taxonomy (39)
protein (223)
source (88)
structure (5)
composition (1)
disease (25)
reference (123)
site (373)
peptide (236)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Equus caballus (Domestic horse)
- Macaca mulatta (Rhesus monkey)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Bufo arenarum
- Rana temporaria (Common frog)
- Xenopus laevis (African clawed frog)
- Styela plicata (Sea squirt)
- Gallus gallus (Chicken)
- Rhea americana (Greater rhea)
- Sturnus vulgaris (Common starling)
- Autographa californica nucleopolyhedrovirus
- Human adenovirus type 2
- Human adenovirus type 5
- Human cytomegalovirus (strain 751)
- Human cytomegalovirus (strain ad169)
- Human cytomegalovirus (strain towne)
- Simian virus 40
- Entamoeba histolytica
- Unspecified eukaryote/s
- Aspergillus oryzae
- Hirudinaria manillensis (Leech)
- Aedes aegypti (Yellow fever mosquito)
- Drosophila melanogaster (Fruit fly)
- Protophormia terraenovae (Nestling-sucking blowfly)
- Leishmania major
- Trypanosoma cruzi
- Tropidechis carinatus (Australian rough-scaled snake)
- Friend spleen focus-forming virus
- Friend spleen focus-forming virus (gm1.2.3 mutant)
- Friend spleen focus-forming virus (gm3.4 mutant)
- Fusarium solani f. sp. pisi
- Plum pox virus (strain r)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Schistosoma mansoni
Taxonomy
- Actin-binding LIM protein 1 / Homo sapiens O14639
- Alpha crystallin - a and b chains / Homo sapiens P02489 P02511
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-synuclein / Homo sapiens P37840
- Ankyrin-1 / Homo sapiens P16157
- Ataxin-2-like protein / Homo sapiens Q8WWM7
- Band 3 anion transport protein / Homo sapiens P02730
- BRCA2-interacting transcriptional repressor EMSY / Homo sapiens Q7Z589
- Carbonic anhydrase 1 / Homo sapiens P00915
- Catalase / Homo sapiens P04040
- CDKN2A-interacting protein / Homo sapiens Q9NXV6
- Chromogranin a / Homo sapiens P10645
- Clathrin coat assembly protein AP180 / Homo sapiens O60641
- Coagulation factor V / Homo sapiens P12259
- Cyclin-dependent kinase 12 / Homo sapiens Q9NYV4
- E3 SUMO-protein ligase RanBP2 / Homo sapiens P49792
- Early growth response protein 1 / Homo sapiens P18146
- Equilibrative nucleoside transporter 1 / Homo sapiens Q99808
- Erythrocyte membrane protein band 4.2 / Homo sapiens P16452
- Erythropoietin / Homo sapiens P01588
- Estrogen receptor / Homo sapiens P03372
- Eukaryotic translation initiation factor 4 gamma 1 / Homo sapiens Q04637
- F-actin-capping protein subunit alpha-3 / Homo sapiens Q96KX2
- Forkhead box protein O1 / Homo sapiens Q12778
- Glucocorticoid modulatory element-binding protein 2 / Homo sapiens Q9UKD1
- Glutamine and serine-rich protein 1 / Homo sapiens Q2KHR3
- Glutathione S-transferase omega-1 / Homo sapiens P78417
- Glycophorin a and b / Homo sapiens P06028 P02724
- Glycoprotein ln / Homo sapiens
- Glycoprotein rg / Homo sapiens
- Haptoglobin / Homo sapiens P00738
- Hemoglobin subunit alpha / Homo sapiens P69905
- Hemoglobin subunit beta / Homo sapiens P68871
- Histone H3 / Homo sapiens P68431
- Host Cell Factor 1 / Homo sapiens P51610
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Inhibitor of nuclear factor kappa-B kinase subunit beta / Homo sapiens O14920
- Interleukin-2 [mu30] / Homo sapiens P60568
- Interleukin-2 [mu32] / Homo sapiens P60568
- KAT8 regulatory NSL complex subunit 3 / Homo sapiens Q9P2N6
- Keratin, type I cytoskeletal 13 / Homo sapiens P13646
- Keratin, type i cytoskeletal 18 / Homo sapiens P05783
- Keratin, type II cytoskeletal 8 / Homo sapiens P05787
- Leukosialin (cd43) / Homo sapiens P16150
- Low-density lipoprotein receptor / Homo sapiens P01130
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- MAX gene-associated protein / Homo sapiens Q8IWI9
- Microfibrillar-associated protein 5 / Homo sapiens Q13361
- Microtubule-associated protein tau / Homo sapiens P10636
- Msx2-interacting protein / Homo sapiens Q96T58
- Mucin-1 / Homo sapiens P15941
- Mucin-7 / Homo sapiens Q8TAX7
- Myc proto-oncogene protein / Homo sapiens P01106
- Myocyte-specific enhancer factor 2D / Homo sapiens Q14814
- Neuroblast differentiation-associated protein AHNAK / Homo sapiens Q09666
- Nuclear envelope pore membrane protein POM 121 / Homo sapiens Q96HA1
- Nuclear factor related to kappa-B-binding protein / Homo sapiens Q6P4R8
- Nuclear mitotic apparatus protein 1 / Homo sapiens Q14980
- Nuclear pore complex protein Nup153 / Homo sapiens P49790
- Nuclear pore complex protein Nup214 / Homo sapiens P35658
- Nuclear pore complex protein Nup98-Nup96 isoform 4 / Homo sapiens P52948-4
- Nuclear receptor corepressor 1 / Homo sapiens O75376
- Nucleoporin p62 / Homo sapiens P37198
- Nucleoprotein TPR / Homo sapiens P12270
- Nucleosome-remodeling factor subunit BPTF / Homo sapiens Q12830
- PDZ and LIM domain protein 7 isoform 4 / Homo sapiens Q9NR12-4
- Perilipin-4 / Homo sapiens Q96Q06
- Pleckstrin homology domain containing, family A member 5 / Homo sapiens Q9HAU0
- Pogo transposable element with ZNF domain isoform 2 / Homo sapiens Q7Z3K3-2
- Polyhomeotic-like protein 3 / Homo sapiens Q8NDX5
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prelamin-A/C isoform 3 / Homo sapiens P02545-3
- Prosaposin / Homo sapiens P07602
- Protein 4.1 / Homo sapiens P11171
- Protein lin-54 homolog / Homo sapiens Q6MZP7
- Protein PRRC2C / Homo sapiens Q9Y520
- Protein SON / Homo sapiens P18583-1
- Protein strawberry notch homolog 1 / Homo sapiens A3KN83
- Protein YIPF3 / Homo sapiens Q9GZM5
- Proteoglycan 4 (lubricin) / Homo sapiens Q92954
- RanBP2-like and GRIP domain-containing protein 4 / Homo sapiens Q7Z3J3
- Ras-associated and pleckstrin homology domains-containing protein 1 / Homo sapiens Q70E73
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Regulation of nuclear pre-mRNA domain-containing protein 2 / Homo sapiens Q5VT52
- Ribosomal RNA processing protein 1 homolog B / Homo sapiens Q14684
- RNA binding motif protein 27 / Homo sapiens Q9P2N5
- RNA-binding protein 14 / Homo sapiens Q96PK6
- Serine/arginine repetitive matrix protein 2 / Homo sapiens Q9UQ35
- Serine/threonine-protein kinase WNK1 / Homo sapiens Q9H4A3
- Serum response factor (srf) / Homo sapiens P11831
- Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens P11166
- Spectrin alpha chain, erythrocytic 1 / Homo sapiens P02549
- Spectrin beta chain, erythrocytic / Homo sapiens P11277
- Synaptopodin / Homo sapiens Q8N3V7
- TBP-associated factor 4 / Homo sapiens O00268
- Thrombopoietin / Homo sapiens P40225
- Transcription factor sp1 / Homo sapiens P08047
- Transcriptional repressor p66-beta / Homo sapiens Q8WXI9
- Transferrin receptor protein 1 / Homo sapiens P02786
- Ubiquitin-associated protein 2-like / Homo sapiens Q14157
- Uncharacterized protein / Homo sapiens
- Uncharacterized protein / Homo sapiens
- Uncharacterized protein from Meconium / Homo sapiens
- Uncharacterized protein from Ovary / Homo sapiens
- Unspecified mucin / Homo sapiens
- Vimentin / Homo sapiens P08670
- YTH domain-containing family protein 1 / Homo sapiens Q9BYJ9
- YTH domain-containing family protein 3 / Homo sapiens Q7Z739
- Zinc finger CCCH domain-containing protein 14 isoform 2 / Homo sapiens Q6PJT7-2
- Zinc finger protein 281 / Homo sapiens Q9Y2X9
- Zinc finger protein 40 / Homo sapiens P15822
- Zinc finger RNA-binding protein / Homo sapiens Q96KR1
- Zinc fingers and homeoboxes protein 1 / Homo sapiens Q9UKY1
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Alpha crystallin - a and b chains / Bos taurus P02510 P02470
- Alpha crystallin a chain (a1 subunit) / Bos taurus P02470
- Alpha crystallin a chain (a2 subunit) / Bos taurus P02470
- Alpha crystallin b chain (b1 subunit) / Bos taurus P02510
- Alpha crystallin b chain (b2 subunit) / Bos taurus P02510
- Ankyrin 3 / Bos taurus E1BNC9
- Apolipoprotein E / Bos taurus Q03247
- Estrogen receptor / Bos taurus P49884
- Fetuin-b / Bos taurus Q58D62
- Fibrinogen beta chain / Bos taurus P02676
- Gp-3 / Bos taurus
- Insulin-like growth factor II / Bos taurus P07456
- Inter-alpha-trypsin inhibitor heavy chain h1 / Bos taurus Q0VCM5
- Inter-alpha-trypsin inhibitor heavy chain h4 / Bos taurus Q3T052
- Lactophorin / Bos taurus P80195
- Mucin / Bos taurus
- Plasma serine protease inhibitor / Bos taurus Q9N2I2
- Synapsin-1 / Bos taurus P17599
- Mucin / Equus caballus
- Alpha crystallin - a and b chains / Macaca mulatta P02488
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus P56528
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Cadherin-13 / Mus musculus Q9WTR5
- Carboxypeptidase E / Mus musculus Q00493
- Choline transporter-like protein 1 / Mus musculus Q6X893
- Contactin-2 / Mus musculus Q61330
- Contactin-associated protein 1 / Mus musculus O54991
- CUB and sushi domain-containing protein 3 / Mus musculus Q80T79
- Embigin / Mus musculus P21995
- Epiglycanin / Mus musculus D9N008
- Estrogen receptor / Mus musculus P19785
- Estrogen receptor beta / Mus musculus O08537
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Isoform 2 of Teneurin-3 / Mus musculus Q9WTS6-2
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Isoform 3 of Neuroplastin / Mus musculus P97300-3
- Isoform 9 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-11
- Leucine-rich repeat-containing protein 4 / Mus musculus Q99PH1
- Muc2 / Mus musculus
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuroplastin / Mus musculus P97300
- Nucleoporin p62 / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus G5E8G3
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Prostaglandin g/h synthase 2 / Mus musculus Q05769
- Reticulocalbin-1 / Mus musculus Q05186
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Uncharacterized protein / Mus musculus
- Uncharacterized protein / Mus musculus
- Uncharacterized protein from Thymus / Mus musculus
- Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- P67 / Oryctolagus cuniculus
- 56 kDa intrinsic membrane protein / Rattus norvegicus
- Alpha crystallin - a and b chains / Rattus norvegicus P24623 P23928
- Mucin / Rattus norvegicus
- Mucin-2 glycopeptide a / Rattus norvegicus Q62635
- Mucin-2 glycopeptide b / Rattus norvegicus Q62635
- Neurofilament triplet l protein / Rattus norvegicus P19527
- Neurofilament triplet m protein / Rattus norvegicus P12839
- Nuclear pore glycoprotein p62 / Rattus norvegicus P17955
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein from Brain / Rattus norvegicus
- Uncharacterized protein from Liver / Rattus norvegicus
- Uncharacterized protein from Liver / Rattus norvegicus
- Mucin / Sus scrofa
- Talin-1 / Sus scrofa F1SFZ8
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Mucin / Bufo arenarum
- Mucin / Rana temporaria
- Nucleoporin p62 / Xenopus laevis
- H-antigen / Styela plicata
- Glycophorin / Gallus gallus
- Talin / Gallus gallus P54939
- Alpha crystallin - a and b chains / Rhea americana P02505
- Alpha crystallin / Sturnus vulgaris
- Fg / Autographa californica nucleopolyhedrovirus
- Eg / Human adenovirus type 2
- Fiber protein / Human adenovirus type 2 P03275
- Lg / Human adenovirus type 2
- Fiber protein / Human adenovirus type 5 P11818
- Large structural phosphoprotein / Human cytomegalovirus (strain 751)
- Large structural phosphoprotein / Human cytomegalovirus (strain ad169) P08318
- Large structural phosphoprotein / Human cytomegalovirus (strain towne)
- Large t antigen / Simian virus 40 P03070
- Serine-rich 25 kDa antigen protein / Entamoeba histolytica P21138
- Rna polymerase II (Pol II) / Unspecified eukaryote/s
- Alpha-amylase a / Aspergillus oryzae P0C1B3
- Hirudin p6 / Hirudinaria manillensis P28512
- Uncharacterized protein / Aedes aegypti
- Mucin d, gp-b (80 kDa) / Drosophila melanogaster
- Diptericin-D / Protophormia terraenovae P18684
- Glycoprotein 96-92 / Leishmania major Q4Q843
- 35/50 kDa surface glycoprotein / Trypanosoma cruzi
- Mucin / Trypanosoma cruzi
- Synthetic peptide: kppttttttttkpp / Trypanosoma cruzi
- Uncharacterized protein / Trypanosoma cruzi
- Coagulation factor x / Tropidechis carinatus P81428
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant) P03393
- Cutinase / Fusarium solani f. sp. pisi P00590
- Coat protein / Plum pox virus (strain r)
- Uncharacterized protein / Schistosoma mansoni
Protein
- Anterior Lobe of Cerebellum (UBERON_0002131)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Body Fluid (UBERON_0006314)
- Brain (UBERON_0000955) C-1300 clone N18 (CVCL_4724)
- Brain (UBERON_0000955) C-1300 clone S20 (CVCL_VU14)
- Brain (UBERON_0000955) NB41A3 (CVCL_3553)
- Brain (UBERON_0000955) Neuro-2a (CVCL_0470)
- Brain (UBERON_0000955)
- Brain (UBERON_0000955) Nucleus (GO_0005634)
- Colon (UBERON_0001155) HT-29 (CVCL_0320)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Embryo (UBERON_0000922)
- Frontal Cortex (UBERON_0001870)
- Gizzard Smooth Muscle (UBERON_0011903)
- Hemolymph (UBERON_0001011)
- Intestinal Mucosa
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113) COS-7 (CVCL_0224)
- Kidney (UBERON_0002113) CV-1 (CVCL_0229)
- Kidney (UBERON_0002113) NRK (CVCL_3758)
- Large Intestine (UBERON_0000059)
- Lens of Camera-Type Eye (UBERON_0000965)
- Liver (UBERON_0002107) AH66-TC (CVCL_4368) Plasma Membrane (GO_0005886)
- Liver (UBERON_0002107) BRL (CVCL_4565) Nucleus (GO_0005634)
- Liver (UBERON_0002107)
- Liver (UBERON_0002107) Nucleus (GO_0005634)
- Lung (UBERON_0002048) Nucleus (GO_0005634)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mammary Gland (UBERON_0001911) T-47D (CVCL_0553)
- Mammary Gland (UBERON_0001911) TA3/Ha (CVCL_4321)
- Meconium (UBERON_0007109)
- Middle Frontal Gyrus (UBERON_0002702)
- Milk (UBERON_0001913)
- Mucosa (UBERON_0000344) 67j25D (CVCL_Z425)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Mucosa of Stomach (UBERON_0001199)
- Myocardium (UBERON_0002349) Nucleus (GO_0005634)
- Outer Epithelium (UBERON_0007376) Foreskin Keratinocyte (CL_1001606)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Placenta (UBERON_0001987) BeWo (CVCL_0044) Epithelium (CL_0002577)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Prepuce of Penis (UBERON_0001332) Fibroblast (CL_0000057)
- Saliva (UBERON_0001836)
- Saliva-Secreting Gland (UBERON_0001044)
- Skin of Body (UBERON_0002097) A-431 (CVCL_0037) Fibroblast (CL_0000057)
- Small Intestine (UBERON_0002108)
- Stomach Smooth Muscle (UBERON_0004222)
- Submandibular Gland (UBERON_0001736)
- Synovial Fluid (UBERON_0001090)
- Thymus (UBERON_0002370) Platelet (CL_0000233)
- Thyroid (UBERON_0002046)
- Urine (UBERON_0001088)
- Uterine Cervix (UBERON_0000002) Detroit 98/AH-2 (CVCL_8190)
- Uterine Cervix (UBERON_0000002) HEp-2 (CVCL_1906)
- Uterine Cervix (UBERON_0000002) HeLa (CVCL_0030) Fibroblast (CL_0000057)
- Uterine Cervix (UBERON_0000002) HeLa (CVCL_0030)
- Uterus (UBERON_0000995)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- CCRF-CEM (CVCL_0207) T-Lymphocyte (CL_0000084)
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- HeLa (CVCL_0030)
- LSTM-AA-20A (CVCL_Z354) Cell Surface (GO_0009986)
- Rat1 (CVCL_0492)
- Schneider 2 (CVCL_Z232)
- B-Lymphocyte (CL_0000236)
- Egg Cell
- Egg Cell Jelly Coat
- Erythrocyte (CL_0000232)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Fibroblast (CL_0000057)
- Leukocyte (CL_0000738)
- Reticulocyte (CL_0000558)
- T-Lymphocyte (CL_0000084)
- Cell Surface (GO_0009986)
- Cytoplasm (GO_0005737)
- Cytoplasmic Vesicle (GO_0031410)
- Neurofilament (GO_0005883)
- Node of Ranvier (GO_0033268)
- Nucleus (GO_0005634)
- Plasma Membrane (GO_0005886)
Source
- N-Linked / Truncated / GlcNAc
- N-Linked/O-Linked / Truncated If N-Linked / GlcNAc
- O-Linked / Core 0 / GalNAc
- O-Linked / Core 1 / Structure 9641
- O-Linked / O-GlcNAc / GlcNAc(b
Reported structure
- HexNAc:1 (avg mass : 221.2103 )
Composition
- Adenocarcinoma (DOID:299)
- Adenocarcinoma, Grade II (DOID:299)
- Alzheimer's disease (DOID:10652)
- Anemia, Aplastic (DOID:12449)
- Arthritis, Rheumatoid (DOID:7148)
- Cancer, breast (DOID:1612)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Carcinoid Tumor, with multiple liver metastasis
- Carcinoma (DOID:305)
- Carcinoma, Hepatocellular (DOID:684)
- Carcinoma, Squamous cell (DOID:1749)
- Choriocarcinoma (DOID:3594)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Erythroleukemia with associated Polycythemia
- Leukemia, Acute lymphoblastic and HIV-1
- Leukemia, Myloid, Chronic (DOID:8552)
- Malaria Tropica, Malignant (DOID:14067)
- Multiple myeloma (DOID:9538)
- Neuroblastoma (DOID:769)
- Osteoarthritis (DOID:8398)
- Ovarian cyst (DOID:5119)
- Tn Polyagglutinability Syndrome (DOID:0080520)
Disease
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Site-specific O-glycosylation analysis of SARS-CoV-2 spike protein produced in insect and human cells (2021 - Ieva Bagdonaite, Andrew J. Thompson, Xiaoning Wang, Max Søgaard, Cyrielle Fougeroux, Martin Frank, Jolene K. Diedrich, John R. Yates 3rd, Ali Salanti, Sergey Y. Vakhrushev, James C. Paulson, Hans H. Wandall) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed
- Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Naturally Occurring Structural Isomers in Serum IgA1 O-Glycosylation (2012 - Kazuo Takahashi, Archer D. Smith, IV, Knud Poulsen, Mogens Kilian, Bruce A. Julian, Jiri Mestecky, Jan Novak, Matthew B. Renfrow) / Status : Reviewed
- Modification of Histones by Sugar β-N-acetylglucosamine (GlcNAc) Occurs on Multiple Residues, Including Histone H3 Serine 10, and Is Cell Cycle-Regulated (2011 - Suisheng Zhang, Kevin Roche, Heinz-Peter Nasheuer, Noel Francis Lowndes) / Status : Reviewed
- Mapping O-GlcNAc modification sites on tau and generation of a site-specific O-GlcNAc tau antibody (2011 - Scott A Yuzwa, Anuj K Yadav, Yuliya Skorobogatko, Thomas Clark, Keith Vosseller, David J Vocadlo) / Status : Unreviewed
- Identification of O-GlcNAc sites within peptides of the Tau protein and their impact on phosphorylation (2011 - Caroline Smet-Nocca, Malgorzata Broncel, Jean-Michel Wieruszeski, Caroline Tokarski, Xavier Hanoulle, Arnaud Leroy, Isabelle Landrieu, Christian Rolando, Guy Lippens, Christian P R Hackenberger) / Status : Unreviewed
- Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed
- Affinity enrichment and characterization of mucin core-1 type glycopeptides from bovine serum (2009 - Darula Z, Medzihradszky KF.) / Status : Reviewed
- Site-specific GlcNAcylation of Human Erythrocyte Proteins: Potential Biomarker(s) for Diabetes (2009 - Zihao Wang, Kyoungsook Park, Frank Comer, Linda C Hsieh-Wilson, Christopher D Saudek, Gerald W Hart) / Status : Reviewed
- Loss of p53 Enhances Catalytic Activity of IKKbeta Through O-linked beta-N-acetyl Glucosamine Modification (2009 - Keiko Kawauchi, Keigo Araki, Kei Tobiume, Nobuyuki Tanaka) / Status : Reviewed
- O-GlcNAc Regulates FoxO Activation in Response to Glucose (2008 - Michael P Housley, Joseph T Rodgers, Namrata D Udeshi, Timothy J Kelly, Jeffrey Shabanowitz, Donald F Hunt, Pere Puigserver, Gerald W Hart) / Status : Reviewed
- The diversity of O-linked glycans expressed during Drosophila melanogaster development reflects stage- and tissue-specific requirements for cell signaling. (2008 - Kazuhiro Aoki, Mindy Porterfield, Samuel S Lee, Brian Dong, Khoi Nguyen, Katherine H McGlamry, Michael Tiemeyer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Occurrence of O-linked Xyl-GlcNAc and Xyl-Glc disaccharides in trocarin, a factor Xa homolog from snake venom (2003 - Joseph JS, Valiyavettil M, Gowda DC, Kini RM) / Status : Reviewed
- A novel sialylated and galactofuranose-containing O-linked glycan, Neu5Ac alpha2-5 Galp beta1-6 (Galf beta1-4) GlcNAc, is expressed on the sialoglycoprotein of Trypanosoma cruzi Dm28c (2003 - Agrellos OA, Jones C, Todeschini AR, Previato JO, Mendonca-Previato L) / Status : Reviewed
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- The capsid protein of a plant single-stranded RNA virus is modified by O-linked N-acetylglucosamine (2002 - Fernandez-Fernandez, Camafeita, Bonay, Mendez, Albar, Garcia) / Status : Reviewed
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- Characterization of the glycosylation sites in cyclooxygenase-2 using mass spectrometry. (2001 - Nemeth J, Hochgesang G, Marnett L, Caprioli R, Hochensang G) / Status : Reviewed
- Structure of O-glycosidically linked oligosaccharides from glycoproteins of Trypanosoma cruzi CL-Brener strain: evidence for the presence of O-linked sialyl-oligosaccharides. (2001 - Todeschini A, da Silveira E, Jones C, Wait R, Previato J, Mendona-Previato L) / Status : Reviewed
- Isolation and characterization of glycophorin from nucleated (chicken) erythrocytes. (2000 - Duk M, Krotkiewski H, Stasyk T, Lutsik-Kordovsky M, Syper D, Lisowska E) / Status : Reviewed
- Separation of Galfbeta1-->XGlcNAc and Galpbeta1-->XGlcNAc (X = 3, 4, and 6) as the alditols by high-pH anion-exchange chromatography and thin-layer chromatography: characterization of mucins from Trypanosoma cruzi. (2000 - Salto M, Gallo-Rodriguez C, Lima C, de Lederkremer R) / Status : Reviewed
- Alternative O-glycosylation/O-phosphorylation of the murine estrogen receptor beta. (2000 - Cheng X, Cole R, Zaia J, Hart G) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
- An evaluation of sialation of the nucleoporin p62. (1998 - Fang B, Hanover J, Miller M) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
- Phosphorylation and O-glycosylation sites of human chromogranin A (CGA79-439) from urine of patients with carcinoid tumors. (1998 - Gadroy P, Stridsberg M, Capon C, Michalski J, Strub J, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- Human low-molecular-weight salivary mucin expresses the sialyl lewisx determinant and has L-selectin ligand activity. (1998 - Prakobphol A, Thomsson K, Hansson G, Rosen S, Singer M, Phillips N, Medzihradszky K, Burlingame A, Leffler H, Fisher S) / Status : Reviewed
