Hex:6 HexNAc:4 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens    P30533
• Anoctamin-6 / Homo sapiens    Q4KMQ2
• Antithrombin-III / Homo sapiens    P01008
• Apolipoprotein d / Homo sapiens    P05090
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Biglycan / Homo sapiens    P21810
• Calbindin / Homo sapiens    P05937
• CD276 antigen / Homo sapiens    Q5ZPR3
• CD59 glycoprotein / Homo sapiens    P13987
• Ceruloplasmin / Homo sapiens    P00450
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens    Q11201
• Coagulation factor XIII B chain / Homo sapiens    P05160
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Complement component C9 / Homo sapiens    P02748
• Complement factor b / Homo sapiens    P00751
• Complement factor h / Homo sapiens    P08603
• Complement factor H-related protein 1 / Homo sapiens    Q03591
• Decorin / Homo sapiens    P07585
• Desmocollin-2 / Homo sapiens    Q02487
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens    P78536
• DNA-dependent protein kinase catalytic subunit / Homo sapiens    P78527
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens    Q8TCJ2
• Fibrillin-1 / Homo sapiens    P35555
• Fibrinogen beta chain / Homo sapiens    P02675
• Fibrinogen gamma chain / Homo sapiens    P02679
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Histidine-rich glycoprotein / Homo sapiens    P04196
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Integrin alpha-1 / Homo sapiens    P56199
• Integrin alpha-2 / Homo sapiens    P17301
• Integrin alpha-6 / Homo sapiens    P23229
• Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens    Q06033
• Interleukin-1 receptor accessory protein / Homo sapiens    Q9NPH3
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens    Q14767
• Lysosome membrane protein 2 / Homo sapiens    Q14108
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Mannan-binding lectin serine protease 1 / Homo sapiens    P48740
• Mimecan / Homo sapiens    P20774
• Niemann-Pick C1 protein / Homo sapiens    O15118
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens    Q96AY3
• Periostin / Homo sapiens    Q15063
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens    Q02809
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolargin / Homo sapiens    P51888
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein AMBP / Homo sapiens    P02760
• Protein disulfide-isomerase A2 / Homo sapiens    Q13087
• Prothrombin / Homo sapiens    P00734
• Reticulocalbin-1 / Homo sapiens    Q15293
• Secretogranin-3 / Homo sapiens    Q8WXD2
• Serotransferrin / Homo sapiens    P02787
• Sparc / Homo sapiens    P09486
• Tetraspanin-3 / Homo sapiens    O60637
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Uromodulin / Homo sapiens    P07911
• Vitronectin / Homo sapiens    P04004
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Ribonuclease, brain / Bos taurus    P39873
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus    
• Cadherin-10 / Mus musculus    P70408
• Cadherin-13 / Mus musculus    Q9WTR5
• Carbonic anhydrase-related protein 10 / Mus musculus    P61215
• Carboxypeptidase D / Mus musculus    O89001
• Carboxypeptidase M / Mus musculus    Q80V42
• Cell adhesion molecule 4 / Mus musculus    Q8R464
• Contactin-1 / Mus musculus    P12960
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus    P63137
• Golgi apparatus protein 1 / Mus musculus    Q61543
• Heparan sulfate 2-O-sulfotransferase 1 / Mus musculus    Q8R3H7
• Immunoglobulin superfamily member 8 / Mus musculus    Q8R366
• Integrin beta-2 / Mus musculus    P11835
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus    Q9R1V6-16
• Isoform 2 of Cell adhesion molecule 2 / Mus musculus    Q8BLQ9-2
• Leukocyte surface antigen CD47 / Mus musculus    Q61735
• Myelin-oligodendrocyte glycoprotein / Mus musculus    Q61885
• Nectin-1 / Mus musculus    Q9JKF6
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neurofascin / Mus musculus    A0A087WPX3
• Neuroplastin / Mus musculus    P97300
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Receptor-type tyrosine-protein phosphatase delta / Mus musculus    Q64487
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• SPARC / Mus musculus    P07214
• SPARC-like protein 1 / Mus musculus    P70663
• Tetraspanin-2 / Mus musculus    Q922J6
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Uncharacterized protein / Mus musculus    
• Uncharacterized protein / Mus musculus    
• Uncharacterized protein / Mus musculus    
• Uncharacterized protein / Mus musculus    
• Uncharacterized protein / Mus musculus    
• Uncharacterized protein / Mus musculus    
• Uncharacterized protein from Ascitic fluid / Mus musculus    
• Zinc transporter ZIP10 / Mus musculus    Q6P5F6
• Uncharacterized protein / Rattus norvegicus    
• Amiloride-sensitive amine oxidase / Sus scrofa    Q9TRC7
• Coagulation factor VIII / Sus scrofa    P12263
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Ascitic fluid (UBERON_0007795)   EL4 (CVCL_0255)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Seminal Fluid (UBERON_0006530)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)  
• BW5147 (CVCL_3896)   T-Lymphocyte (CL_0000084)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• J558L (CVCL_3949)  
• WEHI-231 (CVCL_0577)   B-Lymphocyte (CL_0000236)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• B-Lymphocyte (CL_0000236)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  
• T-Lymphocyte (CL_0000084)  
• Plasma Membrane (GO_0005886)  

Reported structure

• Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / Structure 9159
• Free / Lactose / Structure 9160
• Free / Lactose / Structure 9206
• N-Linked / Complex / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 9601
• N-Linked / Complex / Structure 9677
• N-Linked / Hybrid / Structure 9381
• N-Linked / Hybrid / Structure 9910
• N-Linked / Hybrid / Structure 10008

Composition

• Hex:6 HexNAc:4 dHex:1 (avg mass : 1949.7927 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Lymphoma, Lymphoblastic (DOID:0080147)
• Lymphoma, Thymic (DOID:10146)
• Myeloma (DOID:0070004)
• Prostate cancer (DOID:10283)

Reference

• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Unreviewed
• N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
• Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Cell type and maturation stage-dependent polymorphism of N-linked oligosaccharides on murine lymphocytes and lymphoma cells. (1991 - Yoshida T, Takahashi N, Nakashima I) / Status : Reviewed
• The structure of the asparagine-linked sugar chains of bovine brain ribonuclease. (1990 - Katoh H, Ohgi K, Irie M, Endo T, Kobata A) / Status : Reviewed
• A protein structural change in aglycosylated IgG3 correlates with loss of huFc gamma R1 and huFc gamma R111 binding and/or activation. (1990 - Lund J, Tanaka T, Takahashi N, Sarmay G, Arata Y, Jefferis R) / Status : Reviewed
• The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed

Reported glycosite

• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-127
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-107
  •        Asn-271
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
  •        Asn-176
• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
  •        Asn-268
• Anoctamin-6 / Homo sapiens
  •        Asn-361
• Antithrombin-III / Homo sapiens
  •        Asn-187
• Apolipoprotein d / Homo sapiens
  •        Asn-65
  •        Asn-98
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-3780
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-253
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Calbindin / Homo sapiens
  •        Asn-230
• CD276 antigen / Homo sapiens
  •        Asn-104
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Ceruloplasmin / Homo sapiens
