• Human cytomegalovirus (strain ad169)
• Human cytomegalovirus (strain towne)
• Simian virus 40
• Entamoeba histolytica
• Unspecified eukaryote/s
• Aspergillus oryzae
• Hirudinaria manillensis (Leech)
• Aedes aegypti (Yellow fever mosquito)
• Drosophila melanogaster (Fruit fly)
• Protophormia terraenovae (Nestling-sucking blowfly)
• Leishmania major
• Trypanosoma cruzi
• Tropidechis carinatus (Australian rough-scaled snake)
• Friend spleen focus-forming virus
• Friend spleen focus-forming virus (gm1.2.3 mutant)
• Friend spleen focus-forming virus (gm3.4 mutant)
• Fusarium solani f. sp. pisi
• Plum pox virus (strain r)
• Schistosoma mansoni

Protein

• Alpha crystallin - a and b chains / Homo sapiens    P02511    P02489
• Assembly protein-3 (ap3) / Homo sapiens
• Chromogranin a / Homo sapiens    P10645
• Erythropoietin / Homo sapiens    P01588
• Estrogen receptor / Homo sapiens    P03372
• Glycophorin a and b / Homo sapiens    P02724    P06028
• Glycoprotein ln / Homo sapiens
• Glycoprotein rg / Homo sapiens
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Interleukin-2 [mu30] / Homo sapiens    P60568
• Interleukin-2 [mu32] / Homo sapiens    P60568
• Keratin, type i cytoskeletal 13 / Homo sapiens    P13646
• Keratin, type i cytoskeletal 18 / Homo sapiens    P05783
• Keratin, type II cytoskeletal 8 / Homo sapiens    P05787
• Leukosialin (cd43) / Homo sapiens    P16150
• Low-density lipoprotein receptor / Homo sapiens    P01130
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Microfibrillar-associated protein 5 / Homo sapiens    Q13361
• Mucin / Homo sapiens
• Mucin - mg2 / Homo sapiens
• Mucin-1 / Homo sapiens    P15941
• Myc proto-oncogene protein / Homo sapiens    P01106
• Nucleoporin p62 / Homo sapiens    P37198
• P65 / Homo sapiens
• Prosaposin / Homo sapiens    P07602
• Protein 4.1 / Homo sapiens    P11171
• Protein yipf3 / Homo sapiens    Q9GZM5
• Proteoglycan 4 (lubricin) / Homo sapiens    Q92954
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Serum response factor (srf) / Homo sapiens    P11831
• Thrombopoietin / Homo sapiens    P40225
• Transcription factor sp1 / Homo sapiens    P08047
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Uncharacterized protein from Erythrocyte / Homo sapiens
• Uncharacterized protein from Erythrocyte / Homo sapiens
• Uncharacterized protein from Erythrocyte Membrane / Homo sapiens
• Uncharacterized protein from Fluid / Homo sapiens
• Uncharacterized protein from Meconium / Homo sapiens
• Alpha crystallin - a and b chains / Bos taurus    P02470    P02510
• Alpha crystallin a chain (a1 subunit) / Bos taurus    P02470
• Alpha crystallin a chain (a2 subunit) / Bos taurus    P02470
• Alpha crystallin b chain (b1 subunit) / Bos taurus    P02510
• Alpha crystallin b chain (b2 subunit) / Bos taurus    P02510
• Ankyrin g (480 kDa) / Bos taurus    E1BNC9
• Apolipoprotein e / Bos taurus    Q03247
• Estrogen receptor / Bos taurus    P49884
• Fetuin-b / Bos taurus    Q58D62
• Fibrinogen beta chain / Bos taurus    P02676
• Gp-3 / Bos taurus
• Insulin-like growth factor II / Bos taurus    P07456
• Inter-alpha-trypsin inhibitor heavy chain h1 / Bos taurus    Q0VCM5
• Inter-alpha-trypsin inhibitor heavy chain h4 / Bos taurus    Q3T052
• Lactophorin / Bos taurus    P80195
• Mucin / Bos taurus
• Plasma serine protease inhibitor / Bos taurus    Q9N2I2
• Synapsin i / Bos taurus    P17599
• Mucin / Equus caballus
• Alpha crystallin - a and b chains / Macaca mulatta    P02488
• ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus    P56528
• BDNF/NT-3 growth factors receptor / Mus musculus    P15209
• Cadherin-13 / Mus musculus    Q9WTR5
• Carboxypeptidase E / Mus musculus    Q00493
• Choline transporter-like protein 1 / Mus musculus    Q6X893
• Contactin-2 / Mus musculus    Q61330
• Contactin-associated protein 1 / Mus musculus    O54991
• CUB and sushi domain-containing protein 3 / Mus musculus    Q80T79
• Embigin / Mus musculus    P21995
• Epiglycanin / Mus musculus    D9N008
• Estrogen receptor / Mus musculus    P19785
• Estrogen receptor beta / Mus musculus    O08537
• Gamma-glutamyltransferase 7 / Mus musculus    Q99JP7
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus    P35438
• Isoform 2 of Teneurin-3 / Mus musculus    Q9WTS6-2
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Isoform 3 of Neuroplastin / Mus musculus    P97300-3
• Isoform 9 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus    Q9R1V6-11
• Leucine-rich repeat-containing protein 4 / Mus musculus    Q99PH1
• Muc2 / Mus musculus
• Neurofascin / Mus musculus    Q810U3
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Neuroplastin / Mus musculus    P97300
• Nucleoporin p62 / Mus musculus
• Opioid-binding protein/cell adhesion molecule / Mus musculus    G5E8G3
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Prosaposin / Mus musculus    Q61207
• Prostaglandin g/h synthase 2 / Mus musculus    Q05769
• Reticulocalbin-1 / Mus musculus    Q05186
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Uncharacterized protein from B-Lymphocyte / Mus musculus
• Uncharacterized protein from T-Lymphocyte / Mus musculus
• Uncharacterized protein from T-Lymphocyte / Mus musculus
• Uncharacterized protein from Thymocyte / Mus musculus
• Brain non dialyzable glycopeptide / Oryctolagus cuniculus
• P67 / Oryctolagus cuniculus
• 56 kDa intrinsic membrane protein / Rattus norvegicus
• Alpha crystallin - a and b chains / Rattus norvegicus    P23928    P24623
• Mucin / Rattus norvegicus
• Mucin-2 glycopeptide a / Rattus norvegicus    Q62635
• Mucin-2 glycopeptide b / Rattus norvegicus    Q62635
• Neurofilament triplet l protein / Rattus norvegicus    P19527
• Neurofilament triplet m protein / Rattus norvegicus    P12839
• Nuclear pore glycoprotein p62 / Rattus norvegicus    P17955
• Uncharacterized protein from Cell Membranes / Rattus norvegicus
• Uncharacterized protein from Cell Nuclei / Rattus norvegicus
• Uncharacterized protein from Cell Nuclei / Rattus norvegicus
• Uncharacterized protein from Cell Nuclei / Rattus norvegicus
• Uncharacterized protein from Cell Nuclei / Rattus norvegicus
• Uncharacterized protein from Liver / Rattus norvegicus
• Uncharacterized protein from Nucleus / Rattus norvegicus
• Mucin / Sus scrofa
• Talin / Sus scrofa
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
• Mucin / Bufo arenarum
• Mucin / Rana temporaria
• Nucleoporin p62 / Xenopus laevis
• H-antigen / Styela plicata
• Glycophorin / Gallus gallus
• Talin / Gallus gallus    P54939
• Alpha crystallin - a and b chains / Rhea americana    P02505
• Alpha crystallin / Sturnus vulgaris
• Fg / Autographa californica nucleopolyhedrovirus
• Eg / Human adenovirus type 2
• Fiber protein / Human adenovirus type 2    P03275
• Lg / Human adenovirus type 2
• Fiber protein / Human adenovirus type 5    P11818
• Large structural phosphoprotein / Human cytomegalovirus (strain 751)
• Large structural phosphoprotein / Human cytomegalovirus (strain ad169)    P08318
• Large structural phosphoprotein / Human cytomegalovirus (strain towne)
• Large t antigen / Simian virus 40    P03070
• Serine-rich 25 kDa antigen protein / Entamoeba histolytica    P21138
• Rna polymerase II (Pol II) / Unspecified eukaryote/s
• Alpha-amylase a / Aspergillus oryzae    P0C1B3
• Hirudin p6 / Hirudinaria manillensis    P28512
• Uncharacterized protein from Cell Surface / Aedes aegypti
• Mucin d, gp-b (80 kDa) / Drosophila melanogaster
• Diptericin-D / Protophormia terraenovae    P18684
• Gp96/92 / Leishmania major
• 35/50 kDa surface glycoprotein / Trypanosoma cruzi
• Mucin / Trypanosoma cruzi
• Synthetic peptide: kppttttttttkpp / Trypanosoma cruzi
• Uncharacterized protein from Undefined tissue / Trypanosoma cruzi
• Coagulation factor x / Tropidechis carinatus    P81428
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus    P03393
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)    P03393
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)    P03393
• Cutinase / Fusarium solani f. sp. pisi    P00590
• Coat protein / Plum pox virus (strain r)
• Uncharacterized protein from Whole Organism / Schistosoma mansoni

