GlyConnect

taxonomy (7) protein (49) source (20) structure (18) composition (1) disease (5) reference (35) site (67) peptide (49)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:7 HexNAc:6 dHex:1 NeuAc:4 (avg mass : 3683.3567 )

Disease

Reference

Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
Novel Asn-linked oligosaccharides terminating in GalNAc beta (1-->4)[Fuc alpha (1-->3)]GlcNAc beta (1-->.) are present in recombinant human protein C expressed in human kidney 293 cells. (1993 - Yan S, Chao Y, van Halbeek H) / Status : Reviewed
Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
Carbohydrate structure of a thrombin-like serine protease from Agkistrodon rhodostoma. Structure elucidation of oligosaccharides by methylation analysis, liquid secondary-ion mass spectrometry and proton magnetic resonance. (1992 - Pfeiffer G, Dabrowski U, Dabrowski J, Stirm S, Strube K, Geyer R) / Status : Reviewed
The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
Determination of the branch location of extra N-acetyllactosamine units in sialo N-linked tetraantennary oligosaccharides. (1991 - Hokke C, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
Sialylated carbohydrate chains of recombinant human glycoproteins expressed in Chinese hamster ovary cells contain traces of N-glycolylneuraminic acid. (1990 - Hokke C, Bergwerff A, van Dedem G, van Oostrum J, Kamerling J, Vliegenthart J) / Status : Reviewed
Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
Identification of a tetrasialylated monofucosylated tetraantennary N-linked carbohydrate chain in human platelet glycocalicin. (1988 - Korrel S, Clemetson K, van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
The asparagine-linked sugar chains of the glycoproteins in calf thymocyte plasma membrane. Structural studies of acidic oligosaccharides. (1980 - Yoshima H, Takasaki S, Kobata A) / Status : Reviewed

Reported glycosite

4F2 cell-surface antigen heavy chain / Homo sapiens
- Asn-381
Alpha-1-acid glycoprotein 1 / Homo sapiens
- Asn-72
- Asn-93
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
- Asn-72
- Asn-88
- Asn-93
Alpha-1-antichymotrypsin / Homo sapiens
- Asn-106
- Asn-271
Alpha-1-antitrypsin / Homo sapiens
- Asn-107
Apolipoprotein b-100 / Homo sapiens
- Asn-3411
Apolipoprotein d / Homo sapiens
- Asn-88
- Asn-98
Biotinidase / Homo sapiens
- Asn-349
Cadherin-5 / Homo sapiens
- Asn-519
Ceruloplasmin / Homo sapiens
- Asn-138
- Asn-762
Clusterin / Homo sapiens
- Asn-374
Coagulation factor IX / Homo sapiens
- Undefined site
Coagulation factor VIII / Homo sapiens
- Undefined site
Complement c3 / Homo sapiens
- Asn-1617
Ephrin type-B receptor 3 / Homo sapiens
- Asn-445
Epidermal growth factor receptor / Homo sapiens
- Undefined site
Erythropoietin / Homo sapiens
- Undefined site
- Asn-110
Fer-1-like protein 6 / Homo sapiens
- Asn-259
Follitropin, alpha and beta chains / Homo sapiens
- Undefined site
Galectin-3-binding protein / Homo sapiens
- Asn-398
Glycocalicin / Homo sapiens
- Undefined site
Haptoglobin / Homo sapiens
- Asn-241
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Asn-517
Kininogen-1 / Homo sapiens
- Asn-169
- Asn-294
Lumican / Homo sapiens
- Asn-252
Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Asn-84
Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Asn-32
- Asn-58
- Asn-101
Mammaglobin-A / Homo sapiens
- Asn-53
Multimerin-2 / Homo sapiens
- Asn-205
Prosaposin / Homo sapiens
- Asn-80
Prostaglandin-h2 d-isomerase / Homo sapiens
- Asn-78
Protein yipf3 / Homo sapiens
- Asn-337
Protein Z-dependent protease inhibitor / Homo sapiens
- Asn-180
Receptor-type tyrosine-protein phosphatase eta / Homo sapiens
- Asn-501
Recombinant plasminogen - [r580s] / Homo sapiens
- Asn-322
Rho GTPase-activating protein 28 / Homo sapiens
- Asn-534
Thrombopoietin / Homo sapiens
- Undefined site
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
Uromodulin / Homo sapiens
- Undefined site
- Asn-232
- Asn-322
Vitamin k-dependent protein c / Homo sapiens
- Undefined site
Acetylcholinesterase / Bos taurus
- Undefined site
Uncharacterized protein from Plasma Membrane / Bos taurus
- Undefined site
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
Neuroligin 1 / Rattus norvegicus
- Undefined site
Ancrod / Calloselasma rhodostoma
- Undefined site
Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)
- Asn-286
Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Asn-122
- Asn-165
- Asn-234
- Asn-282
- Asn-657
- Asn-1194

Mass spectrometry observed peptide

LELNLTDSENATCLYAK (17aa)
- P13473 Asn-32
ELLQEFIDDNATTNAIDELK (20aa)
- Q13296 Asn-53
YETTNK (6aa)
- P13473 Asn-58
SVVAPATDGGLNLTSTFLR (19aa)
- P41222 Asn-78
YFTPNKTEDTIFLR (14aa)
- P02763 Asn-72
YFTPNKTEDTIFLR (14aa)
- P19652 Asn-72
DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
- P07602 Asn-80
SSCGKENTSDPSIVIAFGR (19aa)
- P11279 Asn-84
ADGTVNQIEGEATPVNLTEPAK (22aa)
- P05090 Asn-88
QNQCFYNSSYLNVQR (15aa)
- P19652 Asn-88
QNQCFYNSSYLNVQR (15aa)
- P19652 Asn-93
QDQCIYNTTYLNVQR (15aa)
- P02763 Asn-93
QDQCIYNTTYINVQR (15aa)
- P02763 Asn-93
ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- P05090 Asn-98
IAVQFGPGFSWIANFTK (17aa)
- P13473 Asn-101
FNLTETSEAEIHQSFQHLLR (20aa)
- P01011 Asn-106
ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
- P01009 Asn-107
TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122
EHEGAIYPDNTTDFQR (16aa)
- P00450 Asn-138
VYSSANNCTFEYVSQPFLMDLEGK (24aa)
- P0DTC2 Asn-165
VYSSANNCTFE (11aa)
- P0DTC2 Asn-165
HGIQYFNNNTQHSSLFTLNEVK (22aa)
- P01042 Asn-169
- VAR_019278 178:M→T dbSNP:rs1656922
ETFFNISK (8aa)
- Q9UK55 Asn-180
ALPGNLTAAVMEANQTGHEFPDR (23aa)
- Q9H8L6 Asn-205
CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- P07911 Asn-232
DLPQGFSALEPLVDLPIGINITR (23aa)
- P0DTC2 Asn-234
VVLHPNYSQVDIGLIK (16aa)
- P00738 Asn-241
ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
- P51884 Asn-252
MNSSIMANVTKAFVGDSK (18aa)
- Q2WGJ9 Asn-259
YTGNASALFILPDQDKMEEVEAMLLPETLK (30aa)
- P01011 Asn-271
YTGNASALFILPDQDK (16aa)
- P01011 Asn-271
YNENGTITDAVDCALDPLSETK (22aa)
- P0DTC2 Asn-282
LNAENNATFYFK (12aa)
- P01042 Asn-294
QDFNITDISLLEHR (14aa)
- P07911 Asn-322
LPTTVLNATAK (11aa)
- Q9GZM5 Asn-337
NPVGLIGAENATGETDPSHSK (21aa)
- P43251 Asn-349
LANLTQGEDQYYLR (14aa)
- P10909 Asn-374
IIIAGTNSSDIQQIISIIESNK (22aa)
- P08195 Asn-381
GINITEDTYKPR (12aa)
- Q08380 Asn-398
YKGLNLTEDTYKPR (14aa)
- Q08380 Asn-398
YAAVNITTNQAAPSEVPTLR (20aa)
- P54753 Asn-445
VEITTNQSIIIGGLFPGTK (19aa)
- Q12913 Asn-501
FILNTENNFTLTDNHDNTANITVK (24aa)
- P33151 Asn-519
NRMSLWNISTVMAPNLFFSR (20aa)
- Q9P2N2 Asn-534
AGCLIGAEHVNNSYE (15aa)
- P0DTC2 Asn-657
AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- P0DTC2 Asn-657
ELHHLQEQNVSNAFLDK (17aa)
- P00450 Asn-762
NLNESLIDLQELGK (14aa)
- P0DTC2 Asn-1194
NLNESLIDLQELGKYEQYIK (20aa)
- P0DTC2 Asn-1194
HYLMWGLSSDFWGEKPNLSYIIGK (24aa)
- P01024 Asn-1617
FVEGSHNSTVSLTTK (15aa)
- P04114 Asn-3411

- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)
- N-Linked / Complex (avg mass : 3683.3567)

- Hex:7 HexNAc:6 dHex:1 NeuAc:4 / N-Linked (avg mass : 3683.3567)