  •        Asn-358
  •        Asn-397
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
  •        Asn-79
• Coagulation factor XIII B chain / Homo sapiens
  •        Asn-545
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
  •        Asn-2679
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Collagen alpha-3(VI) chain / Homo sapiens
  •        Asn-2558
  •        Asn-3037
• Complement component C9 / Homo sapiens
  •        Asn-415
• Complement factor b / Homo sapiens
  •        Asn-378
• Complement factor h / Homo sapiens
  •        Asn-911
  •        Asn-1095
• Complement factor H-related protein 1 / Homo sapiens
  •        Asn-194
• Decorin / Homo sapiens
  •        Asn-211
• Desmocollin-2 / Homo sapiens
  •        Asn-392
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-276
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
  •        Asn-539
• DNA-dependent protein kinase catalytic subunit / Homo sapiens
  •        Asn-1350
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
  •        Asn-623
• Fibrillin-1 / Homo sapiens
  •        Asn-1067
  •        Asn-1581
  •        Asn-1902
• Fibrinogen beta chain / Homo sapiens
  •        Asn-394
• Fibrinogen gamma chain / Homo sapiens
  •        Asn-78
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-542
  •        Asn-1236
• Haptoglobin / Homo sapiens
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-64
  •        Asn-187
  •        Asn-453
• Histidine-rich glycoprotein / Homo sapiens
  •        Asn-125
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-830
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Integrin alpha-1 / Homo sapiens
  •        Asn-317
• Integrin alpha-2 / Homo sapiens
  •        Asn-343
• Integrin alpha-6 / Homo sapiens
  •        Asn-770
• Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
  •        Asn-91
• Interleukin-1 receptor accessory protein / Homo sapiens
  •        Asn-118
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-215
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-2707
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-576
  •        Asn-1241
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
  •        Asn-421
• Lysosome membrane protein 2 / Homo sapiens
  •        Asn-249
  •        Asn-412
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
  •        Asn-275
  •        Asn-356
• Mannan-binding lectin serine protease 1 / Homo sapiens
  •        Asn-385
• Mimecan / Homo sapiens
  •        Asn-214
• Niemann-Pick C1 protein / Homo sapiens
  •        Asn-185
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-248
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
  •        Asn-182
• Periostin / Homo sapiens
  •        Asn-599
• Plexin-B2 / Homo sapiens
  •        Asn-528
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-186
  •        Asn-499
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
  •        Asn-197
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolargin / Homo sapiens
  •        Asn-327
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-1645
  •        Asn-2117
  •        Asn-2472
  •        Asn-3333
  •        Asn-4075
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Protein AMBP / Homo sapiens
  •        Asn-250
• Protein disulfide-isomerase A2 / Homo sapiens
  •        Asn-516
• Prothrombin / Homo sapiens
  •        Asn-416
• Reticulocalbin-1 / Homo sapiens
  •        Asn-53
• Secretogranin-3 / Homo sapiens
  •        Asn-346
• Serotransferrin / Homo sapiens
  •        Asn-432
  •        Asn-630
• Sparc / Homo sapiens
  •        Asn-116
• Tetraspanin-3 / Homo sapiens
  •        Asn-167
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-1069
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
• Uromodulin / Homo sapiens
  •        Asn-232
• Vitronectin / Homo sapiens
  •        Asn-169
  •        Asn-242
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Ribonuclease, brain / Bos taurus
  •        Asn-88
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Cadherin-10 / Mus musculus
  •        Asn-438
• Cadherin-13 / Mus musculus
  •        Asn-638
• Carbonic anhydrase-related protein 10 / Mus musculus
  •        Asn-116
• Carboxypeptidase D / Mus musculus
  •        Asn-625
• Carboxypeptidase M / Mus musculus
  •        Asn-38
• Cell adhesion molecule 4 / Mus musculus
  •        Asn-67
• Contactin-1 / Mus musculus
  •        Asn-494
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-505
• Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
  •        Asn-104
• Golgi apparatus protein 1 / Mus musculus
  •        Asn-161
• Heparan sulfate 2-O-sulfotransferase 1 / Mus musculus
  •        Asn-108
• Immunoglobulin superfamily member 8 / Mus musculus
  •        Asn-325
• Integrin beta-2 / Mus musculus
  •        Asn-644
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
  •        Asn-632
• Isoform 2 of Cell adhesion molecule 2 / Mus musculus
  •        Asn-40
• Leukocyte surface antigen CD47 / Mus musculus
  •        Asn-109
• Myelin-oligodendrocyte glycoprotein / Mus musculus
  •        Asn-59
• Nectin-1 / Mus musculus
  •        Asn-202
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
  •        Asn-725
• Neurofascin / Mus musculus
  •        Asn-881
• Neuroplastin / Mus musculus
  •        Asn-196
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-3954
  •        Asn-4126
• Receptor-type tyrosine-protein phosphatase delta / Mus musculus
  •        Asn-724
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-92
  •        Asn-168
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-153
• SPARC / Mus musculus
  •        Asn-115
• SPARC-like protein 1 / Mus musculus
  •        Asn-462
• Tetraspanin-2 / Mus musculus
  •        Asn-139
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-118
• Uncharacterized protein / Mus musculus
  •        Undefined site
• Uncharacterized protein / Mus musculus
  •        Undefined site
• Uncharacterized protein / Mus musculus
  •        Undefined site
• Uncharacterized protein / Mus musculus
  •        Undefined site
• Uncharacterized protein / Mus musculus
  •        Undefined site
• Uncharacterized protein / Mus musculus
  •        Undefined site
• Uncharacterized protein from Ascitic fluid / Mus musculus
  •        Undefined site
• Zinc transporter ZIP10 / Mus musculus
  •        Asn-341
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Amiloride-sensitive amine oxidase / Sus scrofa
  •        Undefined site
• Coagulation factor VIII / Sus scrofa
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-343

Mass spectrometry observed peptide

• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• SVAQNYSSITHLHSIGK (17aa)
  •    Q80V42    Asn-38     Carboxypeptidase M / Mus musculus
• VKGSQGQFPLTQNVTVVEGGTAILTCR (27aa)
  •    Q8BLQ9-2    Asn-40     Isoform 2 of Cell adhesion molecule 2 / Mus musculus
• GSQGQFPLTQNVTVVEGGTAILTCR (25aa)
  •    Q8BLQ9-2    Asn-40     Isoform 2 of Cell adhesion molecule 2 / Mus musculus
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
  •    Q15293    Asn-53     Reticulocalbin-1 / Homo sapiens
• ISPGKNATGMEVGWYR (16aa)
  •    Q61885    Asn-59     Myelin-oligodendrocyte glycoprotein / Mus musculus
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• CSDGWSFDATTLDDNGTMLFFK (22aa)
  •    P02790    Asn-64     Hemopexin / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein d / Homo sapiens
• QTLFFNGTR (9aa)
  •    Q8R464    Asn-67     Cell adhesion molecule 4 / Mus musculus
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• DLQSLEDILHQVENK (15aa)
  •    P02679    Asn-78     Fibrinogen gamma chain / Homo sapiens
• FNQTMQPIITAQNAIIEDDTYR (22aa)