Source

• Anterior Lobe of Cerebellum (UBERON_0002131)  
• Blood Serum (UBERON_0001977)  
• Body Fluid (UBERON_0006314)  
• Brain (UBERON_0000955)   C-1300 clone N18 (CVCL_4724)  
• Brain (UBERON_0000955)   C-1300 clone S20 (CVCL_VU14)  
• Brain (UBERON_0000955)   NB41A3 (CVCL_3553)  
• Brain (UBERON_0000955)   Neuro-2a (CVCL_0470)  
• Brain (UBERON_0000955)  
• Brain (UBERON_0000955)   Nucleus (GO_0005634)  
• Colon (UBERON_0001155)   HT-29 (CVCL_0320)  
• Colon (UBERON_0001155)   LS174T (CVCL_1384)  
• Frontal Cortex (UBERON_0001870)  
• Gizzard Smooth Muscle (UBERON_0011903)  
• Hemolymph (UBERON_0001011)  
• Intestinal Mucosa  
• Kidney (UBERON_0002113)   BHK570 (CVCL_6370)   Fibroblast (CL_0000057)  
• Kidney (UBERON_0002113)   COS-7 (CVCL_0224)  
• Kidney (UBERON_0002113)   CV-1 (CVCL_0229)  
• Kidney (UBERON_0002113)  
• Large Intestine (UBERON_0000059)  
• Lens of Camera-Type Eye (UBERON_0000965)  
• Liver (UBERON_0002107)   AH66-TC (CVCL_4368)   Plasma Membrane (GO_0005886)  
• Liver (UBERON_0002107)   BRL (CVCL_4565)   Nucleus (GO_0005634)  
• Liver (UBERON_0002107)  
• Liver (UBERON_0002107)   Nucleus (GO_0005634)  
• Lung (UBERON_0002048)   Nucleus (GO_0005634)  
• Mammalian Vulva (UBERON_0000997)   A-431 (CVCL_0037)  
• Mammary Gland (UBERON_0001911)   MCF-7 (CVCL_0031)  
• Mammary Gland (UBERON_0001911)   T-47D (CVCL_0553)  
• Mammary Gland (UBERON_0001911)   TA3/Ha (CVCL_4321)  
• Meconium (UBERON_0007109)  
• Middle Frontal Gyrus (UBERON_0002702)  
• Milk (UBERON_0001913)  
• Mucosa (UBERON_0000344)   67j25D (CVCL_Z425)  
• Mucosa of Large Intestine (UBERON_0001207)  
• Mucosa of Small Intestine (UBERON_0001204)  
• Mucosa of Stomach (UBERON_0001199)  
• Myocardium (UBERON_0002349)   Nucleus (GO_0005634)  
• Outer Epithelium (UBERON_0007376)   Foreskin Keratinocyte (CL_1001606)  
• Ovary (UBERON_0000992)   Sf21 (CVCL_0518)  
• Ovary (UBERON_0000992)   Sf9 (CVCL_0549)  
• Ovary (UBERON_0000992)  
• Placenta (UBERON_0001987)   BeWo (CVCL_0044)   Epithelium (CL_0002577)  
• Pleura (UBERON_0000977)   K-562 (CVCL_0004)  
• Prepuce of Penis (UBERON_0001332)   Fibroblast (CL_0000057)  
• Saliva (UBERON_0001836)  
• Saliva-Secreting Gland (UBERON_0001044)  
• Skin of Body (UBERON_0002097)   A-431 (CVCL_0037)   Fibroblast (CL_0000057)  
• Small Intestine (UBERON_0002108)  
• Stomach Smooth Muscle (UBERON_0004222)  
• Submandibular Gland (UBERON_0001736)  
• Synovial Fluid (UBERON_0001090)  
• Thymus (UBERON_0002370)   Platelet (CL_0000233)  
• Thyroid (UBERON_0002046)  
• Urine (UBERON_0001088)  
• Uterine Cervix (UBERON_0000002)   Detroit 98/AH-2 (CVCL_8190)  
• Uterine Cervix (UBERON_0000002)   HEp-2 (CVCL_1906)  
• Uterine Cervix (UBERON_0000002)   HeLa (CVCL_0030)   Fibroblast (CL_0000057)  
• Uterine Cervix (UBERON_0000002)   HeLa (CVCL_0030)  
• Uterus (UBERON_0000995)  
• Venom (UBERON_0007113)  
• Zona Pellucida (UBERON_0000086)  
• CCRF-CEM (CVCL_0207)   T-Lymphocyte (CL_0000084)  
• LSTM-AA-20A (CVCL_Z354)   Cell Surface (GO_0009986)  
• Rat1 (CVCL_0492)  
• B-Lymphocyte (CL_0000236)  
• Egg Cell  
• Egg Cell   Jelly Coat  
• Erythrocyte (CL_0000232)  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  
• Leukocyte (CL_0000738)  
• Reticulocyte (CL_0000558)  
• T-Lymphocyte (CL_0000084)  
• Cell Surface (GO_0009986)  
• Cytoplasm (GO_0005737)  
• Cytoplasmic Vesicle (GO_0031410)  
• Neurofilament (GO_0005883)  
• Node of Ranvier (GO_0033268)  
• Nucleus (GO_0005634)  
• Plasma Membrane (GO_0005886)  

Reported structure

• O-Linked / Core 0 / GalNAc
• N-Linked/O-Linked / Truncated If N-Linked / GlcNAc
• N-Linked / Truncated / GlcNAc
• O-Linked / Undefined core / GlcNAc

Composition

• HexNAc:1 (avg mass : 221.2103 )

Disease

• Adenocarcinoma (DOID:299)
• Adenocarcinoma, Grade II (DOID:299)
• Alzheimer's disease (DOID:10652)
• Anemia, Aplastic (DOID:12449)
• Arthritis, Rheumatoid (DOID:7148)
• Cancer, breast (DOID:1612)
• Cancer, Ovarian (Cystic) (DOID:2394)
• Carcinoid Tumor, with multiple liver metastasis
• Carcinoma (DOID:305)
• Carcinoma, Hepatocellular (DOID:684)
• Carcinoma, Squamous cell (DOID:1749)
• Choriocarcinoma (DOID:3594)
• Cystic Fibrosis (DOID:1485)
• Erythroleukemia with associated Polycythemia
• Leukemia, Acute lymphoblastic and HIV-1
• Leukemia, Myloid, Chronic (DOID:8552)
• Malaria Tropica, Malignant (DOID:14067)
• Myeloma, Multiple (DOID:9538)
• Neuroblastoma (DOID:769)
• Osteoarthritis (DOID:8398)
• Ovarian cyst (DOID:5119)
• Tn Polyagglutinability Syndrome (DOID:0080520)

