Hex:7 HexNAc:6 dHex:1 NeuAc:4

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Gallus gallus (Chicken)
• Calloselasma rhodostoma (Malayan pit viper)
• Influenza a virus (strain a/ussr/90/1977 h1n1) (Influenza a virus (strain a/ussr/90/1977 h1n1))
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Apolipoprotein B-100 / Homo sapiens    P04114
• Apolipoprotein D / Homo sapiens    P05090
• Biotinidase / Homo sapiens    P43251
• Butyrophilin subfamily 1 member A1 / Homo sapiens    Q13410
• Cadherin-5 / Homo sapiens    P33151
• CD16A-NK11-F/F genotype / Homo sapiens    P08637
• CD16A-NK12-V/F genotype / Homo sapiens    P08637
• CD16A-NK13-V/F genotype / Homo sapiens    P08637
• Ceruloplasmin / Homo sapiens    P00450
• Chimeric plasminogen activator K2-tuPA / Homo sapiens    P00749    P00750
• Clusterin / Homo sapiens    P10909
• Coagulation factor IX / Homo sapiens    P00740
• Coagulation factor VIII / Homo sapiens    P00451
• Complement c3 / Homo sapiens    P01024
• Ephrin type-B receptor 3 / Homo sapiens    P54753
• Epidermal growth factor receptor / Homo sapiens    P00533
• Erythropoietin / Homo sapiens    P01588
• Fer-1-like protein 6 / Homo sapiens    Q2WGJ9
• Follitropin, alpha and beta chains / Homo sapiens    P01225    P01215
• Galectin-3-binding protein / Homo sapiens    Q08380
• Glycocalicin / Homo sapiens    P07359
• Haptoglobin / Homo sapiens    P00738
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Kininogen-1 / Homo sapiens    P01042
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Mammaglobin-A / Homo sapiens    Q13296
• Multimerin-2 / Homo sapiens    Q9H8L6
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein YIPF3 / Homo sapiens    Q9GZM5
• Protein Z-dependent protease inhibitor / Homo sapiens    Q9UK55
• Receptor-type tyrosine-protein phosphatase eta / Homo sapiens    Q12913
• Rho GTPase-activating protein 28 / Homo sapiens    Q9P2N2
• Thrombopoietin / Homo sapiens    P40225
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Uncharacterized protein from Pleura / Homo sapiens    
• Uromodulin / Homo sapiens    P07911
• Vitamin k-dependent protein c / Homo sapiens    P04070
• Acetylcholinesterase / Bos taurus    P23795
• Uncharacterized protein / Bos taurus    
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus    P08101
• Neuroligin 1 / Rattus norvegicus    Q62765
• Ancrod / Calloselasma rhodostoma    P26324
• Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)    P03453
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)   Mature NK T cell (CL_0000814)  
• Blood Serum (UBERON_0001977)  
• Colon (UBERON_0001155)  
• Kidney (UBERON_0002113)   6/9CII (CVCL_VT76)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK570 (CVCL_6370)   Fibroblast (CL_0000057)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Kidney (UBERON_0002113)  
• Mammalian Vulva (UBERON_0000997)   A-431 (CVCL_0037)  
• Mammary Gland (UBERON_0001911)   C127 (CVCL_6550)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)  
• Placenta (UBERON_0001987)  
• Pleura (UBERON_0000977)   K-562 (CVCL_0004)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• HEK293 (CVCL_0045)  
• Platelet (CL_0000233)   Plasma Membrane (GO_0005886)  
• Plasma Membrane (GO_0005886)  

Reported structure

• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 4 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 4 x NeuAc(a2-?)"
• N-Linked / Complex / NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-3)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-?)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 788
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-3)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
• N-Linked / Complex / Structure 10701

Composition

• Hex:7 HexNAc:6 dHex:1 NeuAc:4 (avg mass : 3683.3567 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma, Squamous cell (DOID:1749)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Familial hepatic adenoma (DOID:111366)
• Leukemia, Myloid, Chronic (DOID:8552)
• Prostate cancer (DOID:10283)

Reference

• Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
• Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
• A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
• Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
• Novel Asn-linked oligosaccharides terminating in GalNAc beta (1-->4)[Fuc alpha (1-->3)]GlcNAc beta (1-->.) are present in recombinant human protein C expressed in human kidney 293 cells. (1993 - Yan S, Chao Y, van Halbeek H) / Status : Reviewed
• Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
• Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
• Carbohydrate structure of a thrombin-like serine protease from Agkistrodon rhodostoma. Structure elucidation of oligosaccharides by methylation analysis, liquid secondary-ion mass spectrometry and proton magnetic resonance. (1992 - Pfeiffer G, Dabrowski U, Dabrowski J, Stirm S, Strube K, Geyer R) / Status : Reviewed
• The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
• Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
• Determination of the branch location of extra N-acetyllactosamine units in sialo N-linked tetraantennary oligosaccharides. (1991 - Hokke C, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
• Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
• Sialylated carbohydrate chains of recombinant human glycoproteins expressed in Chinese hamster ovary cells contain traces of N-glycolylneuraminic acid. (1990 - Hokke C, Bergwerff A, van Dedem G, van Oostrum J, Kamerling J, Vliegenthart J) / Status : Reviewed
• Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
• Identification of a tetrasialylated monofucosylated tetraantennary N-linked carbohydrate chain in human platelet glycocalicin. (1988 - Korrel S, Clemetson K, van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
• The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
• The asparagine-linked sugar chains of the glycoproteins in calf thymocyte plasma membrane. Structural studies of acidic oligosaccharides. (1980 - Yoshima H, Takasaki S, Kobata A) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-381
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Undefined site
  •        Asn-72
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-72
  •        Asn-88
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-106
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Undefined site
  •        Asn-107
• Apolipoprotein B-100 / Homo sapiens
  •        Asn-3411
• Apolipoprotein D / Homo sapiens
  •        Asn-98
• Biotinidase / Homo sapiens
  •        Asn-349
• Butyrophilin subfamily 1 member A1 / Homo sapiens
  •        Asn-55
• Cadherin-5 / Homo sapiens
  •        Asn-535
• CD16A-NK11-F/F genotype / Homo sapiens
  •        Asn-92
• CD16A-NK12-V/F genotype / Homo sapiens
  •        Asn-92
• CD16A-NK13-V/F genotype / Homo sapiens
  •        Asn-92
• Ceruloplasmin / Homo sapiens
  •        Asn-138
  •        Asn-762
• Chimeric plasminogen activator K2-tuPA / Homo sapiens
  •        Asn-219
• Clusterin / Homo sapiens
  •        Asn-374
• Coagulation factor IX / Homo sapiens
  •        Undefined site
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Complement c3 / Homo sapiens
  •        Asn-1617
• Ephrin type-B receptor 3 / Homo sapiens
  •        Asn-445
• Epidermal growth factor receptor / Homo sapiens
  •        Undefined site
• Erythropoietin / Homo sapiens
  •        Undefined site
  •        Asn-51
  •        Asn-65
  •        Asn-110
• Fer-1-like protein 6 / Homo sapiens
  •        Asn-259
• Follitropin, alpha and beta chains / Homo sapiens
  •        Undefined site
• Galectin-3-binding protein / Homo sapiens
  •        Asn-398
• Glycocalicin / Homo sapiens
  •        Undefined site
• Haptoglobin / Homo sapiens
  •        Asn-241
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
• Kininogen-1 / Homo sapiens
  •        Asn-169
  •        Asn-294
• Lumican / Homo sapiens
  •        Asn-252
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
  •        Asn-58
  •        Asn-101
• Mammaglobin-A / Homo sapiens
  •        Asn-53
• Multimerin-2 / Homo sapiens
  •        Asn-205
• Prosaposin / Homo sapiens
  •        Asn-80
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Protein YIPF3 / Homo sapiens
  •        Asn-337
• Protein Z-dependent protease inhibitor / Homo sapiens
  •        Asn-180
• Receptor-type tyrosine-protein phosphatase eta / Homo sapiens
  •        Asn-501
• Rho GTPase-activating protein 28 / Homo sapiens
  •        Asn-534
• Thrombopoietin / Homo sapiens
  •        Undefined site
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Pleura / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Undefined site
  •        Asn-232
  •        Asn-322
• Vitamin k-dependent protein c / Homo sapiens
  •        Undefined site
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Uncharacterized protein / Bos taurus
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
  •        Undefined site
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Ancrod / Calloselasma rhodostoma
  •        Undefined site
• Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)
  •        Asn-286
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-282
  •        Asn-1194

Mass spectrometry observed peptide

• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• EAENITTGC (9aa)
  •    P01588    Asn-51     Erythropoietin / Homo sapiens
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53     Mammaglobin-A / Homo sapiens
• RLSPNASAEHLELRW (15aa)
  •    Q13410    Asn-55     Butyrophilin subfamily 1 member A1 / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• YFTPNKTEDTIFLR (14aa)
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
  •    P07602    Asn-80     Prosaposin / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• RCQTNLSTLSDPVQLE (16aa)
  •    P08637    Asn-92     CD16A-NK11-F/F genotype / Homo sapiens
  •    P08637    Asn-92     CD16A-NK13-V/F genotype / Homo sapiens
  •    P08637    Asn-92     CD16A-NK12-V/F genotype / Homo sapiens
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-88     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
• QDQCIYNTTYINVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• IAVQFGPGFSWIANFTK (17aa)
  •    P13473    Asn-101     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• FNLTETSEAEIHQSFQHLLR (20aa)
  •    P01011    Asn-106     Alpha-1-antichymotrypsin / Homo sapiens
• ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
  •    P01009    Asn-107     Alpha-1-antitrypsin / Homo sapiens
• GQALLVNSSQPWEPLQLHVDK (21aa)
  •    P01588    Asn-110     Erythropoietin / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• HGIQYFNNNTQHSSLFTLNEVK (22aa)
  •    P01042    Asn-169     Kininogen-1 / Homo sapiens
  •    VAR_019278   178:M→T   dbSNP:rs1656922
• ETFFNISK (8aa)
  •    Q9UK55    Asn-180     Protein Z-dependent protease inhibitor / Homo sapiens
• ALPGNLTAAVMEANQTGHEFPDR (23aa)
  •    Q9H8L6    Asn-205     Multimerin-2 / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
  •    P51884    Asn-252     Lumican / Homo sapiens
• MNSSIMANVTKAFVGDSK (18aa)
  •    Q2WGJ9    Asn-259     Fer-1-like protein 6 / Homo sapiens
• YTGNASALFILPDQDKMEEVEAMLLPETLK (30aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• YTGNASALFILPDQDK (16aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• QDFNITDISLLEHR (14aa)
  •    P07911    Asn-322     Uromodulin / Homo sapiens
• LPTTVLNATAK (11aa)
  •    Q9GZM5    Asn-337     Protein YIPF3 / Homo sapiens
• NPVGLIGAENATGETDPSHSK (21aa)
  •    P43251    Asn-349     Biotinidase / Homo sapiens
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• IIIAGTNSSDIQQIISIIESNK (22aa)
  •    P08195    Asn-381     4F2 cell-surface antigen heavy chain / Homo sapiens
• YKGLNLTEDTYKPR (14aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• GINITEDTYKPR (12aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• YAAVNITTNQAAPSEVPTLR (20aa)
  •    P54753    Asn-445     Ephrin type-B receptor 3 / Homo sapiens
• VEITTNQSIIIGGLFPGTK (19aa)
  •    Q12913    Asn-501     Receptor-type tyrosine-protein phosphatase eta / Homo sapiens
• NRMSLWNISTVMAPNLFFSR (20aa)
  •    Q9P2N2    Asn-534     Rho GTPase-activating protein 28 / Homo sapiens
• FILNTENNFTLTDNHDNTANITVK (24aa)
  •    P33151    Asn-535     Cadherin-5 / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• NLNESLIDLQELGK (14aa)
  •    P0DTC2    Asn-1194     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NLNESLIDLQELGKYEQYIK (20aa)
  •    P0DTC2    Asn-1194     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HYLMWGLSSDFWGEKPNLSYIIGK (24aa)
  •    P01024    Asn-1617     Complement c3 / Homo sapiens
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens