taxonomy (9)
protein (51)
source (29)
structure (21)
composition (1)
disease (7)
reference (43)
site (68)
peptide (48)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Gallus gallus (Chicken)
- Calloselasma rhodostoma (Malayan pit viper)
- Human immunodeficiency virus type 1 (HIV-1)
- Influenza a virus (strain a/ussr/90/1977 h1n1) (Influenza a virus (strain a/ussr/90/1977 h1n1))
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-1-antitrypsin / Homo sapiens P01009
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Biotinidase / Homo sapiens P43251
- Butyrophilin subfamily 1 member A1 / Homo sapiens Q13410
- Cadherin-5 / Homo sapiens P33151
- Ceruloplasmin / Homo sapiens P00450
- Chimeric plasminogen activator K2-tuPA / Homo sapiens P00749 P00750
- Clusterin / Homo sapiens P10909
- Coagulation factor IX / Homo sapiens P00740
- Coagulation factor VIII / Homo sapiens P00451
- Complement c3 / Homo sapiens P01024
- Ephrin type-B receptor 3 / Homo sapiens P54753
- Epidermal growth factor receptor / Homo sapiens P00533
- Erythropoietin / Homo sapiens P01588
- Fer-1-like protein 6 / Homo sapiens Q2WGJ9
- Follitropin, alpha and beta chains / Homo sapiens P01225 P01215
- Galectin-3-binding protein / Homo sapiens Q08380
- Glycocalicin / Homo sapiens P07359
- Haptoglobin / Homo sapiens P00738
- Integrin alpha-5/beta-1 / Homo sapiens P05556 P08648
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Kininogen-1 / Homo sapiens P01042
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens P08637
- Lumican / Homo sapiens P51884
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Mammaglobin-A / Homo sapiens Q13296
- Multimerin-2 / Homo sapiens Q9H8L6
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Protein YIPF3 / Homo sapiens Q9GZM5
- Protein Z-dependent protease inhibitor / Homo sapiens Q9UK55
- Receptor-type tyrosine-protein phosphatase eta / Homo sapiens Q12913
- Rho GTPase-activating protein 28 / Homo sapiens Q9P2N2
- Thrombopoietin / Homo sapiens P40225
- Tissue-type plasminogen activator / Homo sapiens P00750
- Uncharacterized protein from Pleura / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Vitamin k-dependent protein c / Homo sapiens P04070
- Acetylcholinesterase / Bos taurus P23795
- Uncharacterized protein / Bos taurus
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Neuroligin 1 / Rattus norvegicus Q62765
- Ancrod / Calloselasma rhodostoma P26324
- Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1) P03453
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Cerebellum (UBERON_0002037)
- Colon (UBERON_0001155)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Kidney (UBERON_0002113)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911) C127 (CVCL_6550)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- neocortex (UBERON:0001950)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992)
- Placenta (UBERON_0001987)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Striatum (UBERON_0002345)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- HEK293 (CVCL_0045)
- HEK293SF-3F6 (CVCL_4V95)
- Platelet (CL_0000233) Plasma Membrane (GO_0005886)
- Plasma Membrane (GO_0005886)
Source
- N-Linked / Complex / Structure 788
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 4 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 4 x NeuAc(a2-?)"
- N-Linked / Complex / NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-3)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-?)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-3)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / Structure 10701
- N-Linked / Complex / Structure 11736
- N-Linked / Complex / Structure 11863
Reported structure
- Cancer, breast (DOID:1612)
- Carcinoma, Squamous cell (DOID:1749)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Familial hepatic adenoma (DOID:111366)
- Leukemia, Myloid, Chronic (DOID:8552)
- Prostate cancer (DOID:10283)
Disease
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
- Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
- Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
- Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- Novel Asn-linked oligosaccharides terminating in GalNAc beta (1-->4)[Fuc alpha (1-->3)]GlcNAc beta (1-->.) are present in recombinant human protein C expressed in human kidney 293 cells. (1993 - Yan S, Chao Y, van Halbeek H) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
- Carbohydrate structure of a thrombin-like serine protease from Agkistrodon rhodostoma. Structure elucidation of oligosaccharides by methylation analysis, liquid secondary-ion mass spectrometry and proton magnetic resonance. (1992 - Pfeiffer G, Dabrowski U, Dabrowski J, Stirm S, Strube K, Geyer R) / Status : Reviewed
- The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
- Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
- Determination of the branch location of extra N-acetyllactosamine units in sialo N-linked tetraantennary oligosaccharides. (1991 - Hokke C, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
- Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
- Sialylated carbohydrate chains of recombinant human glycoproteins expressed in Chinese hamster ovary cells contain traces of N-glycolylneuraminic acid. (1990 - Hokke C, Bergwerff A, van Dedem G, van Oostrum J, Kamerling J, Vliegenthart J) / Status : Reviewed
- Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
- Identification of a tetrasialylated monofucosylated tetraantennary N-linked carbohydrate chain in human platelet glycocalicin. (1988 - Korrel S, Clemetson K, van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
- The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
- The asparagine-linked sugar chains of the glycoproteins in calf thymocyte plasma membrane. Structural studies of acidic oligosaccharides. (1980 - Yoshima H, Takasaki S, Kobata A) / Status : Reviewed
Reference
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
-
Alpha-1-antitrypsin / Homo sapiens
- Undefined site
- Asn-107
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Biotinidase / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- Cadherin-5 / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Chimeric plasminogen activator K2-tuPA / Homo sapiens
- Clusterin / Homo sapiens
-
Coagulation factor IX / Homo sapiens
- Undefined site
-
Coagulation factor VIII / Homo sapiens
- Undefined site
- Complement c3 / Homo sapiens
- Ephrin type-B receptor 3 / Homo sapiens
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
- Erythropoietin / Homo sapiens
- Fer-1-like protein 6 / Homo sapiens
-
Follitropin, alpha and beta chains / Homo sapiens
- Undefined site
- Galectin-3-binding protein / Homo sapiens
-
Glycocalicin / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Kininogen-1 / Homo sapiens
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Multimerin-2 / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Protein YIPF3 / Homo sapiens
- Protein Z-dependent protease inhibitor / Homo sapiens
- Receptor-type tyrosine-protein phosphatase eta / Homo sapiens
- Rho GTPase-activating protein 28 / Homo sapiens
-
Thrombopoietin / Homo sapiens
- Undefined site
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
-
Uncharacterized protein from Pleura / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
-
Vitamin k-dependent protein c / Homo sapiens
- Undefined site
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
Uncharacterized protein / Bos taurus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
Ancrod / Calloselasma rhodostoma
- Undefined site
- Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- LELNLTDSENATCLYAK (17aa)
- EAENITTGC (9aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- RLSPNASAEHLELRW (15aa)
- YETTNK (6aa)
- SLNENITVPDTK (12aa)
- YFTPNKTEDTIFLR (14aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- RCQTNLSTLSDPVQLE (16aa)
- QNQCFYNSSYLNVQR (15aa)
- QDQCIYNTTYINVQR (15aa)
- QDQCIYNTTYLNVQR (15aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- IAVQFGPGFSWIANFTK (17aa)
- FNLTETSEAEIHQSFQHLLR (20aa)
- ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
- GQALLVNSSQPWEPLQLHVDK (21aa)
- EHEGAIYPDNTTDFQR (16aa)
- HGIQYFNNNTQHSSLFTLNEVK (22aa)
- ETFFNISK (8aa)
- ALPGNLTAAVMEANQTGHEFPDR (23aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- VVLHPNYSQVDIGLIK (16aa)
- ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
- MNSSIMANVTKAFVGDSK (18aa)
- YTGNASALFILPDQDKMEEVEAMLLPETLK (30aa)
- YTGNASALFILPDQDK (16aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- LNAENNATFYFK (12aa)
- QDFNITDISLLEHR (14aa)
- LPTTVLNATAK (11aa)
- NPVGLIGAENATGETDPSHSK (21aa)
- LANLTQGEDQYYLR (14aa)
- IIIAGTNSSDIQQIISIIESNK (22aa)
- YKGLNLTEDTYKPR (14aa)
- GINITEDTYKPR (12aa)
- YAAVNITTNQAAPSEVPTLR (20aa)
- VEITTNQSIIIGGLFPGTK (19aa)
- NRMSLWNISTVMAPNLFFSR (20aa)
- FILNTENNFTLTDNHDNTANITVK (24aa)
- ELHHLQEQNVSNAFLDK (17aa)
- NLNESLIDLQELGK (14aa)
- NLNESLIDLQELGKYEQYIK (20aa)
- HYLMWGLSSDFWGEKPNLSYIIGK (24aa)
- FVEGSHNSTVSLTTK (15aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- Erythropoietin / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- EAENITTGC (9aa)
- RLSPNASAEHLELRW (15aa)
- SLNENITVPDTK (12aa)
- GQALLVNSSQPWEPLQLHVDK (21aa)
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Blood Plasma (UBERON_0001969)
-
Coagulation factor IX / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Blood Plasma (UBERON_0001969)
-
Coagulation factor IX / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Venom (UBERON_0007113)
-
Ancrod / Calloselasma rhodostoma
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Venom (UBERON_0007113)
-
Ancrod / Calloselasma rhodostoma
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Venom (UBERON_0007113)
-
Ancrod / Calloselasma rhodostoma
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Venom (UBERON_0007113)
-
Ancrod / Calloselasma rhodostoma
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Venom (UBERON_0007113)
-
Ancrod / Calloselasma rhodostoma
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992)
- Placenta (UBERON_0001987)
- Urine (UBERON_0001088)
- Carcinoma, Squamous cell (DOID:1749)
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
- Novel Asn-linked oligosaccharides terminating in GalNAc beta (1-->4)[Fuc alpha (1-->3)]GlcNAc beta (1-->.) are present in recombinant human protein C expressed in human kidney 293 cells. (1993 - Yan S, Chao Y, van Halbeek H) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
- The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
- Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization. (1992 - Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y) / Status : Reviewed
- Determination of the branch location of extra N-acetyllactosamine units in sialo N-linked tetraantennary oligosaccharides. (1991 - Hokke C, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
- Sialylated carbohydrate chains of recombinant human glycoproteins expressed in Chinese hamster ovary cells contain traces of N-glycolylneuraminic acid. (1990 - Hokke C, Bergwerff A, van Dedem G, van Oostrum J, Kamerling J, Vliegenthart J) / Status : Reviewed
- Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
- Chimeric plasminogen activator K2-tuPA / Homo sapiens
-
Coagulation factor VIII / Homo sapiens
- Undefined site
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
Erythropoietin / Homo sapiens
- Undefined site
-
Follitropin, alpha and beta chains / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
Thrombopoietin / Homo sapiens
- Undefined site
-
Uromodulin / Homo sapiens
- Undefined site
-
Vitamin k-dependent protein c / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
-
Vitamin k-dependent protein c / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
- Identification of a tetrasialylated monofucosylated tetraantennary N-linked carbohydrate chain in human platelet glycocalicin. (1988 - Korrel S, Clemetson K, van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
-
Glycocalicin / Homo sapiens
- Undefined site
-
Uromodulin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
-
Vitamin k-dependent protein c / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Colon (UBERON_0001155)
- Mammary Gland (UBERON_0001911) C127 (CVCL_6550)
- neocortex (UBERON:0001950)
- Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Leukemia, Myloid, Chronic (DOID:8552)
-
Uncharacterized protein from Pleura / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Plasma Membrane (GO_0005886)
-
Uncharacterized protein / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Kidney (UBERON_0002113)
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein 1 / Homo sapiens
- Undefined site
-
Alpha-1-antitrypsin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3683.3567)
- HEK293SF-3F6 (CVCL_4V95)
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Cerebellum (UBERON_0002037)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Striatum (UBERON_0002345)
-
- Hex:7 HexNAc:6 dHex:1 NeuAc:4 / N-Linked
(avg mass : 3683.3567)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- HEK293 (CVCL_0045)
- N-Linked / Complex / Structure 788
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 4 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 4 x NeuAc(a2-?)"
- N-Linked / Complex / NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-3)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)[NeuAc(?2-?)Hex(?1-?)HexNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-4)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-?)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-6)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-3)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / Structure 10701
- N-Linked / Complex / Structure 11736
- N-Linked / Complex / Structure 11863
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Biotinidase / Homo sapiens
- Cadherin-5 / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Clusterin / Homo sapiens
- Complement c3 / Homo sapiens
- Ephrin type-B receptor 3 / Homo sapiens
- Fer-1-like protein 6 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Haptoglobin / Homo sapiens
- Kininogen-1 / Homo sapiens
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Multimerin-2 / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Protein YIPF3 / Homo sapiens
- Protein Z-dependent protease inhibitor / Homo sapiens
- Receptor-type tyrosine-protein phosphatase eta / Homo sapiens
- Rho GTPase-activating protein 28 / Homo sapiens
- Uromodulin / Homo sapiens
- Hemagglutinin / Influenza a virus (strain a/ussr/90/1977 h1n1)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- LELNLTDSENATCLYAK (17aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- YETTNK (6aa)
- YFTPNKTEDTIFLR (14aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- RCQTNLSTLSDPVQLE (16aa)
- QNQCFYNSSYLNVQR (15aa)
- QDQCIYNTTYINVQR (15aa)
- QDQCIYNTTYLNVQR (15aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- IAVQFGPGFSWIANFTK (17aa)
- FNLTETSEAEIHQSFQHLLR (20aa)
- ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
- EHEGAIYPDNTTDFQR (16aa)
- HGIQYFNNNTQHSSLFTLNEVK (22aa)
- ETFFNISK (8aa)
- ALPGNLTAAVMEANQTGHEFPDR (23aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- VVLHPNYSQVDIGLIK (16aa)
- ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
- MNSSIMANVTKAFVGDSK (18aa)
- YTGNASALFILPDQDKMEEVEAMLLPETLK (30aa)
- YTGNASALFILPDQDK (16aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- LNAENNATFYFK (12aa)
- QDFNITDISLLEHR (14aa)
- LPTTVLNATAK (11aa)
- NPVGLIGAENATGETDPSHSK (21aa)
- LANLTQGEDQYYLR (14aa)
- IIIAGTNSSDIQQIISIIESNK (22aa)
- YKGLNLTEDTYKPR (14aa)
- GINITEDTYKPR (12aa)
- YAAVNITTNQAAPSEVPTLR (20aa)
- VEITTNQSIIIGGLFPGTK (19aa)
- NRMSLWNISTVMAPNLFFSR (20aa)
- FILNTENNFTLTDNHDNTANITVK (24aa)
- ELHHLQEQNVSNAFLDK (17aa)
- NLNESLIDLQELGK (14aa)
- NLNESLIDLQELGKYEQYIK (20aa)
- HYLMWGLSSDFWGEKPNLSYIIGK (24aa)
- FVEGSHNSTVSLTTK (15aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:7 HexNAc:6 dHex:1 NeuAc:4 / N-Linked
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 3683.3567)