- Biosynthesis of O-N-acetylglucosamine-linked glycans in Trypanosoma cruzi. Characterization of the novel uridine diphospho-N-acetylglucosamine:polypeptide N-acetylglucosaminyltransferase-catalyzing formation of N-acetylglucosamine alpha1-->O-threonine. (1998 - Previato J, Sola-Penna M, Agrellos O, Jones C, Oeltmann T, Travassos L, Mendona-Previato L) / Status : Reviewed
- Reduction of O-linked N-acetylglucosamine-modified assembly protein-3 in Alzheimer's disease. (1998 - Yao P, Coleman P) / Status : Reviewed
- SV40 large T antigen is modified with O-linked N-acetylglucosamine but not with other forms of glycosylation. (1998 - Medina L, Grove K, Haltiwanger R) / Status : Reviewed
- Structure of the O-glycopeptides isolated from bovine milk component PP3. (1998 - Coddeville B, Girardet J, Plancke Y, Campagna S, Linden G, Spik G) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana temporaria. (1997 - Maes E, Florea D, Delplace F, Lemoine J, Plancke Y, Strecker G) / Status : Reviewed
- A subpopulation of estrogen receptors are modified by O-linked N-acetylglucosamine. (1997 - Jiang M, Hart G) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Identification of O-linked N-acetylglucosamine modification of ankyrinG isoforms targeted to nodes of Ranvier. (1996 - Zhang X, Bennett V) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Mucin-type glycoprotein from Drosophila melanogaster embryonic cells: characterization of carbohydrate component. (1996 - Kramerov A, Arbatsky N, Rozovsky Y, Mikhaleva E, Polesskaya O, Gvozdev V, Shibaev V) / Status : Reviewed
- Comparison of O-linked carbohydrate chains in MUC-1 mucin from normal breast epithelial cell lines and breast carcinoma cell lines. Demonstration of simpler and fewer glycan chains in tumor cells. (1996 - Lloyd KO, Burchell J, Kudryashov V, Yin BW, Taylor-Papadimitriou J) / Status : Reviewed
- The serine-rich Entamoeba histolytica protein is a phosphorylated membrane protein containing O-linked terminal N-acetylglucosamine residues. (1995 - Stanley Jr S, Tian K, Koester J, Li E) / Status : Reviewed
- c-Myc is glycosylated at threonine 58, a known phosphorylation site and a mutational hot spot in lymphomas. (1995 - Chou T, Hart G, Dang C) / Status : Reviewed
- Insect immunity. The inducible antibacterial peptide diptericin carries two O-glycans necessary for biological activity. (1995 - Bulet P, Hegy G, Lambert J, van Dorsselaer A, Hoffmann J, Hetru C) / Status : Reviewed
- Identification and mutational analysis of the glycosylation sites of human keratin 18. (1995 - Ku N, Omary M) / Status : Reviewed
- The lipid structure of the glycosylphosphatidylinositol-anchored mucin-like sialic acid acceptors of Trypanosoma cruzi changes during parasite differentiation from epimastigotes to infective metacyclic trypomastigote forms. (1995 - Serrano A, Schenkman S, Yoshida N, Mehlert A, Richardson J, Ferguson M) / Status : Reviewed
- Site-specific glycosylation of the human cytomegalovirus tegument basic phosphoprotein (UL32) at serine 921 and serine 952. (1994 - Greis K, Gibson W, Hart G) / Status : Reviewed
- O-glycosidically linked N-acetylglucosamine-bound oligosaccharides from glycoproteins of Trypanosoma cruzi. (1994 - Previato J, Jones C, Gonalves L, Wait R, Travassos L, Mendona-Previato L) / Status : Reviewed
- Altered sialylation of CD45 in HIV-1-infected T lymphocytes. (1994 - Lefebvre J, Giordanengo V, Doglio A, Cagnon L, Breittmayer J, Peyron J, Lesimple J) / Status : Reviewed
- Identification, characterisation and genomic cloning of a O-linked N-acetylglucosamine-containing cytoplasmic Leishmania glycoprotein. (1993 - Handman E, Barnett L, Osborn A, Goding J, Murray P) / Status : Reviewed
- Glycosylation of mammalian neurofilaments. Localization of multiple O-linked N-acetylglucosamine moieties on neurofilament polypeptides L and M. (1993 - Dong D, Xu Z, Chevrier M, Cotter R, Cleveland D, Hart G) / Status : Reviewed
- Biosynthesis and secretion of human interleukin 2 glycoprotein variants from baculovirus-infected Sf21 cells. Characterization of polypeptides and posttranslational modifications. (1993 - Grabenhorst E, Hofer B, Nimtz M, Jger V, Conradt H) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- Assignment of O-glycan attachment sites to the hinge-like regions of human lysosomal membrane glycoproteins lamp-1 and lamp-2. (1993 - Carlsson S, Lycksell P, Fukuda M) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
- Studies on O-glycans of Plasmodium-falciparum-infected human erythrocytes. Evidence for O-GlcNAc and O-GlcNAc-transferase in malaria parasites. (1993 - Dieckmann-Schuppert A, Bause E, Schwarz R) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1993 - Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- The cytoskeletal protein talin is O-glycosylated. (1992 - Hagmann J, Grob M, Burger M) / Status : Reviewed
- Primary structure and function of novel O-glycosylated hirudins from the leech Hirudinaria manillensis. (1992 - Steiner V, Knecht R, Brnsen K, Gassmann E, Stone S, Raschdorf F, Schlaeppi J, Maschler R) / Status : Reviewed
- O-linked oligosaccharides of glycophorins A and B in erythrocytes of two individuals with the Tn polyagglutinability syndrome. (1992 - Blumenfeld O, Lalezari P, Khorshidi M, Puglia K, Fukuda M) / Status : Reviewed
- Vertebrate lens alpha-crystallins are modified by O-linked N-acetylglucosamine. (1992 - Roquemore E, Dell A, Morris H, Panico M, Reason A, Savoy L, Wistow G, Zigler J, Earles B, Hart G) / Status : Reviewed
- Synapsins contain O-linked N-acetylglucosamine. (1991 - Luthi T, Haltiwanger R, Greengard P, Bahler M) / Status : Reviewed
- Characterization of oligosaccharide structures on a chimeric respiratory syncytial virus protein expressed in insect cell line Sf9. (1991 - Wathen M, Aeed P, Elhammer A) / Status : Reviewed
- Lymphocyte activation induces rapid changes in nuclear and cytoplasmic glycoproteins. (1991 - Kearse KP, Hart GW) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- The C-terminal domain of RNA polymerase II is modified by O-linked GlcNAc. (1991 - Kelly W, Dahmus M, Hart G) / Status : Reviewed
- Identification of O-GlcNAc attachment sites in transcription factors. (1991 - Reason A, Dell A, Morris H, Panico M, Treisman R, Marais R, Hart G, Haltiwanger R) / Status : Reviewed
- Bovine lens alpha-crystalline subunits are modified by O-linked GlcNAc. (1991 - Roquemore E, Dell A, Hart G) / Status : Reviewed
- Characterization and dynamics of O-linked glycosylation of human cytokeratin 8 and 18. (1991 - Chou C, Smith A, Omary M) / Status : Reviewed
- Nuclear localization of an O-glycosylated protein phosphotyrosine phosphatase from human cells. (1991 - Meikrantz W, Smith D, Sladicka M, Schlegel R) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Human transferrin receptor contains O-linked oligosaccharides. (1990 - Do S, Enns C, Cummings R) / Status : Reviewed
- Relative accessibility of N-acetylglucosamine in trimers of the adenovirus types 2 and 5 fiber proteins. (1990 - Mullis K, Haltiwanger R, Hart G, Marchase R, Engler J) / Status : Reviewed
- Glycosylation of eukaryotic peptide chain initiation factor 2 (eIF-2)-associated 67-kDa polypeptide (p67) and its possible role in the inhibition of eIF-2 kinase-catalyzed phosphorylation of the eIF-2 alpha-subunit. (1989 - Datta B, Ray M, Chakrabarti D, Wylie D, Gupta N) / Status : Reviewed
- Sugar sequences of allergenically active oligosaccharide alcohols isolated from a large-molecular-size sea squirt antigen termed H-antigen. (1989 - Ohta M, Shigeta S, Ono K, Takao T, Shimonishi Y, Oka S) / Status : Reviewed
- O-N-acetyl-D-glucosamine Moiety on Discrete Peptide of Multiple Protein 4.1 Isoforms Regulated by Alternative Pathways (1989 - M Inaba, Y Maede) / Status : Reviewed
- O-linked oligosaccharides from human serum immunoglobulin A1. (1989 - Field M, Dwek R, Edge C, Rademacher T) / Status : Reviewed
- Cytokeratin 13 contains O-glycosidically linked N-acetylglucosamine residues. (1989 - King I, Hounsell E) / Status : Reviewed
- O-glycosylation of eukaryotic transcription factors: implications for mechanisms of transcriptional regulation. (1988 - Jackson S, Tjian R) / Status : Reviewed
- Characterization of the N- and O-linked oligosaccharides in glycoproteins synthesized by Schistosoma mansoni schistosomula. (1988 - Nyame K, Cummings R, Damian R) / Status : Reviewed
- Intrinsic membrane glycoproteins with cytosol-oriented sugars in the endoplasmic reticulum. (1988 - Abeijon C, Hirschberg C) / Status : Reviewed
- Virion basic phosphoprotein from human cytomegalovirus contains O-linked N-acetylglucosamine. (1988 - Benko D, Haltiwanger R, Hart G, Gibson W) / Status : Reviewed
- Nuclear pore complex glycoproteins contain cytoplasmically disposed O-linked N-acetylglucosamine. (1987 - Holt G, Snow C, Senior A, Haltiwanger R, Gerace L, Hart G) / Status : Reviewed
- A nuclear specific glycoprotein representative of a unique pattern of glycosylation. (1987 - Schindler M, Hogan M, Miller R, DeGaetano D) / Status : Reviewed
- Nuclear pore complex contains a family of glycoproteins that includes p62: glycosylation through a previously unidentified cellular pathway. (1987 - Davis L, Blobel G) / Status : Reviewed
- Erythrocytes contain cytoplasmic glycoproteins. O-linked GlcNAc on Band 4.1. (1987 - Holt G, Haltiwanger R, Torres C, Hart G) / Status : Reviewed
- Schistosoma mansoni synthesizes glycoproteins containing terminal O-linked N-acetylglucosamine residues. (1987 - Nyame K, Cummings R, Damian R) / Status : Reviewed
- Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Structural variations of O-linked oligosaccharides present in leukosialin isolated from erythroid, myeloid, and T-lymphoid cell lines. (1986 - Carlsson S, Sasaki H, Fukuda M) / Status : Reviewed
- Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
- Topography and polypeptide distribution of terminal N-acetylglucosamine residues on the surfaces of intact lymphocytes. Evidence for O-linked GlcNAc. (1984 - Torres C, Hart G) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
- Structure of O-glycosidically linked sugar units from plasma membranes of an ascites hepatoma, AH 66. (1982 - Funakoshi I, Yamashina I) / Status : Reviewed
- Studies on heterogeneity of Taka-amylase A: isolation of an amylase having one N-acetylglucosamine residue as the sugar chain. (1982 - Hase S, Fujimura K, Kanoh M, Ikenaka T) / Status : Reviewed
- Structure determination of oligosaccharides isolated from A+, H+ and A-H- hog-submaxillary-gland mucin glycoproteins, by 360-MHz 1H-NMR spectroscopy, permethylation analysis and mass spectrometry. (1981 - van Halbeek H, Dorland L, Haverkamp J, Veldink G, Vliegenthart J, Fournet B, Ricart G, Montreuil J, Gathmann W, Aminoff D) / Status : Reviewed
- Isolation and characterization of mosquito cell membrane glycoproteins. (1981 - Butters T, Hughes R) / Status : Reviewed
- Structural studies on cutinase, a glycoprotein containing novel amino acids and glucuronic acid amide at the N terminus. (1980 - Lin T, Kolattukudy P) / Status : Reviewed
- Glycoproteins and blood group activity. Oligosaccharides of A+ hog submaxillary glycoproteins. (1979 - Aminoff D, Baig MM, Gathmann WD) / Status : Reviewed
- Glycoproteins and blood group activity. Isolation and characterization of oligosaccharides of H+ hog submaxillary glycoprotein, and their comparison to those found in A+ and A-H- glycoproteins. (1979 - Aminoff D, Gathmann WD, Baig MM) / Status : Reviewed
- Chemical structure of epiglycanin, the major glycoprotein of the TA3-Ha ascites cell. The carbohydrate chains. (1979 - van den Eijnden D, Evans N, Codington J, Reinhold V, Silber C, Jeanloz R) / Status : Reviewed
- Immunochemical studies on blood groups. Immunochemical properties of B-active and non-B-active blood group substances from horse gastric mucosae and the relative size distributions of oligosaccharides liberated by base-borohydride. (1976 - Newman W, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
- Immunochemical and chemical investigations of the structure of glycoprotein fragments obtained from epiglycanin, a glycoprotein at the surface of the TA3-Ha cancer cell. (1975 - Codington J, Linsley K, Jeanlot R) / Status : Reviewed
- Intestinal glycoproteins of germfree rats. IV. Oligosaccharides obtained by chemical degradation of a water-soluble glycoprotein fraction. (1975 - Wold J, Smestad B, Midtvedt T) / Status : Reviewed
- Structure of the carbohydrate units of IgA1 immunoglobulin. II. Stucture of the O-glycosidically linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed
- The polypeptides of adenovirus. VI. Early and late glycopolypeptides. (1974 - Ishibashi M, Maizel J) / Status : Reviewed
- Structural studies on human erythrocyte glycoproteins. Alkali-labile oligosaccharides. (1969 - Thomas D, Winzler R) / Status : Reviewed
- Physical and chemical studies on glycoproteins. II. Isolation and characterization of oligosaccharides from porcine submaxillary glycoproteins. (1968 - Katzman RL, Eylar EH) / Status : Reviewed
- Structures and immunochemical properties of oligosaccharides isolated from pig submaxillary mucins. (1968 - Carlson D) / Status : Reviewed
Reference
- Actin-binding LIM protein 1 / Homo sapiens
-
Alpha crystallin - a and b chains / Homo sapiens
- Undefined site
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-synuclein / Homo sapiens
- Ankyrin-1 / Homo sapiens
- Ataxin-2-like protein / Homo sapiens
- Band 3 anion transport protein / Homo sapiens
- BRCA2-interacting transcriptional repressor EMSY / Homo sapiens
- Carbonic anhydrase 1 / Homo sapiens
- Catalase / Homo sapiens
- CDKN2A-interacting protein / Homo sapiens
- Chromogranin a / Homo sapiens
-
Clathrin coat assembly protein AP180 / Homo sapiens
- Undefined site
- Coagulation factor V / Homo sapiens
- Cyclin-dependent kinase 12 / Homo sapiens
- E3 SUMO-protein ligase RanBP2 / Homo sapiens
- Early growth response protein 1 / Homo sapiens
- Equilibrative nucleoside transporter 1 / Homo sapiens
- Erythrocyte membrane protein band 4.2 / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
- Ser-153
-
Estrogen receptor / Homo sapiens
- Undefined site
- Eukaryotic translation initiation factor 4 gamma 1 / Homo sapiens
- F-actin-capping protein subunit alpha-3 / Homo sapiens
- Forkhead box protein O1 / Homo sapiens
- Glucocorticoid modulatory element-binding protein 2 / Homo sapiens
- Glutamine and serine-rich protein 1 / Homo sapiens
- Glutathione S-transferase omega-1 / Homo sapiens
-
Glycophorin a and b / Homo sapiens
- Undefined site
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Glycoprotein rg / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Hemoglobin subunit alpha / Homo sapiens
- Hemoglobin subunit beta / Homo sapiens
- Histone H3 / Homo sapiens
- Host Cell Factor 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Inhibitor of nuclear factor kappa-B kinase subunit beta / Homo sapiens
-
Interleukin-2 [mu30] / Homo sapiens
- Undefined site
-
Interleukin-2 [mu32] / Homo sapiens
- Undefined site
- KAT8 regulatory NSL complex subunit 3 / Homo sapiens
-
Keratin, type I cytoskeletal 13 / Homo sapiens
- Undefined site
- Keratin, type i cytoskeletal 18 / Homo sapiens
- Keratin, type II cytoskeletal 8 / Homo sapiens
-
Leukosialin (cd43) / Homo sapiens
- Undefined site
-
Low-density lipoprotein receptor / Homo sapiens
- Undefined site
-
Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Undefined site
-
Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Undefined site
- MAX gene-associated protein / Homo sapiens
- Microfibrillar-associated protein 5 / Homo sapiens
- Microtubule-associated protein tau / Homo sapiens
- Msx2-interacting protein / Homo sapiens
-
Mucin-1 / Homo sapiens
- Undefined site
-
Mucin-7 / Homo sapiens
- Undefined site
- Myc proto-oncogene protein / Homo sapiens
- Myocyte-specific enhancer factor 2D / Homo sapiens
- Neuroblast differentiation-associated protein AHNAK / Homo sapiens
- Nuclear envelope pore membrane protein POM 121 / Homo sapiens
- Nuclear factor related to kappa-B-binding protein / Homo sapiens
- Nuclear mitotic apparatus protein 1 / Homo sapiens
- Nuclear pore complex protein Nup153 / Homo sapiens
- Nuclear pore complex protein Nup214 / Homo sapiens
- Nuclear pore complex protein Nup98-Nup96 isoform 4 / Homo sapiens
- Nuclear receptor corepressor 1 / Homo sapiens
-
Nucleoporin p62 / Homo sapiens
- Undefined site
- Nucleoprotein TPR / Homo sapiens
- Nucleosome-remodeling factor subunit BPTF / Homo sapiens
- PDZ and LIM domain protein 7 isoform 4 / Homo sapiens
- Perilipin-4 / Homo sapiens
- Pleckstrin homology domain containing, family A member 5 / Homo sapiens
- Pogo transposable element with ZNF domain isoform 2 / Homo sapiens
- Polyhomeotic-like protein 3 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prelamin-A/C isoform 3 / Homo sapiens
- Prosaposin / Homo sapiens
- Protein 4.1 / Homo sapiens
- Protein lin-54 homolog / Homo sapiens
- Protein PRRC2C / Homo sapiens
- Protein SON / Homo sapiens
- Protein strawberry notch homolog 1 / Homo sapiens
- Protein YIPF3 / Homo sapiens
- Proteoglycan 4 (lubricin) / Homo sapiens
- RanBP2-like and GRIP domain-containing protein 4 / Homo sapiens
- Ras-associated and pleckstrin homology domains-containing protein 1 / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Regulation of nuclear pre-mRNA domain-containing protein 2 / Homo sapiens
- Ribosomal RNA processing protein 1 homolog B / Homo sapiens
- RNA binding motif protein 27 / Homo sapiens
- RNA-binding protein 14 / Homo sapiens
- Serine/arginine repetitive matrix protein 2 / Homo sapiens
-
Serine/threonine-protein kinase WNK1 / Homo sapiens
- Undefined site
- Serum response factor (srf) / Homo sapiens
- Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens
- Spectrin alpha chain, erythrocytic 1 / Homo sapiens
- Spectrin beta chain, erythrocytic / Homo sapiens
- Synaptopodin / Homo sapiens
- TBP-associated factor 4 / Homo sapiens
-
Thrombopoietin / Homo sapiens
- Undefined site
-
Transcription factor sp1 / Homo sapiens
- Undefined site
- Transcriptional repressor p66-beta / Homo sapiens
-
Transferrin receptor protein 1 / Homo sapiens
- Undefined site
- Ubiquitin-associated protein 2-like / Homo sapiens
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Vimentin / Homo sapiens
- YTH domain-containing family protein 1 / Homo sapiens
- YTH domain-containing family protein 3 / Homo sapiens
- Zinc finger CCCH domain-containing protein 14 isoform 2 / Homo sapiens
- Zinc finger protein 281 / Homo sapiens
- Zinc finger protein 40 / Homo sapiens
- Zinc finger RNA-binding protein / Homo sapiens
- Zinc fingers and homeoboxes protein 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Alpha crystallin - a and b chains / Bos taurus
- Alpha crystallin a chain (a1 subunit) / Bos taurus
- Alpha crystallin a chain (a2 subunit) / Bos taurus
-
Alpha crystallin b chain (b1 subunit) / Bos taurus
- Undefined site
-
Alpha crystallin b chain (b2 subunit) / Bos taurus
- Undefined site
-
Ankyrin 3 / Bos taurus
- Undefined site
- Apolipoprotein E / Bos taurus
-
Estrogen receptor / Bos taurus
- Undefined site
- Fetuin-b / Bos taurus
- Fibrinogen beta chain / Bos taurus
-
Gp-3 / Bos taurus
- Undefined site
- Insulin-like growth factor II / Bos taurus
- Inter-alpha-trypsin inhibitor heavy chain h1 / Bos taurus
- Inter-alpha-trypsin inhibitor heavy chain h4 / Bos taurus
- Lactophorin / Bos taurus
-
Mucin / Bos taurus
- Undefined site
- Plasma serine protease inhibitor / Bos taurus
-
Synapsin-1 / Bos taurus
- Undefined site
-
Mucin / Equus caballus
- Undefined site
-
Alpha crystallin - a and b chains / Macaca mulatta
- Undefined site
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Cadherin-13 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Choline transporter-like protein 1 / Mus musculus
- Contactin-2 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- CUB and sushi domain-containing protein 3 / Mus musculus
- Embigin / Mus musculus
-
Epiglycanin / Mus musculus
- Undefined site
- Estrogen receptor / Mus musculus
-
Estrogen receptor beta / Mus musculus
- Undefined site
- Ser-61
- Gamma-glutamyltransferase 7 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Isoform 2 of Teneurin-3 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Neuroplastin / Mus musculus
- Isoform 9 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Leucine-rich repeat-containing protein 4 / Mus musculus
-
Muc2 / Mus musculus
- Undefined site
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuroplastin / Mus musculus
-
Nucleoporin p62 / Mus musculus
- Undefined site
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin g/h synthase 2 / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein from Thymus / Mus musculus
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
P67 / Oryctolagus cuniculus
- Undefined site
-
56 kDa intrinsic membrane protein / Rattus norvegicus
- Undefined site
-
Alpha crystallin - a and b chains / Rattus norvegicus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
- Neurofilament triplet l protein / Rattus norvegicus
- Neurofilament triplet m protein / Rattus norvegicus
-
Nuclear pore glycoprotein p62 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Brain / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Talin-1 / Sus scrofa
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Mucin / Bufo arenarum
- Undefined site
-
Mucin / Rana temporaria
- Undefined site
-
Nucleoporin p62 / Xenopus laevis
- Undefined site
-
H-antigen / Styela plicata
- Undefined site
-
Glycophorin / Gallus gallus
- Undefined site
- Talin / Gallus gallus
-
Alpha crystallin - a and b chains / Rhea americana
- Undefined site
-
Alpha crystallin / Sturnus vulgaris
- Undefined site
-
Fg / Autographa californica nucleopolyhedrovirus
- Undefined site
-
Eg / Human adenovirus type 2
- Undefined site
-
Fiber protein / Human adenovirus type 2
- Undefined site
-
Lg / Human adenovirus type 2
- Undefined site
-
Fiber protein / Human adenovirus type 5
- Undefined site
-
Large structural phosphoprotein / Human cytomegalovirus (strain 751)
- Undefined site
- Large structural phosphoprotein / Human cytomegalovirus (strain ad169)
-
Large structural phosphoprotein / Human cytomegalovirus (strain towne)
- Undefined site
-
Large t antigen / Simian virus 40
- Undefined site
-
Serine-rich 25 kDa antigen protein / Entamoeba histolytica
- Undefined site
-
Rna polymerase II (Pol II) / Unspecified eukaryote/s
- Undefined site
- Alpha-amylase a / Aspergillus oryzae
- Hirudin p6 / Hirudinaria manillensis
-
Uncharacterized protein / Aedes aegypti
- Undefined site
-
Mucin d, gp-b (80 kDa) / Drosophila melanogaster
- Undefined site
- Diptericin-D / Protophormia terraenovae
-
Glycoprotein 96-92 / Leishmania major
- Undefined site
-
35/50 kDa surface glycoprotein / Trypanosoma cruzi
- Undefined site
-
Mucin / Trypanosoma cruzi
- Undefined site
-
Synthetic peptide: kppttttttttkpp / Trypanosoma cruzi
- Undefined site
-
Uncharacterized protein / Trypanosoma cruzi
- Undefined site
-
Coagulation factor x / Tropidechis carinatus
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)
- Undefined site
-
Cutinase / Fusarium solani f. sp. pisi
- Undefined site
-
Coat protein / Plum pox virus (strain r)
- Undefined site
-
Uncharacterized protein / Schistosoma mansoni
- Undefined site
Reported glycosite
- TLSVLSR (7aa)
- VLSPADK (7aa)
- SVSSSSYR (8aa)
- QTARKSTGGKAP (12aa)
- GSAPPGPVPEGSIR (14aa)
- VSTSGPR (7aa)
- RYVETPR (7aa)
- VHISSVR (7aa)
- SYVTTSTR (8aa)
- MFLSFPTTK (9aa)
- HENNTKDNSIQHEFSLTR (18aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGK (29aa)
- GSPSTVSSSYK (11aa)
- FFESFGDLSTPDAVMGNPK (19aa)
- AQPPSSAASR (10aa)
- FSNVTWFHAIHVSGTNGTK (19aa)
- DAQASAAPAAPLPER (15aa)
- SNVSVEENVILEKPSHVELK (20aa)
- VAWLNR (6aa)
- VLGAFSDGLAHLDNLK (16aa)
- FHAIHVSGTNGTKRF (15aa)
- VTWFHAIHVSGTNGTK (16aa)
- HAIHVSGTNGTKRF (14aa)
- HAIHVSGTNGTK (12aa)
- VSGTNGTKRF (10aa)
- MNGTEMNLEPGSR (13aa)
- TQATFPISSLGDR (13aa)
- GTFATLSELHCDK (13aa)
- KTVEGAGSIAAATGFVKK (18aa)
- AQPVQSK (7aa)
- IRNVSDTTK (9aa)
- IRNVSDTTKR (10aa)
- ASTEKSNIIRGW (12aa)
- TSQGTVPTALAFER (14aa)
- ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR (32aa)
- TPPVTTNR (8aa)
- KDIVEYYNDSNGSHVLQGRFGCEIENNRS (29aa)
- ANATIEVK (8aa)
- HYTNPSQDVTVPCPVPSTPPTPSP (24aa)
- P01876 Thr-109     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Ser-111     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Thr-106     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Ser-113     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- STPPTPSPSCCHPR (14aa)
- FSTVAGESGSADTVR (15aa)
- TQSLLIVNNATNVVIK (16aa)
- FLEPYNDSIQAQK (13aa)
- VLVETSYPSQTTR (13aa)
- HINFTR (6aa)
- DTPSLEDEAAGHVTQAR (17aa)
- IVNNATNVVIKVCEF (15aa)
- YSSLAEAASK (10aa)
- FLASVSTVLTSK (12aa)
- FAEINGSALCSYNIKPSEYTLTSK (24aa)
- GNETIVNLIHSTR (13aa)
- STAPAVAYDSK (11aa)
- YHKNNKSWMESEF (13aa)
- HKNNKSWMESEF (12aa)
- ACQFNR (6aa)
- EAISPPDAASAAPLR (15aa)
- RACQFNR (7aa)
- HSHAGELEALGGVKPAVLTR (20aa)
- VSTPATTTSTFSR (13aa)
- VYSSANNCTFEYVSQPFLMDLEGK (24aa)
- VNFTCK (6aa)
- AGVSTNISTK (10aa)
- MVSHHNLTTGATLINEQWLLTTAK (24aa)
- KNASNMEYR (9aa)
- IGDVSSSAVK (10aa)
- RNESHLIDFR (10aa)
- AGYSQGATQYTQAQQTR (17aa)
- IGGDLTAAVTK (11aa)
- SPVVSGDTSPR (11aa)
- FNHTQTIQQK (10aa)
- ESISVSSEQLAQFR (14aa)
- NSTFGSVEVFSLDPNKVHK (19aa)
- IPPDSEATLVLVGR (14aa)
- AVVPVSK (7aa)
- TITVPVSGSPK (11aa)
- SALEPLVDLPIGINIT (16aa)
- VDLPIGINIT (10aa)
- KFHVNYTQPLVAVK (14aa)
- TPTSGPVITK (10aa)
- HLSNVSSTGSIDMVDSPQLATLADEVSASLAK (32aa)
- FHVNYTQPLVAVK (13aa)
- HMNETSHTQGSLR (13aa)
- AQPSVSLGAAYR (12aa)
- GIANLSNFIR (10aa)
- ILDSFAAAPVPTTTLVLK (18aa)
- LSQEDPDYGIR (11aa)
- AQPSASLGVGYR (12aa)
- VTQQSPTSMNQVNLTCR (17aa)
- PSTQTTNTTTQK (12aa)
- VITSQAGK (8aa)
- AQPSVSLGAPYR (12aa)
- STAVTR (6aa)
- ISEILLDHGAPIQAK (15aa)
- TVEKGIYQTSNF (12aa)
- STFRPRTSSNASTISGRLSP (20aa)
- TSSEASVSSSVAK (13aa)
- RVQPTESIVR (10aa)
- RVQPTESIVRFPNITNL (17aa)
- RVQPTESIVRFPNITNLCPF (20aa)
- GIYQTSNFRVQPTESIVR (18aa)
- GEVFNATRFASVY (13aa)
- NATRFASVY (9aa)
- SSSSTNTSLLTSK (13aa)
- SSTNTSLLTS (10aa)
- DLNISEDR (8aa)
- KLVQVGIYNGTHVIPNDR (18aa)
- TTNYSTVPQK (10aa)
- SSSQTSGSLVSK (12aa)
- IVNVSLADLR (10aa)
- DLQGNPIANATISVDGIDHDVTSAK (25aa)
- SAVSTSVPTKPTENISK (17aa)
- GSPGTPGSRSRTPSL (15aa)
- VVSTLPSTVLGK (12aa)
- TPPKSPSSAKSRLQT (15aa)
- QPSVTISSK (9aa)
- VILYNR (6aa)
- PATAAVPTSQSVK (13aa)
- STSQGSINSPVYSR (14aa)
- LVLYLEHNLEKNSTKEEILAALEK (24aa)
- TFDEIASGFR (10aa)
- PVVSSAGTTSDK (12aa)
- LTSTDTIPK (9aa)
- VTGPQATGTPLVTMRPASQAGK (22aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- GSALHEDIYVLHDNGTLEIPVAQK (24aa)
- LVTTPTGTQATYTRPTVSPSIGR (23aa)
- EICSGNSSQCAPNVHK (16aa)
- HAPATVCGPKKSTNL (15aa)
- QVSQAQTTVQPSATLQR (17aa)
- TTSGSIITVVPK (12aa)
- STEANVLPPSSIGFTFSVPVAK (22aa)
- AANIVIQTEPPVPVSINSNITR (22aa)
- PHTSGMNRL (9aa)
- IISSNIVSGTTTK (13aa)
- IPPSSAPTVLSVPAGTTIVK (20aa)
- ALQTTGTAK (9aa)
- IPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVK (36aa)
- TMAVTPGTTTLPATVK (16aa)
- PSFPPSTSAVK (11aa)
- SVGGSGGGSFGDNLVTR (17aa)
- SISQSISGQK (10aa)
- TSAVSSQANSQPPVQVSVK (19aa)
- NLSVVILGASDKDLHPNTDPFKFEIHK (27aa)
- ASASGSGAQVGGPISSGSSASSVTVTR (27aa)
- TAAAQVGTSVSSATNTSTRPIITVHK (26aa)
- SGTVTVAQQAQVVTTVVGGVTK (22aa)
- FPHSVKTTTHSWVSG (15aa)
- CDIPIGAGICASYQTQTNSPAR (22aa)
- QTQTNSPARAA (11aa)
- STSTPTSPGPR (11aa)
- VMSVVQTKPVQTSAVTGQASTGPVTQIIQTK (31aa)
- APPTLQAETATKPQATSAPSPAPK (24aa)
- PQATSAPSPAPK (12aa)
- PVQTSAVTGQASTGPVTQIIQTK (23aa)
- GTVQTSVDTTK (11aa)
- LVTSADGK (8aa)
- TPTSSPASSPLVAK (14aa)
- EQDQSFTALD (10aa)
- PQTSGAYVLNK (11aa)
- PIFTAPPKSEK (11aa)
- PTTIITTTQASGAGTK (16aa)
- ASTPGAAAQIQEVK (14aa)
- SGPSTVSEPAK (11aa)
- PTILGISSVSPSTTKPGTTTIIK (23aa)
- GLLTFVDHLPVTQVVVGDTNR (21aa)
- DLTSVLILQR (10aa)
- TIPMSAIITQAGATGVTSSPGIK (23aa)
- SSVATTSGK (9aa)
- PLVtIPAPTSTK (12aa)
- TAQTITSETPSSTTTTQITK (20aa)
- VVTDETSFVLVSDK (14aa)
- SPITIITTKVMTSGTGAPAK (20aa)
- FGGFNFSQILPDPSKPSK (18aa)
- NFSQILPDPSKPS (13aa)
- DFGGFNFSQILPDPSK (16aa)
- FGGFNFSQILPDPSKPSKR (19aa)
- NFSQILPDPSKPSKR (15aa)
- NFSQILPDPSKPSKRSF (17aa)
- VMTSGTGAPAK (11aa)
- VPATATQTK (9aa)
- VILENIASHEPR (12aa)
- ISFLIGSDSTHVLPGESPFNK (21aa)
- VPTTITLTLR (10aa)
- LVTPVTVSAVKPAVTTLVVK (20aa)
- YVPFNGTK (8aa)
- TPTSQSYR (8aa)
- FGVSSSSSGPSQTLTSTGNFK (21aa)
- EGFSIPVSADGFK (13aa)
- LSTPPPLAEEEGLASR (16aa)
- QSCITEQTQYFFKNDTK (17aa)
- TGTTNTATTTVVANLGGHPQPTQVQFVCDRQE (32aa)
- SHLVHGSSPGVMGTSVAtsAs (21aa)
- SHLVHGSSPGVM-oxGTSVATSASK (25aa)
- KNFTTAPAICHDGK (14aa)
- AQEKNFTTAPAICHDGKAHFPREGVF (26aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWFVTQR (16aa)
- GVFVSNGTHWFVTQR (15aa)
- QQEPVTSTSLVFGK (14aa)
- ITGGSSVPK (9aa)
- RACAAGTPAVIR (12aa)
- ISVATGALEAAQGSK (15aa)
- STFSFSM-oxTKPSEK (16aa)
- DSGEGDTTSLR (11aa)
- ATFAFGAQTSTTADQGAAK (19aa)
- IETAVTSTPSASGQFSK (17aa)
- HSHAVSTAAMTR (12aa)
- LSESHPDATEDLQR (14aa)
- SLQGGSPSTTVTVTALE (17aa)
- LLTSQDVSYDEAR (13aa)
- TGTTHTATTATSNGGTGQPE (20aa)
- ASSTSLTSTQPTK (13aa)
- TSPENVQDRFALVTPK (16aa)
- TPVSYQNTMSR (11aa)
- IPGVSTPQTLAGTQK (15aa)
- AQGLLSAGHPEGEQIIR (17aa)
- GIASTSDPPTANIKPTPVVSTPSK (24aa)
- VSSQDYGR (8aa)
- LAGTVPSTVALLPSTATE (18aa)
- STVTTTTTTVTK (12aa)
- NSTTLVMHMK (10aa)
- SAPASQASLR (10aa)
- DVSSVELLMK (10aa)
- VM-oxVAPISGSVTTGTK (18aa)
- MVLTTK (6aa)
- VGSPATVTFQQNK (13aa)
- IPAASAAAMNLASAR (15aa)
- RETIQQSSSLTSVPPTTFSLTFK (23aa)
- AVAITQSPSSVR (12aa)
- ASDVDTSSSTLR (12aa)
- ATSTSPNSQSSK (12aa)
- IVNGSHYEYK (10aa)
- VNTSEGVVLLSYSGQK (16aa)
- ADRPSLEKPEPIHLSVSTPVTQGGTVK (27aa)
- GPQVSSALNLDTSK (14aa)
Mass spectrometry observed peptide
-
- N-Linked / Truncated
(avg mass : 221.2103)
- Characterization of the glycosylation sites in cyclooxygenase-2 using mass spectrometry. (2001 - Nemeth J, Hochgesang G, Marnett L, Caprioli R, Hochensang G) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Studies on heterogeneity of Taka-amylase A: isolation of an amylase having one N-acetylglucosamine residue as the sugar chain. (1982 - Hase S, Fujimura K, Kanoh M, Ikenaka T) / Status : Reviewed
- Prosaposin / Homo sapiens
- Prostaglandin g/h synthase 2 / Mus musculus
- Alpha-amylase a / Aspergillus oryzae
-
- N-Linked/O-Linked / Truncated If N-Linked
(avg mass : 221.2103)
- Uterine Cervix (UBERON_0000002) HeLa (CVCL_0030)
- Venom (UBERON_0007113)
- Reticulocyte (CL_0000558)
- Cell Surface (GO_0009986)
- Plasma Membrane (GO_0005886)
- Carcinoma (DOID:305)
- Occurrence of O-linked Xyl-GlcNAc and Xyl-Glc disaccharides in trocarin, a factor Xa homolog from snake venom (2003 - Joseph JS, Valiyavettil M, Gowda DC, Kini RM) / Status : Reviewed
- A novel sialylated and galactofuranose-containing O-linked glycan, Neu5Ac alpha2-5 Galp beta1-6 (Galf beta1-4) GlcNAc, is expressed on the sialoglycoprotein of Trypanosoma cruzi Dm28c (2003 - Agrellos OA, Jones C, Todeschini AR, Previato JO, Mendonca-Previato L) / Status : Reviewed
- Structure of O-glycosidically linked oligosaccharides from glycoproteins of Trypanosoma cruzi CL-Brener strain: evidence for the presence of O-linked sialyl-oligosaccharides. (2001 - Todeschini A, da Silveira E, Jones C, Wait R, Previato J, Mendona-Previato L) / Status : Reviewed
- Separation of Galfbeta1-->XGlcNAc and Galpbeta1-->XGlcNAc (X = 3, 4, and 6) as the alditols by high-pH anion-exchange chromatography and thin-layer chromatography: characterization of mucins from Trypanosoma cruzi. (2000 - Salto M, Gallo-Rodriguez C, Lima C, de Lederkremer R) / Status : Reviewed
- Biosynthesis of O-N-acetylglucosamine-linked glycans in Trypanosoma cruzi. Characterization of the novel uridine diphospho-N-acetylglucosamine:polypeptide N-acetylglucosaminyltransferase-catalyzing formation of N-acetylglucosamine alpha1-->O-threonine. (1998 - Previato J, Sola-Penna M, Agrellos O, Jones C, Oeltmann T, Travassos L, Mendona-Previato L) / Status : Reviewed
- The lipid structure of the glycosylphosphatidylinositol-anchored mucin-like sialic acid acceptors of Trypanosoma cruzi changes during parasite differentiation from epimastigotes to infective metacyclic trypomastigote forms. (1995 - Serrano A, Schenkman S, Yoshida N, Mehlert A, Richardson J, Ferguson M) / Status : Reviewed
- O-glycosidically linked N-acetylglucosamine-bound oligosaccharides from glycoproteins of Trypanosoma cruzi. (1994 - Previato J, Jones C, Gonalves L, Wait R, Travassos L, Mendona-Previato L) / Status : Reviewed
- The C-terminal domain of RNA polymerase II is modified by O-linked GlcNAc. (1991 - Kelly W, Dahmus M, Hart G) / Status : Reviewed
- Relative accessibility of N-acetylglucosamine in trimers of the adenovirus types 2 and 5 fiber proteins. (1990 - Mullis K, Haltiwanger R, Hart G, Marchase R, Engler J) / Status : Reviewed
- Glycosylation of eukaryotic peptide chain initiation factor 2 (eIF-2)-associated 67-kDa polypeptide (p67) and its possible role in the inhibition of eIF-2 kinase-catalyzed phosphorylation of the eIF-2 alpha-subunit. (1989 - Datta B, Ray M, Chakrabarti D, Wylie D, Gupta N) / Status : Reviewed
- Characterization of the N- and O-linked oligosaccharides in glycoproteins synthesized by Schistosoma mansoni schistosomula. (1988 - Nyame K, Cummings R, Damian R) / Status : Reviewed
- Schistosoma mansoni synthesizes glycoproteins containing terminal O-linked N-acetylglucosamine residues. (1987 - Nyame K, Cummings R, Damian R) / Status : Reviewed
- Structural studies on cutinase, a glycoprotein containing novel amino acids and glucuronic acid amide at the N terminus. (1980 - Lin T, Kolattukudy P) / Status : Reviewed
- The polypeptides of adenovirus. VI. Early and late glycopolypeptides. (1974 - Ishibashi M, Maizel J) / Status : Reviewed
-
P67 / Oryctolagus cuniculus
- Undefined site
-
Eg / Human adenovirus type 2
- Undefined site
-
Fiber protein / Human adenovirus type 2
- Undefined site
-
Lg / Human adenovirus type 2
- Undefined site
-
Rna polymerase II (Pol II) / Unspecified eukaryote/s
- Undefined site
-
35/50 kDa surface glycoprotein / Trypanosoma cruzi
- Undefined site
-
Mucin / Trypanosoma cruzi
- Undefined site
-
Synthetic peptide: kppttttttttkpp / Trypanosoma cruzi
- Undefined site
-
Uncharacterized protein / Trypanosoma cruzi
- Undefined site
-
Coagulation factor x / Tropidechis carinatus
- Undefined site
-
Cutinase / Fusarium solani f. sp. pisi
- Undefined site
-
Uncharacterized protein / Schistosoma mansoni
- Undefined site
-
- O-Linked / Core 0
(avg mass : 221.2103)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Body Fluid (UBERON_0006314)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Intestinal Mucosa
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Large Intestine (UBERON_0000059)
- Liver (UBERON_0002107) AH66-TC (CVCL_4368) Plasma Membrane (GO_0005886)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911) T-47D (CVCL_0553)
- Mammary Gland (UBERON_0001911) TA3/Ha (CVCL_4321)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Mucosa (UBERON_0000344) 67j25D (CVCL_Z425)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Mucosa of Stomach (UBERON_0001199)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Placenta (UBERON_0001987) BeWo (CVCL_0044) Epithelium (CL_0002577)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Saliva (UBERON_0001836)
- Saliva-Secreting Gland (UBERON_0001044)
- Skin of Body (UBERON_0002097) A-431 (CVCL_0037) Fibroblast (CL_0000057)
- Small Intestine (UBERON_0002108)
- Submandibular Gland (UBERON_0001736)
- Synovial Fluid (UBERON_0001090)
- Thyroid (UBERON_0002046)
- Urine (UBERON_0001088)
- Uterine Cervix (UBERON_0000002) HEp-2 (CVCL_1906)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- CCRF-CEM (CVCL_0207) T-Lymphocyte (CL_0000084)
- HEK293-F (CVCL_6642)
- LSTM-AA-20A (CVCL_Z354) Cell Surface (GO_0009986)
- Rat1 (CVCL_0492)
- Schneider 2 (CVCL_Z232)
- Egg Cell Jelly Coat
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Leukocyte (CL_0000738)
- Plasma Membrane (GO_0005886)
- Adenocarcinoma (DOID:299)
- Anemia, Aplastic (DOID:12449)
- Arthritis, Rheumatoid (DOID:7148)
- Cancer, breast (DOID:1612)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Carcinoid Tumor, with multiple liver metastasis
- Carcinoma, Hepatocellular (DOID:684)
- Carcinoma, Squamous cell (DOID:1749)
- Choriocarcinoma (DOID:3594)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Erythroleukemia with associated Polycythemia
- Leukemia, Acute lymphoblastic and HIV-1
- Leukemia, Myloid, Chronic (DOID:8552)
- Multiple myeloma (DOID:9538)
- Osteoarthritis (DOID:8398)
- Ovarian cyst (DOID:5119)
- Tn Polyagglutinability Syndrome (DOID:0080520)
- Site-specific O-glycosylation analysis of SARS-CoV-2 spike protein produced in insect and human cells (2021 - Ieva Bagdonaite, Andrew J. Thompson, Xiaoning Wang, Max Søgaard, Cyrielle Fougeroux, Martin Frank, Jolene K. Diedrich, John R. Yates 3rd, Ali Salanti, Sergey Y. Vakhrushev, James C. Paulson, Hans H. Wandall) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Naturally Occurring Structural Isomers in Serum IgA1 O-Glycosylation (2012 - Kazuo Takahashi, Archer D. Smith, IV, Knud Poulsen, Mogens Kilian, Bruce A. Julian, Jiri Mestecky, Jan Novak, Matthew B. Renfrow) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Occurrence of O-linked Xyl-GlcNAc and Xyl-Glc disaccharides in trocarin, a factor Xa homolog from snake venom (2003 - Joseph JS, Valiyavettil M, Gowda DC, Kini RM) / Status : Reviewed
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- Isolation and characterization of glycophorin from nucleated (chicken) erythrocytes. (2000 - Duk M, Krotkiewski H, Stasyk T, Lutsik-Kordovsky M, Syper D, Lisowska E) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
- Human low-molecular-weight salivary mucin expresses the sialyl lewisx determinant and has L-selectin ligand activity. (1998 - Prakobphol A, Thomsson K, Hansson G, Rosen S, Singer M, Phillips N, Medzihradszky K, Burlingame A, Leffler H, Fisher S) / Status : Reviewed
- Structure of the O-glycopeptides isolated from bovine milk component PP3. (1998 - Coddeville B, Girardet J, Plancke Y, Campagna S, Linden G, Spik G) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
- Phosphorylation and O-glycosylation sites of human chromogranin A (CGA79-439) from urine of patients with carcinoid tumors. (1998 - Gadroy P, Stridsberg M, Capon C, Michalski J, Strub J, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana temporaria. (1997 - Maes E, Florea D, Delplace F, Lemoine J, Plancke Y, Strecker G) / Status : Reviewed
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Mucin-type glycoprotein from Drosophila melanogaster embryonic cells: characterization of carbohydrate component. (1996 - Kramerov A, Arbatsky N, Rozovsky Y, Mikhaleva E, Polesskaya O, Gvozdev V, Shibaev V) / Status : Reviewed
- Comparison of O-linked carbohydrate chains in MUC-1 mucin from normal breast epithelial cell lines and breast carcinoma cell lines. Demonstration of simpler and fewer glycan chains in tumor cells. (1996 - Lloyd KO, Burchell J, Kudryashov V, Yin BW, Taylor-Papadimitriou J) / Status : Reviewed
- Insect immunity. The inducible antibacterial peptide diptericin carries two O-glycans necessary for biological activity. (1995 - Bulet P, Hegy G, Lambert J, van Dorsselaer A, Hoffmann J, Hetru C) / Status : Reviewed
- Altered sialylation of CD45 in HIV-1-infected T lymphocytes. (1994 - Lefebvre J, Giordanengo V, Doglio A, Cagnon L, Breittmayer J, Peyron J, Lesimple J) / Status : Reviewed
- Assignment of O-glycan attachment sites to the hinge-like regions of human lysosomal membrane glycoproteins lamp-1 and lamp-2. (1993 - Carlsson S, Lycksell P, Fukuda M) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Biosynthesis and secretion of human interleukin 2 glycoprotein variants from baculovirus-infected Sf21 cells. Characterization of polypeptides and posttranslational modifications. (1993 - Grabenhorst E, Hofer B, Nimtz M, Jger V, Conradt H) / Status : Reviewed
- Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1993 - Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- Primary structure and function of novel O-glycosylated hirudins from the leech Hirudinaria manillensis. (1992 - Steiner V, Knecht R, Brnsen K, Gassmann E, Stone S, Raschdorf F, Schlaeppi J, Maschler R) / Status : Reviewed
- O-linked oligosaccharides of glycophorins A and B in erythrocytes of two individuals with the Tn polyagglutinability syndrome. (1992 - Blumenfeld O, Lalezari P, Khorshidi M, Puglia K, Fukuda M) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Characterization of oligosaccharide structures on a chimeric respiratory syncytial virus protein expressed in insect cell line Sf9. (1991 - Wathen M, Aeed P, Elhammer A) / Status : Reviewed
- Human transferrin receptor contains O-linked oligosaccharides. (1990 - Do S, Enns C, Cummings R) / Status : Reviewed
- O-linked oligosaccharides from human serum immunoglobulin A1. (1989 - Field M, Dwek R, Edge C, Rademacher T) / Status : Reviewed
- Sugar sequences of allergenically active oligosaccharide alcohols isolated from a large-molecular-size sea squirt antigen termed H-antigen. (1989 - Ohta M, Shigeta S, Ono K, Takao T, Shimonishi Y, Oka S) / Status : Reviewed
- Characterization of the N- and O-linked oligosaccharides in glycoproteins synthesized by Schistosoma mansoni schistosomula. (1988 - Nyame K, Cummings R, Damian R) / Status : Reviewed
- Schistosoma mansoni synthesizes glycoproteins containing terminal O-linked N-acetylglucosamine residues. (1987 - Nyame K, Cummings R, Damian R) / Status : Reviewed
- Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Structural variations of O-linked oligosaccharides present in leukosialin isolated from erythroid, myeloid, and T-lymphoid cell lines. (1986 - Carlsson S, Sasaki H, Fukuda M) / Status : Reviewed
- Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
- Structure of O-glycosidically linked sugar units from plasma membranes of an ascites hepatoma, AH 66. (1982 - Funakoshi I, Yamashina I) / Status : Reviewed
- Structure determination of oligosaccharides isolated from A+, H+ and A-H- hog-submaxillary-gland mucin glycoproteins, by 360-MHz 1H-NMR spectroscopy, permethylation analysis and mass spectrometry. (1981 - van Halbeek H, Dorland L, Haverkamp J, Veldink G, Vliegenthart J, Fournet B, Ricart G, Montreuil J, Gathmann W, Aminoff D) / Status : Reviewed
- Isolation and characterization of mosquito cell membrane glycoproteins. (1981 - Butters T, Hughes R) / Status : Reviewed
- Glycoproteins and blood group activity. Oligosaccharides of A+ hog submaxillary glycoproteins. (1979 - Aminoff D, Baig MM, Gathmann WD) / Status : Reviewed
- Glycoproteins and blood group activity. Isolation and characterization of oligosaccharides of H+ hog submaxillary glycoprotein, and their comparison to those found in A+ and A-H- glycoproteins. (1979 - Aminoff D, Gathmann WD, Baig MM) / Status : Reviewed
- Chemical structure of epiglycanin, the major glycoprotein of the TA3-Ha ascites cell. The carbohydrate chains. (1979 - van den Eijnden D, Evans N, Codington J, Reinhold V, Silber C, Jeanloz R) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Immunochemical properties of B-active and non-B-active blood group substances from horse gastric mucosae and the relative size distributions of oligosaccharides liberated by base-borohydride. (1976 - Newman W, Kabat E) / Status : Reviewed
- Immunochemical and chemical investigations of the structure of glycoprotein fragments obtained from epiglycanin, a glycoprotein at the surface of the TA3-Ha cancer cell. (1975 - Codington J, Linsley K, Jeanlot R) / Status : Reviewed
- Intestinal glycoproteins of germfree rats. IV. Oligosaccharides obtained by chemical degradation of a water-soluble glycoprotein fraction. (1975 - Wold J, Smestad B, Midtvedt T) / Status : Reviewed
- Structure of the carbohydrate units of IgA1 immunoglobulin. II. Stucture of the O-glycosidically linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed
- Structural studies on human erythrocyte glycoproteins. Alkali-labile oligosaccharides. (1969 - Thomas D, Winzler R) / Status : Reviewed
- Physical and chemical studies on glycoproteins. II. Isolation and characterization of oligosaccharides from porcine submaxillary glycoproteins. (1968 - Katzman RL, Eylar EH) / Status : Reviewed
- Structures and immunochemical properties of oligosaccharides isolated from pig submaxillary mucins. (1968 - Carlson D) / Status : Reviewed
- Chromogranin a / Homo sapiens
- Coagulation factor V / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
- Ser-153
-
Glycophorin a and b / Homo sapiens
- Undefined site
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Glycoprotein rg / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Interleukin-2 [mu30] / Homo sapiens
- Undefined site
-
Interleukin-2 [mu32] / Homo sapiens
- Undefined site
-
Leukosialin (cd43) / Homo sapiens
- Undefined site
-
Low-density lipoprotein receptor / Homo sapiens
- Undefined site
-
Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Undefined site
-
Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Undefined site
-
Mucin-1 / Homo sapiens
- Undefined site
-
Mucin-7 / Homo sapiens
- Undefined site
- Proteoglycan 4 (lubricin) / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Thrombopoietin / Homo sapiens
- Undefined site
-
Transferrin receptor protein 1 / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Gp-3 / Bos taurus
- Undefined site
- Lactophorin / Bos taurus
-
Mucin / Bos taurus
- Undefined site
-
Mucin / Equus caballus
- Undefined site
-
Epiglycanin / Mus musculus
- Undefined site
-
Muc2 / Mus musculus
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Mucin / Bufo arenarum
- Undefined site
-
Mucin / Rana temporaria
- Undefined site
-
H-antigen / Styela plicata
- Undefined site
-
Glycophorin / Gallus gallus
- Undefined site
-
Fg / Autographa californica nucleopolyhedrovirus
- Undefined site
- Hirudin p6 / Hirudinaria manillensis
-
Uncharacterized protein / Aedes aegypti
- Undefined site
-
Mucin d, gp-b (80 kDa) / Drosophila melanogaster
- Undefined site
- Diptericin-D / Protophormia terraenovae
-
Coagulation factor x / Tropidechis carinatus
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)
- Undefined site
-
Uncharacterized protein / Schistosoma mansoni
- Undefined site
- FSNVTWFHAIHVSGTNGTK (19aa)
- FHAIHVSGTNGTKRF (15aa)
- HAIHVSGTNGTK (12aa)
- HAIHVSGTNGTKRF (14aa)
- VTWFHAIHVSGTNGTK (16aa)
- VSGTNGTKRF (10aa)
- ASTEKSNIIRGW (12aa)
- HYTNPSQDVTVPCPVPSTPPTPSP (24aa)
- P01876 Thr-109     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Ser-111     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Thr-106     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Ser-113     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- STPPTPSPSCCHPR (14aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- YHKNNKSWMESEF (13aa)
- HKNNKSWMESEF (12aa)
- EAISPPDAASAAPLR (15aa)
- VYSSANNCTFEYVSQPFLMDLEGK (24aa)
- SALEPLVDLPIGINIT (16aa)
- VDLPIGINIT (10aa)
- TVEKGIYQTSNF (12aa)
- RVQPTESIVR (10aa)
- RVQPTESIVRFPNITNL (17aa)
- RVQPTESIVRFPNITNLCPF (20aa)
- GIYQTSNFRVQPTESIVR (18aa)
- GEVFNATRFASVY (13aa)
- NATRFASVY (9aa)
- HAPATVCGPKKSTNL (15aa)
- CDIPIGAGICASYQTQTNSPAR (22aa)
- QTQTNSPARAA (11aa)
- FGGFNFSQILPDPSKPSKR (19aa)
- NFSQILPDPSKPS (13aa)
- NFSQILPDPSKPSKR (15aa)
- FGGFNFSQILPDPSKPSK (18aa)
- NFSQILPDPSKPSKRSF (17aa)
- DFGGFNFSQILPDPSK (16aa)
- KNFTTAPAICHDGK (14aa)
- AQEKNFTTAPAICHDGKAHFPREGVF (26aa)
- GVFVSNGTHWFVTQR (15aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWFVTQR (16aa)
-
- O-Linked / Core 1
(avg mass : 221.2103)
- Embryo (UBERON_0000922)
-
- O-Linked / O-GlcNAc
(avg mass : 221.2103)
- Anterior Lobe of Cerebellum (UBERON_0002131)
- Brain (UBERON_0000955) C-1300 clone N18 (CVCL_4724)
- Brain (UBERON_0000955) C-1300 clone S20 (CVCL_VU14)
- Brain (UBERON_0000955) NB41A3 (CVCL_3553)
- Brain (UBERON_0000955) Neuro-2a (CVCL_0470)
- Brain (UBERON_0000955)
- Brain (UBERON_0000955) Nucleus (GO_0005634)
- Colon (UBERON_0001155) HT-29 (CVCL_0320)
- Frontal Cortex (UBERON_0001870)
- Gizzard Smooth Muscle (UBERON_0011903)
- Kidney (UBERON_0002113) COS-7 (CVCL_0224)
- Kidney (UBERON_0002113) CV-1 (CVCL_0229)
- Kidney (UBERON_0002113) NRK (CVCL_3758)
- Lens of Camera-Type Eye (UBERON_0000965)
- Liver (UBERON_0002107) BRL (CVCL_4565) Nucleus (GO_0005634)
- Liver (UBERON_0002107)
- Liver (UBERON_0002107) Nucleus (GO_0005634)
- Lung (UBERON_0002048) Nucleus (GO_0005634)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Middle Frontal Gyrus (UBERON_0002702)
- Milk (UBERON_0001913)
- Myocardium (UBERON_0002349) Nucleus (GO_0005634)
- Outer Epithelium (UBERON_0007376) Foreskin Keratinocyte (CL_1001606)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Prepuce of Penis (UBERON_0001332) Fibroblast (CL_0000057)
- Stomach Smooth Muscle (UBERON_0004222)
- Submandibular Gland (UBERON_0001736)
- Thymus (UBERON_0002370) Platelet (CL_0000233)
- Uterine Cervix (UBERON_0000002) Detroit 98/AH-2 (CVCL_8190)
- Uterine Cervix (UBERON_0000002) HeLa (CVCL_0030) Fibroblast (CL_0000057)
- Uterine Cervix (UBERON_0000002) HeLa (CVCL_0030)
- Uterus (UBERON_0000995)
- HEK293 (CVCL_0045)
- HeLa (CVCL_0030)
- B-Lymphocyte (CL_0000236)
- Egg Cell
- Erythrocyte (CL_0000232)
- Fibroblast (CL_0000057)
- T-Lymphocyte (CL_0000084)
- Cytoplasm (GO_0005737)
- Cytoplasmic Vesicle (GO_0031410)
- Neurofilament (GO_0005883)
- Node of Ranvier (GO_0033268)
- Nucleus (GO_0005634)
- Adenocarcinoma (DOID:299)
- Adenocarcinoma, Grade II (DOID:299)
- Alzheimer's disease (DOID:10652)
- Carcinoma (DOID:305)
- Carcinoma, Squamous cell (DOID:1749)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Malaria Tropica, Malignant (DOID:14067)
- Neuroblastoma (DOID:769)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed
- Modification of Histones by Sugar β-N-acetylglucosamine (GlcNAc) Occurs on Multiple Residues, Including Histone H3 Serine 10, and Is Cell Cycle-Regulated (2011 - Suisheng Zhang, Kevin Roche, Heinz-Peter Nasheuer, Noel Francis Lowndes) / Status : Reviewed
- Mapping O-GlcNAc modification sites on tau and generation of a site-specific O-GlcNAc tau antibody (2011 - Scott A Yuzwa, Anuj K Yadav, Yuliya Skorobogatko, Thomas Clark, Keith Vosseller, David J Vocadlo) / Status : Unreviewed
- Identification of O-GlcNAc sites within peptides of the Tau protein and their impact on phosphorylation (2011 - Caroline Smet-Nocca, Malgorzata Broncel, Jean-Michel Wieruszeski, Caroline Tokarski, Xavier Hanoulle, Arnaud Leroy, Isabelle Landrieu, Christian Rolando, Guy Lippens, Christian P R Hackenberger) / Status : Unreviewed
- Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed
- Site-specific GlcNAcylation of Human Erythrocyte Proteins: Potential Biomarker(s) for Diabetes (2009 - Zihao Wang, Kyoungsook Park, Frank Comer, Linda C Hsieh-Wilson, Christopher D Saudek, Gerald W Hart) / Status : Reviewed
- Loss of p53 Enhances Catalytic Activity of IKKbeta Through O-linked beta-N-acetyl Glucosamine Modification (2009 - Keiko Kawauchi, Keigo Araki, Kei Tobiume, Nobuyuki Tanaka) / Status : Reviewed
- O-GlcNAc Regulates FoxO Activation in Response to Glucose (2008 - Michael P Housley, Joseph T Rodgers, Namrata D Udeshi, Timothy J Kelly, Jeffrey Shabanowitz, Donald F Hunt, Pere Puigserver, Gerald W Hart) / Status : Reviewed
- The capsid protein of a plant single-stranded RNA virus is modified by O-linked N-acetylglucosamine (2002 - Fernandez-Fernandez, Camafeita, Bonay, Mendez, Albar, Garcia) / Status : Reviewed
- Alternative O-glycosylation/O-phosphorylation of the murine estrogen receptor beta. (2000 - Cheng X, Cole R, Zaia J, Hart G) / Status : Reviewed
- An evaluation of sialation of the nucleoporin p62. (1998 - Fang B, Hanover J, Miller M) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Reduction of O-linked N-acetylglucosamine-modified assembly protein-3 in Alzheimer's disease. (1998 - Yao P, Coleman P) / Status : Reviewed
- SV40 large T antigen is modified with O-linked N-acetylglucosamine but not with other forms of glycosylation. (1998 - Medina L, Grove K, Haltiwanger R) / Status : Reviewed
- A subpopulation of estrogen receptors are modified by O-linked N-acetylglucosamine. (1997 - Jiang M, Hart G) / Status : Reviewed
- Identification of O-linked N-acetylglucosamine modification of ankyrinG isoforms targeted to nodes of Ranvier. (1996 - Zhang X, Bennett V) / Status : Reviewed
- The serine-rich Entamoeba histolytica protein is a phosphorylated membrane protein containing O-linked terminal N-acetylglucosamine residues. (1995 - Stanley Jr S, Tian K, Koester J, Li E) / Status : Reviewed
- c-Myc is glycosylated at threonine 58, a known phosphorylation site and a mutational hot spot in lymphomas. (1995 - Chou T, Hart G, Dang C) / Status : Reviewed
- Identification and mutational analysis of the glycosylation sites of human keratin 18. (1995 - Ku N, Omary M) / Status : Reviewed
- Site-specific glycosylation of the human cytomegalovirus tegument basic phosphoprotein (UL32) at serine 921 and serine 952. (1994 - Greis K, Gibson W, Hart G) / Status : Reviewed
- Identification, characterisation and genomic cloning of a O-linked N-acetylglucosamine-containing cytoplasmic Leishmania glycoprotein. (1993 - Handman E, Barnett L, Osborn A, Goding J, Murray P) / Status : Reviewed
- Glycosylation of mammalian neurofilaments. Localization of multiple O-linked N-acetylglucosamine moieties on neurofilament polypeptides L and M. (1993 - Dong D, Xu Z, Chevrier M, Cotter R, Cleveland D, Hart G) / Status : Reviewed
- Studies on O-glycans of Plasmodium-falciparum-infected human erythrocytes. Evidence for O-GlcNAc and O-GlcNAc-transferase in malaria parasites. (1993 - Dieckmann-Schuppert A, Bause E, Schwarz R) / Status : Reviewed
- The cytoskeletal protein talin is O-glycosylated. (1992 - Hagmann J, Grob M, Burger M) / Status : Reviewed
- Vertebrate lens alpha-crystallins are modified by O-linked N-acetylglucosamine. (1992 - Roquemore E, Dell A, Morris H, Panico M, Reason A, Savoy L, Wistow G, Zigler J, Earles B, Hart G) / Status : Reviewed
- Synapsins contain O-linked N-acetylglucosamine. (1991 - Luthi T, Haltiwanger R, Greengard P, Bahler M) / Status : Reviewed
- Lymphocyte activation induces rapid changes in nuclear and cytoplasmic glycoproteins. (1991 - Kearse KP, Hart GW) / Status : Reviewed
- Identification of O-GlcNAc attachment sites in transcription factors. (1991 - Reason A, Dell A, Morris H, Panico M, Treisman R, Marais R, Hart G, Haltiwanger R) / Status : Reviewed
- Bovine lens alpha-crystalline subunits are modified by O-linked GlcNAc. (1991 - Roquemore E, Dell A, Hart G) / Status : Reviewed
- Characterization and dynamics of O-linked glycosylation of human cytokeratin 8 and 18. (1991 - Chou C, Smith A, Omary M) / Status : Reviewed
- Nuclear localization of an O-glycosylated protein phosphotyrosine phosphatase from human cells. (1991 - Meikrantz W, Smith D, Sladicka M, Schlegel R) / Status : Reviewed
- Relative accessibility of N-acetylglucosamine in trimers of the adenovirus types 2 and 5 fiber proteins. (1990 - Mullis K, Haltiwanger R, Hart G, Marchase R, Engler J) / Status : Reviewed
- Cytokeratin 13 contains O-glycosidically linked N-acetylglucosamine residues. (1989 - King I, Hounsell E) / Status : Reviewed
- O-N-acetyl-D-glucosamine Moiety on Discrete Peptide of Multiple Protein 4.1 Isoforms Regulated by Alternative Pathways (1989 - M Inaba, Y Maede) / Status : Reviewed
- O-glycosylation of eukaryotic transcription factors: implications for mechanisms of transcriptional regulation. (1988 - Jackson S, Tjian R) / Status : Reviewed
- Intrinsic membrane glycoproteins with cytosol-oriented sugars in the endoplasmic reticulum. (1988 - Abeijon C, Hirschberg C) / Status : Reviewed
- Virion basic phosphoprotein from human cytomegalovirus contains O-linked N-acetylglucosamine. (1988 - Benko D, Haltiwanger R, Hart G, Gibson W) / Status : Reviewed
- Nuclear pore complex glycoproteins contain cytoplasmically disposed O-linked N-acetylglucosamine. (1987 - Holt G, Snow C, Senior A, Haltiwanger R, Gerace L, Hart G) / Status : Reviewed
- A nuclear specific glycoprotein representative of a unique pattern of glycosylation. (1987 - Schindler M, Hogan M, Miller R, DeGaetano D) / Status : Reviewed
- Nuclear pore complex contains a family of glycoproteins that includes p62: glycosylation through a previously unidentified cellular pathway. (1987 - Davis L, Blobel G) / Status : Reviewed
- Erythrocytes contain cytoplasmic glycoproteins. O-linked GlcNAc on Band 4.1. (1987 - Holt G, Haltiwanger R, Torres C, Hart G) / Status : Reviewed
- Topography and polypeptide distribution of terminal N-acetylglucosamine residues on the surfaces of intact lymphocytes. Evidence for O-linked GlcNAc. (1984 - Torres C, Hart G) / Status : Reviewed
- Actin-binding LIM protein 1 / Homo sapiens
-
Alpha crystallin - a and b chains / Homo sapiens
- Undefined site
- Alpha-synuclein / Homo sapiens
- Ankyrin-1 / Homo sapiens
- Ataxin-2-like protein / Homo sapiens
- Band 3 anion transport protein / Homo sapiens
- BRCA2-interacting transcriptional repressor EMSY / Homo sapiens
- Carbonic anhydrase 1 / Homo sapiens
- Catalase / Homo sapiens
- CDKN2A-interacting protein / Homo sapiens
-
Clathrin coat assembly protein AP180 / Homo sapiens
- Undefined site
- Cyclin-dependent kinase 12 / Homo sapiens
- E3 SUMO-protein ligase RanBP2 / Homo sapiens
- Early growth response protein 1 / Homo sapiens
- Equilibrative nucleoside transporter 1 / Homo sapiens
- Erythrocyte membrane protein band 4.2 / Homo sapiens
-
Estrogen receptor / Homo sapiens
- Undefined site
- Eukaryotic translation initiation factor 4 gamma 1 / Homo sapiens
- F-actin-capping protein subunit alpha-3 / Homo sapiens
- Forkhead box protein O1 / Homo sapiens
- Glucocorticoid modulatory element-binding protein 2 / Homo sapiens
- Glutamine and serine-rich protein 1 / Homo sapiens
- Glutathione S-transferase omega-1 / Homo sapiens
- Hemoglobin subunit alpha / Homo sapiens
- Hemoglobin subunit beta / Homo sapiens
- Histone H3 / Homo sapiens
- Host Cell Factor 1 / Homo sapiens
- Inhibitor of nuclear factor kappa-B kinase subunit beta / Homo sapiens
- KAT8 regulatory NSL complex subunit 3 / Homo sapiens
-
Keratin, type I cytoskeletal 13 / Homo sapiens
- Undefined site
- Keratin, type i cytoskeletal 18 / Homo sapiens
- Keratin, type II cytoskeletal 8 / Homo sapiens
- MAX gene-associated protein / Homo sapiens
- Microtubule-associated protein tau / Homo sapiens
- Msx2-interacting protein / Homo sapiens
- Myc proto-oncogene protein / Homo sapiens
- Myocyte-specific enhancer factor 2D / Homo sapiens
- Neuroblast differentiation-associated protein AHNAK / Homo sapiens
- Nuclear envelope pore membrane protein POM 121 / Homo sapiens
- Nuclear factor related to kappa-B-binding protein / Homo sapiens
- Nuclear mitotic apparatus protein 1 / Homo sapiens
- Nuclear pore complex protein Nup153 / Homo sapiens
- Nuclear pore complex protein Nup214 / Homo sapiens
- Nuclear pore complex protein Nup98-Nup96 isoform 4 / Homo sapiens
- Nuclear receptor corepressor 1 / Homo sapiens
-
Nucleoporin p62 / Homo sapiens
- Undefined site
- Nucleoprotein TPR / Homo sapiens
- Nucleosome-remodeling factor subunit BPTF / Homo sapiens
- PDZ and LIM domain protein 7 isoform 4 / Homo sapiens
- Perilipin-4 / Homo sapiens
- Pleckstrin homology domain containing, family A member 5 / Homo sapiens
- Pogo transposable element with ZNF domain isoform 2 / Homo sapiens
- Polyhomeotic-like protein 3 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prelamin-A/C isoform 3 / Homo sapiens
- Protein 4.1 / Homo sapiens
- Protein lin-54 homolog / Homo sapiens
- Protein PRRC2C / Homo sapiens
- Protein SON / Homo sapiens
- Protein strawberry notch homolog 1 / Homo sapiens
- RanBP2-like and GRIP domain-containing protein 4 / Homo sapiens
- Ras-associated and pleckstrin homology domains-containing protein 1 / Homo sapiens
- Regulation of nuclear pre-mRNA domain-containing protein 2 / Homo sapiens
- Ribosomal RNA processing protein 1 homolog B / Homo sapiens
- RNA binding motif protein 27 / Homo sapiens
- RNA-binding protein 14 / Homo sapiens
- Serine/arginine repetitive matrix protein 2 / Homo sapiens
-
Serine/threonine-protein kinase WNK1 / Homo sapiens
- Undefined site
- Serum response factor (srf) / Homo sapiens
- Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens
- Spectrin alpha chain, erythrocytic 1 / Homo sapiens
- Spectrin beta chain, erythrocytic / Homo sapiens
- Synaptopodin / Homo sapiens
- TBP-associated factor 4 / Homo sapiens
-
Transcription factor sp1 / Homo sapiens
- Undefined site
- Transcriptional repressor p66-beta / Homo sapiens
- Ubiquitin-associated protein 2-like / Homo sapiens
-
Uncharacterized protein / Homo sapiens
- Undefined site
- Vimentin / Homo sapiens
- YTH domain-containing family protein 1 / Homo sapiens
- YTH domain-containing family protein 3 / Homo sapiens
- Zinc finger CCCH domain-containing protein 14 isoform 2 / Homo sapiens
- Zinc finger protein 281 / Homo sapiens
- Zinc finger protein 40 / Homo sapiens
- Zinc finger RNA-binding protein / Homo sapiens
- Zinc fingers and homeoboxes protein 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Alpha crystallin - a and b chains / Bos taurus
- Alpha crystallin a chain (a1 subunit) / Bos taurus
- Alpha crystallin a chain (a2 subunit) / Bos taurus
-
Alpha crystallin b chain (b1 subunit) / Bos taurus
- Undefined site
-
Alpha crystallin b chain (b2 subunit) / Bos taurus
- Undefined site
-
Ankyrin 3 / Bos taurus
- Undefined site
-
Estrogen receptor / Bos taurus
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Synapsin-1 / Bos taurus
- Undefined site
-
Alpha crystallin - a and b chains / Macaca mulatta
- Undefined site
- Estrogen receptor / Mus musculus
-
Estrogen receptor beta / Mus musculus
- Undefined site
- Ser-61
-
Nucleoporin p62 / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein from Thymus / Mus musculus
- Undefined site
-
56 kDa intrinsic membrane protein / Rattus norvegicus
- Undefined site
-
Alpha crystallin - a and b chains / Rattus norvegicus
- Undefined site
- Neurofilament triplet l protein / Rattus norvegicus
- Neurofilament triplet m protein / Rattus norvegicus
-
Nuclear pore glycoprotein p62 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Brain / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
Talin-1 / Sus scrofa
- Undefined site
-
Nucleoporin p62 / Xenopus laevis
- Undefined site
- Talin / Gallus gallus
-
Alpha crystallin - a and b chains / Rhea americana
- Undefined site
-
Alpha crystallin / Sturnus vulgaris
- Undefined site
-
Fiber protein / Human adenovirus type 5
- Undefined site
-
Large structural phosphoprotein / Human cytomegalovirus (strain 751)
- Undefined site
- Large structural phosphoprotein / Human cytomegalovirus (strain ad169)
-
Large structural phosphoprotein / Human cytomegalovirus (strain towne)
- Undefined site
-
Large t antigen / Simian virus 40
- Undefined site
-
Serine-rich 25 kDa antigen protein / Entamoeba histolytica
- Undefined site
-
Glycoprotein 96-92 / Leishmania major
- Undefined site
-
Coat protein / Plum pox virus (strain r)
- Undefined site
- TLSVLSR (7aa)
- VLSPADK (7aa)
- SVSSSSYR (8aa)
- QTARKSTGGKAP (12aa)
- GSAPPGPVPEGSIR (14aa)
- VSTSGPR (7aa)
- RYVETPR (7aa)
- VHISSVR (7aa)
- SYVTTSTR (8aa)
- MFLSFPTTK (9aa)
- GSPSTVSSSYK (11aa)
- FFESFGDLSTPDAVMGNPK (19aa)
- AQPPSSAASR (10aa)
- DAQASAAPAAPLPER (15aa)
- VLGAFSDGLAHLDNLK (16aa)
- TQATFPISSLGDR (13aa)
- GTFATLSELHCDK (13aa)
- KTVEGAGSIAAATGFVKK (18aa)
- AQPVQSK (7aa)
- TSQGTVPTALAFER (14aa)
- KDIVEYYNDSNGSHVLQGRFGCEIENNRS (29aa)
- TPPVTTNR (8aa)
- FSTVAGESGSADTVR (15aa)
- VLVETSYPSQTTR (13aa)
- DTPSLEDEAAGHVTQAR (17aa)
- YSSLAEAASK (10aa)
- FLASVSTVLTSK (12aa)
- STAPAVAYDSK (11aa)
- HSHAGELEALGGVKPAVLTR (20aa)
- VSTPATTTSTFSR (13aa)
- AGVSTNISTK (10aa)
- IGDVSSSAVK (10aa)
- AGYSQGATQYTQAQQTR (17aa)
- IGGDLTAAVTK (11aa)
- SPVVSGDTSPR (11aa)
- ESISVSSEQLAQFR (14aa)
- IPPDSEATLVLVGR (14aa)
- AVVPVSK (7aa)
- TITVPVSGSPK (11aa)
- TPTSGPVITK (10aa)
- HLSNVSSTGSIDMVDSPQLATLADEVSASLAK (32aa)
- AQPSVSLGAAYR (12aa)
- ILDSFAAAPVPTTTLVLK (18aa)
- LSQEDPDYGIR (11aa)
- AQPSASLGVGYR (12aa)
- PSTQTTNTTTQK (12aa)
- VITSQAGK (8aa)
- AQPSVSLGAPYR (12aa)
- STAVTR (6aa)
- ISEILLDHGAPIQAK (15aa)
- STFRPRTSSNASTISGRLSP (20aa)
- TSSEASVSSSVAK (13aa)
- SSSSTNTSLLTSK (13aa)
- SSTNTSLLTS (10aa)
- TTNYSTVPQK (10aa)
- SSSQTSGSLVSK (12aa)
- IVNVSLADLR (10aa)
- SAVSTSVPTKPTENISK (17aa)
- GSPGTPGSRSRTPSL (15aa)
- VVSTLPSTVLGK (12aa)
- TPPKSPSSAKSRLQT (15aa)
- QPSVTISSK (9aa)
- PATAAVPTSQSVK (13aa)
- STSQGSINSPVYSR (14aa)
- TFDEIASGFR (10aa)
- PVVSSAGTTSDK (12aa)
- LTSTDTIPK (9aa)
- VTGPQATGTPLVTMRPASQAGK (22aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- LVTTPTGTQATYTRPTVSPSIGR (23aa)
- QVSQAQTTVQPSATLQR (17aa)
- TTSGSIITVVPK (12aa)
- STEANVLPPSSIGFTFSVPVAK (22aa)
- AANIVIQTEPPVPVSINSNITR (22aa)
- PHTSGMNRL (9aa)
- IISSNIVSGTTTK (13aa)
- IPPSSAPTVLSVPAGTTIVK (20aa)
- ALQTTGTAK (9aa)
- IPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVK (36aa)
- TMAVTPGTTTLPATVK (16aa)
- PSFPPSTSAVK (11aa)
- SVGGSGGGSFGDNLVTR (17aa)
- SISQSISGQK (10aa)
- TSAVSSQANSQPPVQVSVK (19aa)
- ASASGSGAQVGGPISSGSSASSVTVTR (27aa)
- TAAAQVGTSVSSATNTSTRPIITVHK (26aa)
- SGTVTVAQQAQVVTTVVGGVTK (22aa)
- FPHSVKTTTHSWVSG (15aa)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / O-GlcNAc
(avg mass : 221.2103)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 221.2103)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / Core 0
(avg mass : 221.2103)
Source
Disease
Reference
Reported glycosite
- N-Linked/O-Linked / Truncated If N-Linked
(avg mass : 221.2103)
Reference
Reported glycosite
- N-Linked / Truncated
(avg mass : 221.2103)