  •    Q11201    Asn-79     CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-83     Polymeric immunoglobulin receptor / Homo sapiens
• TAFITNFTLTIDGVTYPGNVK (21aa)
  •    Q06033    Asn-91     Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92     Signal-regulatory protein alpha / Mus musculus
• IRNVSDTTK (9aa)
  •    P97797    Asn-92     Signal-regulatory protein alpha / Mus musculus
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein d / Homo sapiens
• TAIFPDIIAQGNASIR (16aa)
  •    Q5ZPR3    Asn-104     CD276 antigen / Homo sapiens
• LSYNVIPLNLTLDNR (15aa)
  •    P63137    Asn-104     Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
  •    P01009    Asn-107     Alpha-1-antitrypsin / Homo sapiens
• YHVLHINTTK (10aa)
  •    Q8R3H7    Asn-108     Heparan sulfate 2-O-sulfotransferase 1 / Mus musculus
• DIVEYYNDSNGSHVIQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• DAMVGNYTCEVTELSR (16aa)
  •    Q61735    Asn-109     Leukocyte surface antigen CD47 / Mus musculus
• VCSNDNKTFDSSCHFFATK (19aa)
  •    P07214    Asn-115     SPARC / Mus musculus
• VCSNDNK (7aa)
  •    P09486    Asn-116     Sparc / Homo sapiens
• LDKEHLVNISGGPMTYSHR (19aa)
  •    P61215    Asn-116     Carbonic anhydrase-related protein 10 / Mus musculus
• NTTYCSK (7aa)
  •    Q9NPH3    Asn-118     Interleukin-1 receptor accessory protein / Homo sapiens
• DEGDYFCELQVSGANPMSSNK (21aa)
  •    P01831    Asn-118     Thy-1 membrane glycoprotein / Mus musculus
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VIDFNCTTSSVSSAIANTK (19aa)
  •    P04196    Asn-125     Histidine-rich glycoprotein / Homo sapiens
• TINQSSDEIQISMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
  •    P43307    Asn-136     Translocon-associated protein subunit alpha / Homo sapiens
• ARGNGTLITFHSAFQCCGK (19aa)
  •    Q922J6    Asn-139     Tetraspanin-2 / Mus musculus
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •    P01877    Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• ACQFNR (6aa)
  •    P14231    Asn-153     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• VCQDCPIIAPINDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• LNLTTDPK (8aa)
  •    Q61543    Asn-161     Golgi apparatus protein 1 / Mus musculus
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• NQSVPISCCR (10aa)
  •    O60637    Asn-167     Tetraspanin-3 / Homo sapiens
• GIPDQKVNFTCK (12aa)
  •    P97797    Asn-168     Signal-regulatory protein alpha / Mus musculus
• VNFTCK (6aa)
  •    P97797    Asn-168     Signal-regulatory protein alpha / Mus musculus
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• AALAAFNAQNNGSNFQLEEISR (22aa)
  •    P02765    Asn-176     Alpha-2-HS-glycoprotein / Homo sapiens
• YHYNGTIIDGTSFDTSYSK (19aa)
  •    Q96AY3    Asn-182     Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
• ACNATNWIEYMFNK (14aa)
  •    O15118    Asn-185     Niemann-Pick C1 protein / Homo sapiens
• KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• QIGLYPVLVIDSSGYVNPNYTGR (23aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• SWPAVGNCSSAIR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• SWPAVGNCSSAL (12aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• SLTFNETYQDISELVYGAK (19aa)
  •    P01008    Asn-187     Antithrombin-III / Homo sapiens
• NASNMEYR (8aa)
  •    P97300    Asn-196     Neuroplastin / Mus musculus
• KNASNMEYR (9aa)
  •    P97300    Asn-196     Neuroplastin / Mus musculus
• EQINITIDHR (10aa)
  •    Q02809    Asn-197     Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
• LKGEAEYQEIRNPNGTVTVISR (22aa)
  •    Q9JKF6    Asn-202     Nectin-1 / Mus musculus
• NPNGTVTVISR (11aa)
  •    Q9JKF6    Asn-202     Nectin-1 / Mus musculus
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• KLNNLTFLYLDHNALESVPLNLPESLR (27aa)
  •    P20774    Asn-214     Mimecan / Homo sapiens
• NTTGFK (6aa)