Reference

• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
• Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
• Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
• Affinity enrichment and characterization of mucin core-1 type glycopeptides from bovine serum (2009 - Darula Z, Medzihradszky KF.) / Status : Reviewed
• Occurrence of O-linked Xyl-GlcNAc and Xyl-Glc disaccharides in trocarin, a factor Xa homolog from snake venom (2003 - Joseph JS, Valiyavettil M, Gowda DC, Kini RM) / Status : Reviewed
• A novel sialylated and galactofuranose-containing O-linked glycan, Neu5Ac alpha2-5 Galp beta1-6 (Galf beta1-4) GlcNAc, is expressed on the sialoglycoprotein of Trypanosoma cruzi Dm28c (2003 - Agrellos OA, Jones C, Todeschini AR, Previato JO, Mendonca-Previato L) / Status : Reviewed
• The capsid protein of a plant single-stranded RNA virus is modified by O-linked N-acetylglucosamine (2002 - Fernandez-Fernandez, Camafeita, Bonay, Mendez, Albar, Garcia) / Status : Reviewed
• Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
• Structure of O-glycosidically linked oligosaccharides from glycoproteins of Trypanosoma cruzi CL-Brener strain: evidence for the presence of O-linked sialyl-oligosaccharides. (2001 - Todeschini A, da Silveira E, Jones C, Wait R, Previato J, Mendona-Previato L) / Status : Reviewed
• Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
• Characterization of the glycosylation sites in cyclooxygenase-2 using mass spectrometry. (2001 - Nemeth J, Hochgesang G, Marnett L, Caprioli R, Hochensang G) / Status : Reviewed
• Alternative O-glycosylation/O-phosphorylation of the murine estrogen receptor beta. (2000 - Cheng X, Cole R, Zaia J, Hart G) / Status : Reviewed
• Isolation and characterization of glycophorin from nucleated (chicken) erythrocytes. (2000 - Duk M, Krotkiewski H, Stasyk T, Lutsik-Kordovsky M, Syper D, Lisowska E) / Status : Reviewed
• Separation of Galfbeta1-->XGlcNAc and Galpbeta1-->XGlcNAc (X = 3, 4, and 6) as the alditols by high-pH anion-exchange chromatography and thin-layer chromatography: characterization of mucins from Trypanosoma cruzi. (2000 - Salto M, Gallo-Rodriguez C, Lima C, de Lederkremer R) / Status : Reviewed
• High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
• Reduction of O-linked N-acetylglucosamine-modified assembly protein-3 in Alzheimer's disease. (1998 - Yao P, Coleman P) / Status : Reviewed
• Phosphorylation and O-glycosylation sites of human chromogranin A (CGA79-439) from urine of patients with carcinoid tumors. (1998 - Gadroy P, Stridsberg M, Capon C, Michalski J, Strub J, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
• Structure of the O-glycopeptides isolated from bovine milk component PP3. (1998 - Coddeville B, Girardet J, Plancke Y, Campagna S, Linden G, Spik G) / Status : Reviewed
• SV40 large T antigen is modified with O-linked N-acetylglucosamine but not with other forms of glycosylation. (1998 - Medina L, Grove K, Haltiwanger R) / Status : Reviewed
• Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
• Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
• Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions (1998 - Martensson, Levery, Fang, Bendiak) / Status : Reviewed
• Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
• Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
• Human low-molecular-weight salivary mucin expresses the sialyl lewisx determinant and has L-selectin ligand activity. (1998 - Prakobphol A, Thomsson K, Hansson G, Rosen S, Singer M, Phillips N, Medzihradszky K, Burlingame A, Leffler H, Fisher S) / Status : Reviewed
• An evaluation of sialation of the nucleoporin p62. (1998 - Fang B, Hanover J, Miller M) / Status : Reviewed
• Biosynthesis of O-N-acetylglucosamine-linked glycans in Trypanosoma cruzi. Characterization of the novel uridine diphospho-N-acetylglucosamine:polypeptide N-acetylglucosaminyltransferase-catalyzing formation of N-acetylglucosamine alpha1-->O-threonine. (1998 - Previato J, Sola-Penna M, Agrellos O, Jones C, Oeltmann T, Travassos L, Mendona-Previato L) / Status : Reviewed
• A subpopulation of estrogen receptors are modified by O-linked N-acetylglucosamine. (1997 - Jiang M, Hart G) / Status : Reviewed
• Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
• The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
• Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana temporaria. (1997 - Maes E, Florea D, Delplace F, Lemoine J, Plancke Y, Strecker G) / Status : Reviewed
• Identification of O-linked N-acetylglucosamine modification of ankyrinG isoforms targeted to nodes of Ranvier. (1996 - Zhang X, Bennett V) / Status : Reviewed
• Comparison of O-linked carbohydrate chains in MUC-1 mucin from normal breast epithelial cell lines and breast carcinoma cell lines. Demonstration of simpler and fewer glycan chains in tumor cells. (1996 - Lloyd KO, Burchell J, Kudryashov V, Yin BW, Taylor-Papadimitriou J) / Status : Reviewed
• Mucin-type glycoprotein from Drosophila melanogaster embryonic cells: characterization of carbohydrate component. (1996 - Kramerov A, Arbatsky N, Rozovsky Y, Mikhaleva E, Polesskaya O, Gvozdev V, Shibaev V) / Status : Reviewed
• Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
• The lipid structure of the glycosylphosphatidylinositol-anchored mucin-like sialic acid acceptors of Trypanosoma cruzi changes during parasite differentiation from epimastigotes to infective metacyclic trypomastigote forms. (1995 - Serrano A, Schenkman S, Yoshida N, Mehlert A, Richardson J, Ferguson M) / Status : Reviewed
• Insect immunity. The inducible antibacterial peptide diptericin carries two O-glycans necessary for biological activity. (1995 - Bulet P, Hegy G, Lambert J, van Dorsselaer A, Hoffmann J, Hetru C) / Status : Reviewed
• Identification and mutational analysis of the glycosylation sites of human keratin 18. (1995 - Ku N, Omary M) / Status : Reviewed
• c-Myc is glycosylated at threonine 58, a known phosphorylation site and a mutational hot spot in lymphomas. (1995 - Chou T, Hart G, Dang C) / Status : Reviewed
• The serine-rich Entamoeba histolytica protein is a phosphorylated membrane protein containing O-linked terminal N-acetylglucosamine residues. (1995 - Stanley Jr S, Tian K, Koester J, Li E) / Status : Reviewed
• O-glycosidically linked N-acetylglucosamine-bound oligosaccharides from glycoproteins of Trypanosoma cruzi. (1994 - Previato J, Jones C, Gonalves L, Wait R, Travassos L, Mendona-Previato L) / Status : Reviewed
• Site-specific glycosylation of the human cytomegalovirus tegument basic phosphoprotein (UL32) at serine 921 and serine 952. (1994 - Greis K, Gibson W, Hart G) / Status : Reviewed
• Altered sialylation of CD45 in HIV-1-infected T lymphocytes. (1994 - Lefebvre J, Giordanengo V, Doglio A, Cagnon L, Breittmayer J, Peyron J, Lesimple J) / Status : Reviewed
• Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
• Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1993 - Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A) / Status : Reviewed
• Identification, characterisation and genomic cloning of a O-linked N-acetylglucosamine-containing cytoplasmic Leishmania glycoprotein. (1993 - Handman E, Barnett L, Osborn A, Goding J, Murray P) / Status : Reviewed
• Biosynthesis and secretion of human interleukin 2 glycoprotein variants from baculovirus-infected Sf21 cells. Characterization of polypeptides and posttranslational modifications. (1993 - Grabenhorst E, Hofer B, Nimtz M, Jger V, Conradt H) / Status : Reviewed
• Assignment of O-glycan attachment sites to the hinge-like regions of human lysosomal membrane glycoproteins lamp-1 and lamp-2. (1993 - Carlsson S, Lycksell P, Fukuda M) / Status : Reviewed
• Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
• Glycosylation of mammalian neurofilaments. Localization of multiple O-linked N-acetylglucosamine moieties on neurofilament polypeptides L and M. (1993 - Dong D, Xu Z, Chevrier M, Cotter R, Cleveland D, Hart G) / Status : Reviewed
• Studies on O-glycans of Plasmodium-falciparum-infected human erythrocytes. Evidence for O-GlcNAc and O-GlcNAc-transferase in malaria parasites. (1993 - Dieckmann-Schuppert A, Bause E, Schwarz R) / Status : Reviewed
• O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
• Vertebrate lens alpha-crystallins are modified by O-linked N-acetylglucosamine. (1992 - Roquemore E, Dell A, Morris H, Panico M, Reason A, Savoy L, Wistow G, Zigler J, Earles B, Hart G) / Status : Reviewed
• O-linked oligosaccharides of glycophorins A and B in erythrocytes of two individuals with the Tn polyagglutinability syndrome. (1992 - Blumenfeld O, Lalezari P, Khorshidi M, Puglia K, Fukuda M) / Status : Reviewed
• Primary structure and function of novel O-glycosylated hirudins from the leech Hirudinaria manillensis. (1992 - Steiner V, Knecht R, Brnsen K, Gassmann E, Stone S, Raschdorf F, Schlaeppi J, Maschler R) / Status : Reviewed
• Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
• The cytoskeletal protein talin is O-glycosylated. (1992 - Hagmann J, Grob M, Burger M) / Status : Reviewed
• Bovine lens alpha-crystalline subunits are modified by O-linked GlcNAc. (1991 - Roquemore E, Dell A, Hart G) / Status : Reviewed
• Characterization of oligosaccharide structures on a chimeric respiratory syncytial virus protein expressed in insect cell line Sf9. (1991 - Wathen M, Aeed P, Elhammer A) / Status : Reviewed
• Characterization and dynamics of O-linked glycosylation of human cytokeratin 8 and 18. (1991 - Chou C, Smith A, Omary M) / Status : Reviewed
• Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
• Nuclear localization of an O-glycosylated protein phosphotyrosine phosphatase from human cells. (1991 - Meikrantz W, Smith D, Sladicka M, Schlegel R) / Status : Reviewed
• The C-terminal domain of RNA polymerase II is modified by O-linked GlcNAc. (1991 - Kelly W, Dahmus M, Hart G) / Status : Reviewed
• Identification of O-GlcNAc attachment sites in transcription factors. (1991 - Reason A, Dell A, Morris H, Panico M, Treisman R, Marais R, Hart G, Haltiwanger R) / Status : Reviewed
• Synapsins contain O-linked N-acetylglucosamine. (1991 - Luthi T, Haltiwanger R, Greengard P, Bahler M) / Status : Reviewed
• Lymphocyte activation induces rapid changes in nuclear and cytoplasmic glycoproteins. (1991 - Kearse KP, Hart GW) / Status : Reviewed
• Relative accessibility of N-acetylglucosamine in trimers of the adenovirus types 2 and 5 fiber proteins. (1990 - Mullis K, Haltiwanger R, Hart G, Marchase R, Engler J) / Status : Reviewed
• Human transferrin receptor contains O-linked oligosaccharides. (1990 - Do S, Enns C, Cummings R) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Sugar sequences of allergenically active oligosaccharide alcohols isolated from a large-molecular-size sea squirt antigen termed H-antigen. (1989 - Ohta M, Shigeta S, Ono K, Takao T, Shimonishi Y, Oka S) / Status : Reviewed
• O-linked oligosaccharides from human serum immunoglobulin A1. (1989 - Field M, Dwek R, Edge C, Rademacher T) / Status : Reviewed
• Cytokeratin 13 contains O-glycosidically linked N-acetylglucosamine residues. (1989 - King I, Hounsell E) / Status : Reviewed
• Glycosylation of eukaryotic peptide chain initiation factor 2 (eIF-2)-associated 67-kDa polypeptide (p67) and its possible role in the inhibition of eIF-2 kinase-catalyzed phosphorylation of the eIF-2 alpha-subunit. (1989 - Datta B, Ray M, Chakrabarti D, Wylie D, Gupta N) / Status : Reviewed
• Intrinsic membrane glycoproteins with cytosol-oriented sugars in the endoplasmic reticulum. (1988 - Abeijon C, Hirschberg C) / Status : Reviewed
• Virion basic phosphoprotein from human cytomegalovirus contains O-linked N-acetylglucosamine. (1988 - Benko D, Haltiwanger R, Hart G, Gibson W) / Status : Reviewed
• O-glycosylation of eukaryotic transcription factors: implications for mechanisms of transcriptional regulation. (1988 - Jackson S, Tjian R) / Status : Reviewed
• Characterization of the N- and O-linked oligosaccharides in glycoproteins synthesized by Schistosoma mansoni schistosomula. (1988 - Nyame K, Cummings R, Damian R) / Status : Reviewed
• Nuclear pore complex contains a family of glycoproteins that includes p62: glycosylation through a previously unidentified cellular pathway. (1987 - Davis L, Blobel G) / Status : Reviewed
• Erythrocytes contain cytoplasmic glycoproteins. O-linked GlcNAc on Band 4.1. (1987 - Holt G, Haltiwanger R, Torres C, Hart G) / Status : Reviewed
• Schistosoma mansoni synthesizes glycoproteins containing terminal O-linked N-acetylglucosamine residues. (1987 - Nyame K, Cummings R, Damian R) / Status : Reviewed
• Nuclear pore complex glycoproteins contain cytoplasmically disposed O-linked N-acetylglucosamine. (1987 - Holt G, Snow C, Senior A, Haltiwanger R, Gerace L, Hart G) / Status : Reviewed
• A nuclear specific glycoprotein representative of a unique pattern of glycosylation. (1987 - Schindler M, Hogan M, Miller R, DeGaetano D) / Status : Reviewed
• Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
• Structural variations of O-linked oligosaccharides present in leukosialin isolated from erythroid, myeloid, and T-lymphoid cell lines. (1986 - Carlsson S, Sasaki H, Fukuda M) / Status : Reviewed
• Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
• Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
• The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
• Topography and polypeptide distribution of terminal N-acetylglucosamine residues on the surfaces of intact lymphocytes. Evidence for O-linked GlcNAc. (1984 - Torres C, Hart G) / Status : Reviewed
• Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
• Studies on heterogeneity of Taka-amylase A: isolation of an amylase having one N-acetylglucosamine residue as the sugar chain. (1982 - Hase S, Fujimura K, Kanoh M, Ikenaka T) / Status : Reviewed
• Structure of O-glycosidically linked sugar units from plasma membranes of an ascites hepatoma, AH 66. (1982 - Funakoshi I, Yamashina I) / Status : Reviewed
• Structure determination of oligosaccharides isolated from A+, H+ and A-H- hog-submaxillary-gland mucin glycoproteins, by 360-MHz 1H-NMR spectroscopy, permethylation analysis and mass spectrometry. (1981 - van Halbeek H, Dorland L, Haverkamp J, Veldink G, Vliegenthart J, Fournet B, Ricart G, Montreuil J, Gathmann W, Aminoff D) / Status : Reviewed
• Isolation and characterization of mosquito cell membrane glycoproteins. (1981 - Butters T, Hughes R) / Status : Reviewed
• Structural studies on cutinase, a glycoprotein containing novel amino acids and glucuronic acid amide at the N terminus. (1980 - Lin T, Kolattukudy P) / Status : Reviewed
• Chemical structure of epiglycanin, the major glycoprotein of the TA3-Ha ascites cell. The carbohydrate chains. (1979 - van den Eijnden D, Evans N, Codington J, Reinhold V, Silber C, Jeanloz R) / Status : Reviewed
• Glycoproteins and blood group activity. Isolation and characterization of oligosaccharides of H+ hog submaxillary glycoprotein, and their comparison to those found in A+ and A-H- glycoproteins. (1979 - Aminoff D, Gathmann WD, Baig MM) / Status : Reviewed
• Glycoproteins and blood group activity. Oligosaccharides of A+ hog submaxillary glycoproteins. (1979 - Aminoff D, Baig MM, Gathmann WD) / Status : Reviewed
• Immunochemical studies on blood groups. Immunochemical properties of B-active and non-B-active blood group substances from horse gastric mucosae and the relative size distributions of oligosaccharides liberated by base-borohydride. (1976 - Newman W, Kabat E) / Status : Reviewed
• Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
• Immunochemical and chemical investigations of the structure of glycoprotein fragments obtained from epiglycanin, a glycoprotein at the surface of the TA3-Ha cancer cell. (1975 - Codington J, Linsley K, Jeanlot R) / Status : Reviewed
• Intestinal glycoproteins of germfree rats. IV. Oligosaccharides obtained by chemical degradation of a water-soluble glycoprotein fraction. (1975 - Wold J, Smestad B, Midtvedt T) / Status : Reviewed
• The polypeptides of adenovirus. VI. Early and late glycopolypeptides. (1974 - Ishibashi M, Maizel J) / Status : Reviewed
• Structure of the carbohydrate units of IgA1 immunoglobulin. II. Stucture of the O-glycosidically linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed
• Structural studies on human erythrocyte glycoproteins. Alkali-labile oligosaccharides. (1969 - Thomas D, Winzler R) / Status : Reviewed
• Structures and immunochemical properties of oligosaccharides isolated from pig submaxillary mucins. (1968 - Carlson D) / Status : Reviewed
• Physical and chemical studies on glycoproteins. II. Isolation and characterization of oligosaccharides from porcine submaxillary glycoproteins. (1968 - Katzman RL, Eylar EH) / Status : Reviewed

Reported glycosite

• Alpha crystallin - a and b chains / Homo sapiens
  •        Undefined site
• Assembly protein-3 (ap3) / Homo sapiens
  •        Undefined site
• Chromogranin a / Homo sapiens
  •        Thr-251
• Erythropoietin / Homo sapiens
  •        Undefined site
  •        Ser-153
• Estrogen receptor / Homo sapiens
  •        Undefined site
• Glycophorin a and b / Homo sapiens
  •        Undefined site
• Glycoprotein ln / Homo sapiens
  •        Undefined site
• Glycoprotein rg / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Ser-105
• Interleukin-2 [mu30] / Homo sapiens
  •        Undefined site
• Interleukin-2 [mu32] / Homo sapiens
  •        Undefined site
• Keratin, type i cytoskeletal 13 / Homo sapiens
  •        Undefined site
• Keratin, type i cytoskeletal 18 / Homo sapiens
  •        Ser-29
  •        Ser-30
  •        Ser-48
• Keratin, type II cytoskeletal 8 / Homo sapiens
  •        Undefined site
• Leukosialin (cd43) / Homo sapiens
  •        Undefined site
• Low-density lipoprotein receptor / Homo sapiens
  •        Undefined site
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Undefined site
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Undefined site
• Microfibrillar-associated protein 5 / Homo sapiens
  •        Thr-54
• Mucin / Homo sapiens
  •        Undefined site
• Mucin - mg2 / Homo sapiens
  •        Undefined site
• Mucin-1 / Homo sapiens
  •        Undefined site
• Myc proto-oncogene protein / Homo sapiens
  •        Thr-58
• Nucleoporin p62 / Homo sapiens
  •        Undefined site
• P65 / Homo sapiens
  •        Undefined site
• Prosaposin / Homo sapiens
  •        Undefined site
• Protein 4.1 / Homo sapiens
  •        Undefined site
• Protein yipf3 / Homo sapiens
  •        Thr-346
• Proteoglycan 4 (lubricin) / Homo sapiens
  •        Ser-306
  •        Thr-324
  •        Thr-332
  •        Ser-427
  •        Ser-529
  •        Thr-532
  •        Thr-627
  •        Ser-812
  •        Thr-900
  •        Ser-962
  •        Thr-963
  •        Thr-968
  •        Thr-975
  •        Thr-980
  •        Thr-1161
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Serum response factor (srf) / Homo sapiens
  •        Ser-277
  •        Ser-316
• Thrombopoietin / Homo sapiens
  •        Undefined site
• Transcription factor sp1 / Homo sapiens
  •        Undefined site
• Transferrin receptor protein 1 / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Erythrocyte / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Erythrocyte / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Erythrocyte Membrane / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Fluid / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Alpha crystallin - a and b chains / Bos taurus
  •        Ser-162
• Alpha crystallin a chain (a1 subunit) / Bos taurus
  •        Ser-162
• Alpha crystallin a chain (a2 subunit) / Bos taurus
  •        Ser-162
• Alpha crystallin b chain (b1 subunit) / Bos taurus
  •        Undefined site
• Alpha crystallin b chain (b2 subunit) / Bos taurus
  •        Undefined site
• Ankyrin g (480 kDa) / Bos taurus
  •        Undefined site
• Apolipoprotein e / Bos taurus
  •        Thr-32
  •        Ser-310
• Estrogen receptor / Bos taurus
  •        Undefined site
• Fetuin-b / Bos taurus
  •        Thr-292
• Fibrinogen beta chain / Bos taurus
  •        Thr-4
• Gp-3 / Bos taurus
  •        Undefined site
• Insulin-like growth factor II / Bos taurus
  •        Thr-106
• Inter-alpha-trypsin inhibitor heavy chain h1 / Bos taurus
  •        Ser-643
• Inter-alpha-trypsin inhibitor heavy chain h4 / Bos taurus
  •        Ser-683
  •        Thr-705
• Lactophorin / Bos taurus
  •        Thr-104
• Mucin / Bos taurus
  •        Undefined site
• Plasma serine protease inhibitor / Bos taurus
  •        Thr-36
• Synapsin i / Bos taurus
  •        Undefined site
• Mucin / Equus caballus
  •        Undefined site
• Alpha crystallin - a and b chains / Macaca mulatta
  •        Undefined site
• ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
  •        Asn-223
• BDNF/NT-3 growth factors receptor / Mus musculus
  •        Asn-121
  •        Asn-241
• Cadherin-13 / Mus musculus
  •        Asn-598
• Carboxypeptidase E / Mus musculus
  •        Asn-139
  •        Asn-390
• Choline transporter-like protein 1 / Mus musculus
  •        Asn-134
• Contactin-2 / Mus musculus
  •        Asn-78
• Contactin-associated protein 1 / Mus musculus
  •        Asn-764
• CUB and sushi domain-containing protein 3 / Mus musculus
  •        Asn-2711
• Embigin / Mus musculus
  •        Asn-70
• Epiglycanin / Mus musculus
  •        Undefined site
• Estrogen receptor / Mus musculus
  •        Thr-575
• Estrogen receptor beta / Mus musculus
  •        Undefined site
  •        Ser-61
• Gamma-glutamyltransferase 7 / Mus musculus
  •        Asn-198
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus
  •        Asn-368
• Isoform 2 of Teneurin-3 / Mus musculus
  •        Asn-860
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-968
• Isoform 3 of Neuroplastin / Mus musculus
  •        Asn-112
• Isoform 9 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
  •        Asn-517
• Leucine-rich repeat-containing protein 4 / Mus musculus
  •        Asn-362
• Muc2 / Mus musculus
  •        Undefined site
• Neurofascin / Mus musculus
  •        Asn-446
  •        Asn-866
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-217
  •        Asn-501
• Neuroplastin / Mus musculus
  •        Asn-196
• Nucleoporin p62 / Mus musculus
  •        Undefined site
• Opioid-binding protein/cell adhesion molecule / Mus musculus
  •        Asn-70
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-1826
• Prosaposin / Mus musculus
  •        Asn-459
• Prostaglandin g/h synthase 2 / Mus musculus
  •        Asn-396
  •        Asn-580
• Reticulocalbin-1 / Mus musculus
  •        Asn-47
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-92
  •        Asn-168
  •        Asn-246
  •        Asn-271
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-118
  •        Asn-153
  •        Asn-238
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Uncharacterized protein from B-Lymphocyte / Mus musculus
  •        Undefined site
• Uncharacterized protein from T-Lymphocyte / Mus musculus
  •        Undefined site
• Uncharacterized protein from T-Lymphocyte / Mus musculus
  •        Undefined site
• Uncharacterized protein from Thymocyte / Mus musculus
  •        Undefined site
• Brain non dialyzable glycopeptide / Oryctolagus cuniculus
  •        Undefined site
• P67 / Oryctolagus cuniculus
  •        Undefined site
• 56 kDa intrinsic membrane protein / Rattus norvegicus
  •        Undefined site
• Alpha crystallin - a and b chains / Rattus norvegicus
  •        Undefined site
• Mucin / Rattus norvegicus
  •        Undefined site
• Mucin-2 glycopeptide a / Rattus norvegicus
  •        Undefined site
• Mucin-2 glycopeptide b / Rattus norvegicus
  •        Undefined site
• Neurofilament triplet l protein / Rattus norvegicus
  •        Thr-20
  •        Ser-26
• Neurofilament triplet m protein / Rattus norvegicus
  •        Thr-47
  •        Thr-430
• Nuclear pore glycoprotein p62 / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Cell Membranes / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Cell Nuclei / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Cell Nuclei / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Cell Nuclei / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Cell Nuclei / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Liver / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Nucleus / Rattus norvegicus
  •        Undefined site
• Mucin / Sus scrofa
  •        Undefined site
• Talin / Sus scrofa
  •        Undefined site
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Mucin / Bufo arenarum
  •        Undefined site
• Mucin / Rana temporaria
  •        Undefined site
• Nucleoporin p62 / Xenopus laevis
  •        Undefined site
• H-antigen / Styela plicata
  •        Undefined site
• Glycophorin / Gallus gallus
  •        Undefined site
• Talin / Gallus gallus
  •        Thr-18
  •        Thr-27
• Alpha crystallin - a and b chains / Rhea americana
  •        Undefined site
• Alpha crystallin / Sturnus vulgaris
  •        Undefined site
• Fg / Autographa californica nucleopolyhedrovirus
  •        Undefined site
• Eg / Human adenovirus type 2
  •        Undefined site
• Fiber protein / Human adenovirus type 2
  •        Undefined site
• Lg / Human adenovirus type 2
  •        Undefined site
• Fiber protein / Human adenovirus type 5
  •        Undefined site
• Large structural phosphoprotein / Human cytomegalovirus (strain 751)
  •        Undefined site
• Large structural phosphoprotein / Human cytomegalovirus (strain ad169)
  •        Ser-921
  •        Ser-952
• Large structural phosphoprotein / Human cytomegalovirus (strain towne)
  •        Undefined site
• Large t antigen / Simian virus 40
  •        Undefined site
• Serine-rich 25 kDa antigen protein / Entamoeba histolytica
  •        Undefined site
• Rna polymerase II (Pol II) / Unspecified eukaryote/s
  •        Undefined site
• Alpha-amylase a / Aspergillus oryzae
  •        Asn-218
• Hirudin p6 / Hirudinaria manillensis
  •        Thr-43
• Uncharacterized protein from Cell Surface / Aedes aegypti
  •        Undefined site
• Mucin d, gp-b (80 kDa) / Drosophila melanogaster
  •        Undefined site
• Diptericin-D / Protophormia terraenovae
  •        Thr-72
• Gp96/92 / Leishmania major
  •        Undefined site
• 35/50 kDa surface glycoprotein / Trypanosoma cruzi
  •        Undefined site
• Mucin / Trypanosoma cruzi
  •        Undefined site
• Synthetic peptide: kppttttttttkpp / Trypanosoma cruzi
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Trypanosoma cruzi
  •        Undefined site
• Coagulation factor x / Tropidechis carinatus
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)
  •        Undefined site
• Cutinase / Fusarium solani f. sp. pisi
  •        Undefined site
• Coat protein / Plum pox virus (strain r)
  •        Undefined site
• Uncharacterized protein from Whole Organism / Schistosoma mansoni
  •        Undefined site

Mass spectrometry observed peptide

• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42
• VVRPDSELGERPPEDNQSFQYDHEAFLGK (29aa)
  •    Q05186    Asn-47
• VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
  •    Q05186    Asn-47
• VAWLNR (6aa)
  •    G5E8G3    Asn-70
• SNVSVEENVILEKPSHVELK (20aa)
  •    P21995    Asn-70
• MNGTEMNLEPGSR (13aa)
  •    Q61330    Asn-78
• IRNVSDTTK (9aa)
  •    P97797    Asn-92
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92
• ANATIEVK (8aa)
  •    P97300-3    Asn-112
• FLEPYNDSIQAQK (13aa)
  •    P14231    Asn-118
• HINFTR (6aa)
  •    P15209    Asn-121
• FAEINGSALCSYNIKPSEYTLTSK (24aa)
  •    Q6X893    Asn-134
• GNETIVNLIHSTR (13aa)
  •    Q00493    Asn-139
• RACQFNR (7aa)
  •    P14231    Asn-153
• ACQFNR (6aa)
  •    P14231    Asn-153
• VNFTCK (6aa)
  •    P97797    Asn-168
• KNASNMEYR (9aa)
  •    P97300    Asn-196
• RNESHLIDFR (10aa)
  •    Q99JP7    Asn-198
• FNHTQTIQQK (10aa)
  •    Q810U4    Asn-217
• NSTFGSVEVFSLDPNKVHK (19aa)
  •    P56528    Asn-223
• KFHVNYTQPLVAVK (14aa)
  •    P14231    Asn-238
• FHVNYTQPLVAVK (13aa)
  •    P14231    Asn-238
• HMNETSHTQGSLR (13aa)
  •    P15209    Asn-241
• GIANLSNFIR (10aa)
  •    P97797    Asn-246
• VTQQSPTSMNQVNLTCR (17aa)
  •    P97797    Asn-271
• DLNISEDR (8aa)
  •    Q99PH1    Asn-362
• KLVQVGIYNGTHVIPNDR (18aa)
  •    P35438    Asn-368
• DLQGNPIANATISVDGIDHDVTSAK (25aa)
  •    Q00493    Asn-390
• VILYNR (6aa)
  •    Q810U3    Asn-446
• LVLYLEHNLEKNSTKEEILAALEK (24aa)
  •    Q61207    Asn-459
• GSALHEDIYVLHDNGTLEIPVAQK (24aa)
  •    Q810U4    Asn-501
• EICSGNSSQCAPNVHK (16aa)
  •    Q9R1V6-11    Asn-517
• NLSVVILGASDKDLHPNTDPFKFEIHK (27aa)
  •    Q9WTR5    Asn-598
• GLLTFVDHLPVTQVVVGDTNR (21aa)
  •    O54991    Asn-764
• ISFLIGSDSTHVLPGESPFNK (21aa)
  •    Q9WTS6-2    Asn-860
• YVPFNGTK (8aa)
  •    Q810U3    Asn-866
• QSCITEQTQYFFKNDTK (17aa)
  •    O08532-4    Asn-968
• NSTTLVMHMK (10aa)
  •    Q91ZX7    Asn-1826
• IVNGSHYEYK (10aa)
  •    Q80T79    Asn-2711