Hex:6 HexNAc:5

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Canis familiaris (Dog)
• Mesocricetus auratus (Golden hamster)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Friend mink cell focus-forming virus
• Human immunodeficiency virus type 1 (lw12.3 isolate)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Afamin / Homo sapiens    P43652
• Alkaline phosphatase, intestinal / Homo sapiens    P09923
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-1b-glycoprotein / Homo sapiens    P04217
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-fetoprotein / Homo sapiens    P02771
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Apolipoprotein d / Homo sapiens    P05090
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Biglycan / Homo sapiens    P21810
• Bile-salt-activated lipase / Homo sapiens    P19835
• Choriogonadotropin - alpha and beta chains / Homo sapiens    P01215    P0DN86
• Choriogonadotropin beta chain / Homo sapiens    P0DN86
• Clusterin / Homo sapiens    P10909
• Coagulation factor x / Homo sapiens    P00742
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Complement factor h / Homo sapiens    P08603
• Decorin / Homo sapiens    P07585
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens    P78536
• Epidermal growth factor receptor / Homo sapiens    P00533
• Erythropoietin / Homo sapiens    P01588
• Fibrillin-1 / Homo sapiens    P35555
• Fibronectin / Homo sapiens    P02751
• Galectin-3-binding protein / Homo sapiens    Q08380
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens    P32942
• Interferon gamma / Homo sapiens    P01579
• Kininogen-1 / Homo sapiens    P01042
• L-selectin / Homo sapiens    P14151
• Lactotransferrin / Homo sapiens    P02788
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Lysosome membrane protein 2 / Homo sapiens    Q14108
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Niemann-Pick C1 protein / Homo sapiens    O15118
• Nuclear pore complex protein Nup98-Nup96 / Homo sapiens    P52948
• Phosphatidylcholine-sterol acyltransferase / Homo sapiens    P04180
• Plasminogen / Homo sapiens    P00747
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prickle-like protein 1 / Homo sapiens    Q96MT3
• Prorenin / Homo sapiens    P00797
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein AMBP / Homo sapiens    P02760
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens    Q5H9R7
• Serotransferrin / Homo sapiens    P02787
• Sulfatase-modifying factor 2 / Homo sapiens    Q8NBJ7
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Thrombospondin-1 / Homo sapiens    P07996
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Uncharacterized protein from Fluid / Homo sapiens    
• Uromodulin / Homo sapiens    P07911
• Vitronectin / Homo sapiens    P04004
• Von willebrand factor / Homo sapiens    P04275
• Alpha-1-acid glycoprotein / Bos taurus    Q3SZR3
• Alpha-2-hs-glycoprotein / Bos taurus    P12763
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Platelet glycoprotein IV / Bos taurus    P26201
• Alpha-1-acid glycoprotein / Canis familiaris    F6Y713
• Cadherin-13 / Mus musculus    Q9WTR5
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Major urinary protein / Mus musculus    
• Serotransferrin / Mus musculus    Q921I1
• Tenascin-r / Mus musculus    Q8BYI9
• Uncharacterized protein from B-Lymphocyte (Peripheral) / Mus musculus    
• Uncharacterized protein from Plasma Membrane / Mus musculus    
• Uncharacterized protein from T-Lymphocyte (Peripheral) / Mus musculus    
• Uncharacterized protein from T-Lymphocyte (Stimulated) / Mus musculus    
• Alpha-1-acid glycoprotein / Ovis aries    W5P7S6
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Alpha-1-acid glycoprotein / Rattus norvegicus    P02764
• Uncharacterized protein from Undefined tissue / Rattus norvegicus    
• Uncharacterized protein from Undefined tissue / Rattus norvegicus    
• Uncharacterized protein from Undefined tissue / Rattus norvegicus    
• Coagulation factor VIII / Sus scrofa    P12263
• Ovalbumin / Gallus gallus    P01012
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein from Egg Cell / Gallus gallus    
• Envelope glycoprotein / Friend mink cell focus-forming virus    
• Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)    Q70626
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amnion (UBERON_0000305)   FL (CVCL_1905)  
• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   BHK21/13/Py6 (CVCL_LM74)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Liver (UBERON_0002107)  
• Lung (UBERON_0002048)   Mv1Lu (CVCL_0593)  
• Mammalian Vulva (UBERON_0000997)   A-431 (CVCL_0037)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO B8-300 (CVCL_VU03)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Ovary (UBERON_0000992)   IM4 (CVCL_VT63)  
• Ovary (UBERON_0000992)   IM4/IV (CVCL_VT64)  
• Ovary (UBERON_0000992)   IM4/V/IV (CVCL_VT67)  
• Ovary (UBERON_0000992)   IM4/Vh (CVCL_VT65)  
• Ovary (UBERON_0000992)   IM4/Vm (CVCL_VT66)  
• Ovary (UBERON_0000992)   Sf21 (CVCL_0518)  
• Pancreas (UBERON_0001264)  
• Placenta (UBERON_0001987)   JEG-3 (CVCL_0363)   Epithelium (CL_0002577)  
• Placenta (UBERON_0001987)  
• Pleura (UBERON_0000977)   K-562 (CVCL_0004)  
• Spleen (UBERON_0002106)  
• Urine (UBERON_0001088)  
• 3Y1-B clone 1 (CVCL_4563)  
• FreeStyle 293-F (CVCL_D603)  
• H9 (CVCL_1240)   Lymphocyte (CL_0000542)  
• HEK293 (CVCL_0045)  
• NIH 3T3 (CVCL_0594)   Fibroblast (CL_0000057)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• B-Lymphocyte (CL_0000236)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  
• Egg Cell  
• Leukocyte (CL_0000738)  
• T-Lymphocyte (CL_0000084)  
• Cerebrospinal Fluid Secretion (GO_0033326)  
• Plasma Membrane (GO_0005886)  

Reported structure

• N-Linked / Complex / Structure 644
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)[Gal(b1-3)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)[Gal(b1-3)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-3)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-3)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(?1-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-3)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)Man(a1-3)[Gal(b1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-?)GlcNAc(?1-?)"
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-2)[Gal(b1-3)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-2)[Gal(b1-?)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-?)GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)[Gal(b1-?)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-?)GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 9457
• N-Linked / Complex / Structure 9589
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc

Composition

• Hex:6 HexNAc:5 (avg mass : 2006.8447 )

Disease

• Anemia, Aplastic (DOID:12449)
• Cancer, breast (DOID:1612)
• Carcinoma (DOID:305)
• Carcinoma, Gallbladder which metastasises to the liver (DOID:4948)
• Carcinoma, Hepatocellular (DOID:684)
• Carcinoma, Squamous cell (DOID:1749)
• Choriocarcinoma (DOID:3594)
• Choriocarcinoma, with Hyperthyroidism
• COVID-19 (DOID:0080600)
• Diabetes Mellitus (DOID:9351)
• Gangliosidosis GM1 (DOID:3322)
• Gaucher Disease (DOID:1926)
• Hydatidiform Mole (DOID:3590)
• Hydatidiform Mole, Invasive (DOID:3590)
• Leukemia, Acute lymphoblastic (DOID:9952)
• Leukemia, Myloid, Chronic (DOID:8552)
• Prostate cancer (DOID:10283)

Reference

• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Protein and Site Specificity of Fucosylation in Liver-Secreted Glycoproteins (2014 - Pompach P, Ashline DJ, Brnakova Z, Benicky J, Sanda M, Goldman R.) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
• Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
• Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
• Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50). (2001 - Funatsu O, Sato T, Kotovuori P, Gahmberg CG, Ikekita M, Furukawa K) / Status : Reviewed
• Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
• Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
• Glycosylated major urinary protein of the house mouse: characterization of its N-linked oligosaccharides. (2000 - Mechref Y, Zidek L, Ma W, Novotny M) / Status : Reviewed
• Structural analysis of trisialylated biantennary glycans isolated from mouse serum transferrin. Characterization of the sequence Neu5Gc(alpha 2-3)Gal(beta 1-3)[Neu5Gc(alpha 2-6)]GlcNAc(beta 1-2)Man. (2000 - Coddeville B, Regoeczi E, Strecker G, Plancke Y, Spik G) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Characterization of recombinant human plasma lecithin: cholesterol acyltransferase (LCAT): N-linked carbohydrate structures and catalytic properties. (1998 - Lacko A, Reason A, Nuckolls C, Kudchodkar B, Nair M, Sundarrajan G, Pritchard P, Morris H, Dell A) / Status : Reviewed
• Evidence for a site-specific fucosylation of N-linked oligosaccharide of immunoglobulin A1 from normal human serum. (1998 - Tanaka A, Iwase H, Hiki Y, Kokubo T, Ishii-Karakasa I, Toma K, Kobayashi Y, Hotta K) / Status : Reviewed
• Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
• Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
• Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995 - Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K) / Status : Reviewed
• Reducing-end modification of N-linked oligosaccharides with tyrosine. (1994 - Tamura T, Wadhwa M, Rice K) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Carbohydrate structures of human alpha-fetoprotein of patients with hepatocellular carcinoma: presence of fucosylated and non-fucosylated triantennary glycans. (1993 - Aoyagi Y, Suzuki Y, Igarashi K, Saitoh A, Oguro M, Yokota T, Mori S, Suda T, Isemura M, Asakura H) / Status : Reviewed
• The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
• Identification, quantification, and characterization of glycopeptides in reversed-phase HPLC separations of glycoprotein proteolytic digests. (1993 - Rohrer J, Cooper G, Townsend R) / Status : Reviewed
• Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Cell type and maturation stage-dependent polymorphism of N-linked oligosaccharides on murine lymphocytes and lymphoma cells. (1991 - Yoshida T, Takahashi N, Nakashima I) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
• Large-scale preparation and characterization of N-linked glycopeptides from bovine fetuin. (1990 - Rice K, Rao N, Lee Y) / Status : Reviewed
• The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
• Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
• Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
• Relationship between sugar chain structure and biological activity of recombinant human erythropoietin produced in Chinese hamster ovary cells. (1989 - Takeuchi M, Inoue N, Strickland T, Kubota M, Wada M, Shimizu R, Hoshi S, Kozutsumi H, Takasaki S, Kobata A) / Status : Reviewed
• Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
• Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
• Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
• The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
• Comparative study of the carbohydrate moieties of rat and human plasma alpha 1-acid glycoproteins. (1981 - Yoshima H, Matsumoto A, Mizuochi T, Kawasaki T, Kobata A) / Status : Reviewed
• The application of 500-MHz H-NMR spectroscopy for the structure elucidation of N-acetyllactosamine type asparagine-bound carbohydrate chains of glycoproteins. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Schmid K, Montreuil J, Fournet B, Hull W) / Status : Reviewed
• Determination of the primary structures of 16 asialo-carbohydrate units derived from human plasma alpha 1-acid glycoprotein by 360-MHZ 1H NMR spectroscopy and permethylation analysis. (1978 - Fournet B, Montreuil J, Strecker G, Dorland L, Haverkamp J, Vliegenthart F, Binette J, Schmid K) / Status : Reviewed

Reported glycosite

• Afamin / Homo sapiens
  •        Asn-402
• Alkaline phosphatase, intestinal / Homo sapiens
  •        Undefined site
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-33
  •        Asn-72
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-107
• Alpha-1b-glycoprotein / Homo sapiens
  •        Asn-44
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
  •        Asn-176
• Alpha-fetoprotein / Homo sapiens
  •        Undefined site
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Apolipoprotein d / Homo sapiens
  •        Asn-65
  •        Asn-98
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-89
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
• Biglycan / Homo sapiens
  •        Asn-270
• Bile-salt-activated lipase / Homo sapiens
  •        Undefined site
• Choriogonadotropin - alpha and beta chains / Homo sapiens
  •        Undefined site
• Choriogonadotropin beta chain / Homo sapiens
  •        Undefined site
• Clusterin / Homo sapiens
  •        Asn-291
• Coagulation factor x / Homo sapiens
  •        Asn-221
  •        Asn-231
• Collagen alpha-3(VI) chain / Homo sapiens
  •        Asn-2677
• Complement factor h / Homo sapiens
  •        Asn-529
  •        Asn-718
  •        Asn-882
  •        Asn-911
  •        Asn-1095
• Decorin / Homo sapiens
  •        Asn-211
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
  •        Asn-539
• Epidermal growth factor receptor / Homo sapiens
  •        Undefined site
• Erythropoietin / Homo sapiens
  •        Undefined site
• Fibrillin-1 / Homo sapiens
  •        Asn-1581
• Fibronectin / Homo sapiens
  •        Asn-528
• Galectin-3-binding protein / Homo sapiens
  •        Asn-551
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Undefined site
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-211
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-64
  •        Asn-187
  •        Asn-453
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-209
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens
  •        Undefined site
• Interferon gamma / Homo sapiens
  •        Undefined site
• Kininogen-1 / Homo sapiens
  •        Asn-169
  •        Asn-205
  •        Asn-294
• L-selectin / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-378
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-79
• Lysosome membrane protein 2 / Homo sapiens
  •        Asn-249
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-49
  •        Asn-275
  •        Asn-356
• Niemann-Pick C1 protein / Homo sapiens
  •        Asn-185
• Nuclear pore complex protein Nup98-Nup96 / Homo sapiens
  •        Asn-606
• Phosphatidylcholine-sterol acyltransferase / Homo sapiens
  •        Undefined site
• Plasminogen / Homo sapiens
  •        Undefined site
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-499
• Prickle-like protein 1 / Homo sapiens
  •        Asn-544
• Prorenin / Homo sapiens
  •        Undefined site
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Protein AMBP / Homo sapiens
  •        Asn-250
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
  •        Asn-682
• Serotransferrin / Homo sapiens
  •        Undefined site
  •        Asn-432
• Sulfatase-modifying factor 2 / Homo sapiens
  •        Asn-191
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Transferrin receptor protein 1 / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Fluid / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-396
  •        Asn-513
• Vitronectin / Homo sapiens
  •        Asn-242
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Alpha-1-acid glycoprotein / Bos taurus
  •        Undefined site
• Alpha-2-hs-glycoprotein / Bos taurus
  •        Undefined site
  •        Asn-99
  •        Asn-156
  •        Asn-176
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Alpha-1-acid glycoprotein / Canis familiaris
  •        Undefined site
• Cadherin-13 / Mus musculus
  •        Asn-671
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-505
• Major urinary protein / Mus musculus
  •        Undefined site
• Serotransferrin / Mus musculus
  •        Undefined site
• Tenascin-r / Mus musculus
  •        Undefined site
• Uncharacterized protein from B-Lymphocyte (Peripheral) / Mus musculus
  •        Undefined site
• Uncharacterized protein from Plasma Membrane / Mus musculus
  •        Undefined site
• Uncharacterized protein from T-Lymphocyte (Peripheral) / Mus musculus
  •        Undefined site
• Uncharacterized protein from T-Lymphocyte (Stimulated) / Mus musculus
  •        Undefined site
• Alpha-1-acid glycoprotein / Ovis aries
  •        Undefined site
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• Alpha-1-acid glycoprotein / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Coagulation factor VIII / Sus scrofa
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Egg Cell / Gallus gallus
  •        Undefined site
• Envelope glycoprotein / Friend mink cell focus-forming virus
  •        Undefined site
• Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
  •        Undefined site
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-282
  •        Asn-657

Mass spectrometry observed peptide

• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33
• WQMNFTVR (8aa)
  •    P13473    Asn-49
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• AIVNFTR (7aa)
  •    P98160    Asn-89
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• DADACNATNWIEYMFNK (17aa)
  •    O15118    Asn-185
• GQVYPWGNWFQPNR (14aa)
  •    Q8NBJ7    Asn-191
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-211
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241
• KVVLHPNYSQVDIGLIKL (18aa)
  •    P00738    Asn-241
• VVIHPNYSQVDIGIIK (16aa)
  •    P00738    Asn-241
• CNMINGTDGDSFHPIITK (18aa)
  •    Q14108    Asn-249
• YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
  •    P02760    Asn-250
• IININPNK (8aa)
  •    P11279    Asn-261
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• LNSSTIK (7aa)
  •    P13473    Asn-275
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• RHNSTGCLRM (10aa)
  •    P10909    Asn-291
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• GNTTTLISENGHAADTLTATNFR (23aa)
  •    Q14766    Asn-378
• CGIVPVIAENYNK (13aa)
  •    P02787    Asn-432
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499
• CEGPGVPTVTVHNTTDK (17aa)
  •    Q9Z218    Asn-505
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528
• CQEAINATCK (10aa)
  •    P78536    Asn-539
• DSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEK (42aa)
  •    Q96MT3    Asn-544
• KAAIPSALDTNSSKS (15aa)
  •    Q08380    Asn-551
• NLNNSNLFSPVNR (13aa)
  •    P52948    Asn-606
• LYQDVNCT (8aa)
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• ANYNLPIMVTDSGKPPMTNITDLR (24aa)
  •    Q9WTR5    Asn-671
• MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
  •    Q5H9R7    Asn-682
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• VPAQEKNF (8aa)
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581
• VAVVQHAPSESVDNASMPPVK (21aa)
  •    P12111    Asn-2677