  •    Q16363    Asn-215     Laminin subunit alpha-4 / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• VVIHPNYSQVDIGIIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• FEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR (39aa)
  •    P04004    Asn-242     Vitronectin / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• CNMINGTDGDSFHPIITK (18aa)
  •    Q14108    Asn-249     Lysosome membrane protein 2 / Homo sapiens
• YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
  •    P02760    Asn-250     Protein AMBP / Homo sapiens
• IGNWSAMPSCK (11aa)
  •    P02749    Asn-253     Beta-2-glycoprotein 1 / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• VIDLWDLAQSANLTDK (16aa)
  •    P30533    Asn-268     Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• VIYQNHNK (8aa)
  •    P11627    Asn-293     Neural cell adhesion molecule L1 / Mus musculus
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LHSNNITK (8aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• GNISTEK (7aa)
  •    P56199    Asn-317     Integrin alpha-1 / Homo sapiens
• IGPGEPLELLCNVSGALPPPGR (22aa)
  •    Q8R366    Asn-325     Immunoglobulin superfamily member 8 / Mus musculus
• INGTQICPN (9aa)
  •    P51888    Asn-327     Prolargin / Homo sapiens
• DQSEDDRQHECLNVTQLLK (19aa)
  •    Q6P5F6    Asn-341     Zinc transporter ZIP10 / Mus musculus
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• YFFNVSDEAAIIEK (14aa)
  •    P17301    Asn-343     Integrin alpha-2 / Homo sapiens
• NATDNISK (8aa)
  •    Q8WXD2    Asn-346     Secretogranin-3 / Homo sapiens
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• AGIQAFFQVQECNK (14aa)
  •    P00450    Asn-358     Ceruloplasmin / Homo sapiens
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• LNITCESSK (9aa)
  •    Q4KMQ2    Asn-361     Anoctamin-6 / Homo sapiens
• ALQAVYSMMSWPDDVPPEGWNR (22aa)
  •    P00751    Asn-378     Complement factor b / Homo sapiens
• NNLTTYK (7aa)
  •    P48740    Asn-385     Mannan-binding lectin serine protease 1 / Homo sapiens
  •    P05937    Asn-230     Calbindin / Homo sapiens
• ANYTILK (7aa)
  •    Q02487    Asn-392     Desmocollin-2 / Homo sapiens
• GTAGNAIMDGASQIMGENR (19aa)
  •    P02675    Asn-394     Fibrinogen beta chain / Homo sapiens
• YRGTAGNALMDGASQLMGENR (21aa)
  •    P02675    Asn-394     Fibrinogen beta chain / Homo sapiens
• ENITAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397     Ceruloplasmin / Homo sapiens
• TMVFPVMYLNESVHIDK (17aa)
  •    Q14108    Asn-412     Lysosome membrane protein 2 / Homo sapiens
• AVNITSENLIDDVVSLIR (18aa)
  •    P02748    Asn-415     Complement component C9 / Homo sapiens
• CLLYPPWDKNFTENDLLVR (19aa)
  •    P00734    Asn-416     Prothrombin / Homo sapiens
• NFTENDLLVR (10aa)
  •    P00734    Asn-416     Prothrombin / Homo sapiens
• DECWCPANSTGK (12aa)
  •    Q14767    Asn-421     Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• CGIVPVIAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• CGLVPVLAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• IFNIHSGNGSLYTSKPLDR (19aa)
  •    P70408    Asn-438     Cadherin-10 / Mus musculus
• AIPQPQNVTSIIGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• ILDQACGTDNQTYASSCHLFATK (23aa)
  •    P70663    Asn-462     SPARC-like protein 1 / Mus musculus
• GKANSTGTLVITNPTR (16aa)
  •    P12960    Asn-494     Contactin-1 / Mus musculus
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• CEGPGVPTVTVHNTTDKRR (19aa)
  •    Q9Z218    Asn-505     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• CEGPGVPTVTVHNTTDK (17aa)
  •    Q9Z218    Asn-505     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• CEGPGVPTVTVHNTTDKR (18aa)
  •    Q9Z218    Asn-505     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• PPANSTMGSK (10aa)
  •    Q13087    Asn-516     Protein disulfide-isomerase A2 / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• SCVAVTSAQPQNMSR (15aa)
  •    O15031    Asn-528     Plexin-B2 / Homo sapiens
• CQEAINATCK (10aa)
  •    P78536    Asn-539     Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• HEEGHMLNCTCFGQGR (16aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• TYENGSSVEYR (11aa)
  •    P05160    Asn-545     Coagulation factor XIII B chain / Homo sapiens
• QVLSYGQNLSFSFR (14aa)
  •    P11047    Asn-576     Laminin subunit gamma-1 / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• TTIVDNNTWNNSHIAIVGK (19aa)
  •    Q8TCJ2    Asn-623     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
• NNSNNFDLNR (10aa)
  •    O89001    Asn-625     Carboxypeptidase D / Mus musculus
• QQQHIFGSNVTDCSGNFCIFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• TLNCSGAHVK (10aa)
  •    Q9R1V6-16    Asn-632     Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
• INNTHALVSLLQNLNK (16aa)
  •    Q9WTR5    Asn-638     Cadherin-13 / Mus musculus
• ISKINNTHALVSLLQNLNK (19aa)
  •    Q9WTR5    Asn-638     Cadherin-13 / Mus musculus
• GPFEKNCSVQCAGMTLQTIPLK (22aa)
  •    P11835    Asn-644     Integrin beta-2 / Mus musculus
• KVEVEAVNATAVK (13aa)
  •    Q64487    Asn-724     Receptor-type tyrosine-protein phosphatase delta / Mus musculus
• GEGNETNNMVITWKPLR (17aa)
  •    P11627    Asn-725     Neural cell adhesion molecule L1 / Mus musculus
• QLSCVANQNGSQADCELGNPFK (22aa)
  •    P23229    Asn-770     Integrin alpha-6 / Homo sapiens
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• NVTAQICIDK (10aa)
  •    P12109    Asn-804     Collagen alpha-1(VI) chain / Homo sapiens
• ISAIDNIINHSSMFIK (16aa)
  •    Q9Y4L1    Asn-830     Hypoxia up-regulated protein 1 / Homo sapiens
• QMVENFSPNQTK (12aa)
  •    A0A087WPX3    Asn-881     Neurofascin / Mus musculus
• ISEENETTCYMGK (13aa)
  •    P08603    Asn-911     Complement factor h / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• CDSGFALDSEERNCTDIDECR (21aa)
  •    P35555    Asn-1067     Fibrillin-1 / Homo sapiens
• VVNSTTGTGEHIR (13aa)
  •    P35442    Asn-1069     Thrombospondin-2 / Homo sapiens
• SPYEMFGDEEVMCLNGNWTEPPQCK (25aa)
  •    Q03591    Asn-194     Complement factor H-related protein 1 / Homo sapiens
  •    P08603    Asn-1095     Complement factor h / Homo sapiens
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236     Fibronectin / Homo sapiens
• NISQDLEK (8aa)
  •    P11047    Asn-1241     Laminin subunit gamma-1 / Homo sapiens
• NTSPEGWK (8aa)
  •    P78527    Asn-1350     DNA-dependent protein kinase catalytic subunit / Homo sapiens
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581     Fibrillin-1 / Homo sapiens
• AFINGTGVETVVSADIPNAHGIAVDWVSR (29aa)
  •    Q07954    Asn-1645     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763     Collagen alpha-1(XII) chain / Homo sapiens
• DACGNGTCR (9aa)
  •    P35555    Asn-1902     Fibrillin-1 / Homo sapiens
• THANGSIK (8aa)
  •    Q07954    Asn-2117     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• VDIPQQPMGIIAVANDTNSCEISPCR (26aa)
  •    Q07954    Asn-2472     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• NALQINNTAVGHAL (14aa)
  •    P12111    Asn-2558     Collagen alpha-3(VI) chain / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens
• NASLALSASIGR (12aa)
  •    O15230    Asn-2707     Laminin subunit alpha-5 / Homo sapiens
• QNLTVTDR (8aa)
  •    P12111    Asn-3037     Collagen alpha-3(VI) chain / Homo sapiens
• TCVSNCTASQFVCK (14aa)
  •    Q07954    Asn-3333     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• SLTQGSLIVGDLAPVNGTSQGK (22aa)
  •    P98160    Asn-3780     Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
• GVTHLNISGLK (11aa)
  •    Q91ZX7    Asn-3954     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• LNGTDPIVAADSK (13aa)
  •    Q07954    Asn-4075     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• FGHSPLINLTGGLSHASDVVLYHQHK (26aa)
  •    Q91ZX7    Asn-4126     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus