taxonomy (17)
protein (26)
source (21)
structure (21)
composition (1)
disease (8)
reference (33)
site (42)
peptide (45)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Bufo bufo (European toad)
- Bufo viridis
- Rana utricularia
- Xenopus laevis (African clawed frog)
- Androctonus australis hector (Sahara scorpion)
- Caenorhabditis elegans
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Glycoprotein ln / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Muc1 fusion protein / Homo sapiens
- Mucin-7 / Homo sapiens Q8TAX7
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Uncharacterized protein from Fluid / Homo sapiens
- Uncharacterized protein from Seminal Fluid / Homo sapiens
- Unspecified mucin / Homo sapiens
- Mucin / Bos taurus
- Muc2 / Mus musculus
- Mucin / Rattus norvegicus
- Mucin-2 glycopeptide a / Rattus norvegicus Q62635
- Mucin-2 glycopeptide b / Rattus norvegicus Q62635
- Mucin / Sus scrofa
- Mucin / Bufo bufo
- Mucin / Bufo viridis
- Mucin / Rana utricularia
- Mucin / Xenopus laevis
- Toxin Aah6 / Androctonus australis hector P56743
- Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Cervical Mucosa (UBERON_0012248)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Duodenal Gland (UBERON_0001212)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Seminal Fluid (UBERON_0006530)
- Small Intestine (UBERON_0002108)
- Submandibular Gland (UBERON_0001736)
- Tracheal Mucosa (UBERON_0000379)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Egg Cell Jelly Coat
Source
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-?)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- O-Linked / Core 1 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)[Fuc(a1-2)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-2)][GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)[Fuc(a1-?)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(a1-4)]Gal(b1-3)[Fuc(a1-3)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(b1-3)]Gal(b1-3)[Fuc(a1-3)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-2)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)[Fuc(a1-?)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc+"+Fuc(a1-2)"
- O-Linked / Core 2 / Fuc(a1-?)[Gal(b1-?)]GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / No-core / Fuc(?1-?)Gal(?1-?)[Fuc(?1-?)]GlcNAc(?1-?)Gal(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)GlcNAc(?1-6)[Fuc(?1-2)Gal(?1-3)]GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-4)GlcNAc(?1-6)[Fuc(?1-2)Gal(?1-3)]GalNAc
Reported structure
- Hex:2 HexNAc:2 dHex:2 (avg mass : 1040.9761 )
Composition
- Adenocarcinoma (DOID:299)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, breast (DOID:1612)
- Cancer, Ovarian (Cystic) (DOID:2394)
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Ovarian cyst (DOID:5119)
- Prostate cancer (DOID:10283)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- Species-specificity of amphibia carbohydrate chains: the Bufo viridis case study (2002 - Coppin, Maes, Strecker) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
- Primary structures and Lewis blood-group-dependent expression of major sialylated saccharides from mucus glycoproteins of human seminal plasma. (1985 - Hanisch F, Egge H, Peter-Katalini J, Uhlenbruck G, Dienst C, Fangmann R) / Status : Reviewed
- Oligosaccharide structures of the low-molecular-weight salivary mucin from a normal individual and one with cystic fibrosis. (1985 - Reddy M, Levine M, Prakobphol A) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- Further characterization, by a combined high-performance liquid chromatography/1H-NMR approach, of the heterogeneity displayed by the neutral carbohydrate chains of human bronchial mucins. (1984 - Lamblin G, Boersma A, Lhermitte M, Roussel P, Mutsaers J, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
- Structural characterization of neutral oligosaccharides of human midcycle cervical mucin. (1982 - Yurewicz E, Matsuura F, Moghissi K) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
Reference
-
Glycoprotein ln / Homo sapiens
- Undefined site
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Mucin-7 / Homo sapiens
- Undefined site
- Plasma protease c1 inhibitor / Homo sapiens
-
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Muc2 / Mus musculus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Bufo viridis
- Undefined site
-
Mucin / Rana utricularia
- Undefined site
-
Mucin / Xenopus laevis
- Undefined site
- Toxin Aah6 / Androctonus australis hector
-
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- VATTVISK (8aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- TQSLLIVNNATNVVIK (16aa)
- FQFCNDPFLGVYYHKNNK (18aa)
- VYSSANNCTFE (11aa)
- SEFRVYSSANNCTFE (15aa)
- NGTITDAVDCALDPLSE (17aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- TFLLKYNENGTITDAVDCALDPLSETK (27aa)
- FPNITNLCPFGE (12aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FPNITNLCPFGEVFNATR (18aa)
- SIVRFPNITNLCPFGE (16aa)
- VFNATR (6aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRR (37aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR (39aa)
- AGCLIGAEHVNNSYE (15aa)
- HVNNSYE (7aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIE (39aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- QIYKTPPIKDFGGFNFSQILPDPSKPSK (28aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- DFGGFNFSQILPDPSK (16aa)
- TPPIKDFGGFNFSQILPDPSKPSK (24aa)
- KNFTTAPAICHDGK (14aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
- KNFTTAPAICHDGKAHFPRE (20aa)
- EGVFVSNGTHWFVTQR (16aa)
- EGVFVSNGTHWFVTQR (16aa)
- GVFVSNGTHWFVTQR (15aa)
- EELDKYFKNHTSPDVDLGDISGINASVVNIQK (32aa)
- ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
- ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
- YFKNHTSPDVDLGDISGINASVVNIQK (27aa)
- NHTSPDVDLGDISGINASVVNIQKE (25aa)
- NHTSPDVDLGDISGINASVVNIQKE (25aa)
- EELDKYFKNHTSPDVDLGDISGINASVVNIQKE (33aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- NLNESLIDLQELGK (14aa)
- VAKNLNE (7aa)
- IDRLNEVAKNLNESLIDLQE (20aa)
- NLNESLIDLQELGKYEQYIK (20aa)
- VAKNLNESLIDLQE (14aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / No-core (avg mass : 1040.9761)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
-
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
- N-Linked / No-core (avg mass : 1040.9761)
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Toxin Aah6 / Androctonus australis hector
-
- O-Linked / Core 1 (avg mass : 1040.9761)
- Egg Cell Jelly Coat
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Rana utricularia
- Undefined site
-
- O-Linked / Core 1 (avg mass : 1040.9761)
- Egg Cell Jelly Coat
-
Mucin / Bufo viridis
- Undefined site
-
- O-Linked / Core 1 (avg mass : 1040.9761)
- Ovary (UBERON_0000992)
- Cancer, Ovarian (Cystic) (DOID:2394)
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
- O-Linked / Core 1 (avg mass : 1040.9761)
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
- Primary structures and Lewis blood-group-dependent expression of major sialylated saccharides from mucus glycoproteins of human seminal plasma. (1985 - Hanisch F, Egge H, Peter-Katalini J, Uhlenbruck G, Dienst C, Fangmann R) / Status : Reviewed
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 1 (avg mass : 1040.9761)
- Ovary (UBERON_0000992)
- Ovarian cyst (DOID:5119)
-
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Egg Cell Jelly Coat
-
Mucin / Xenopus laevis
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Egg Cell Jelly Coat
-
Mucin / Xenopus laevis
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Egg Cell Jelly Coat
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
-
Mucin / Xenopus laevis
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Saliva (UBERON_0001836)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Cystic Fibrosis (DOID:1485)
-
Muc2 / Mus musculus
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Ovary (UBERON_0000992)
- Saliva (UBERON_0001836)
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Duodenal Gland (UBERON_0001212)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Submandibular Gland (UBERON_0001736)
- Tracheal Mucosa (UBERON_0000379)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, Ovarian (Cystic) (DOID:2394)
- Cystic Fibrosis (DOID:1485)
- Ovarian cyst (DOID:5119)
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- Further characterization, by a combined high-performance liquid chromatography/1H-NMR approach, of the heterogeneity displayed by the neutral carbohydrate chains of human bronchial mucins. (1984 - Lamblin G, Boersma A, Lhermitte M, Roussel P, Mutsaers J, van Halbeek H, Vliegenthart J) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Muc2 / Mus musculus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Cervical Mucosa (UBERON_0012248)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Saliva (UBERON_0001836)
- Cystic Fibrosis (DOID:1485)
-
Mucin-7 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2 (avg mass : 1040.9761)
- Cervical Mucosa (UBERON_0012248)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / No-core (avg mass : 1040.9761)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Adenocarcinoma (DOID:299)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Undefined core (avg mass : 1040.9761)
- Small Intestine (UBERON_0002108)
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- O-Linked / Undefined core (avg mass : 1040.9761)
- Small Intestine (UBERON_0002108)
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- Hex:2 HexNAc:2 dHex:2 / N-Linked (avg mass : 1040.9761)
- BTI-Tn-5B1-4 (CVCL_C190)
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-?)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- TQSLLIVNNATNVVIK (16aa)
- FQFCNDPFLGVYYHKNNK (18aa)
- VYSSANNCTFE (11aa)
- SEFRVYSSANNCTFE (15aa)
- NGTITDAVDCALDPLSE (17aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- TFLLKYNENGTITDAVDCALDPLSETK (27aa)
- FPNITNLCPFGE (12aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FPNITNLCPFGEVFNATR (18aa)
- SIVRFPNITNLCPFGE (16aa)
- VFNATR (6aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRR (37aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR (39aa)
- AGCLIGAEHVNNSYE (15aa)
- HVNNSYE (7aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIE (39aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- QIYKTPPIKDFGGFNFSQILPDPSKPSK (28aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- DFGGFNFSQILPDPSK (16aa)
- TPPIKDFGGFNFSQILPDPSKPSK (24aa)
- KNFTTAPAICHDGK (14aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
- KNFTTAPAICHDGKAHFPRE (20aa)
- EGVFVSNGTHWFVTQR (16aa)
- EGVFVSNGTHWFVTQR (16aa)
- GVFVSNGTHWFVTQR (15aa)
- EELDKYFKNHTSPDVDLGDISGINASVVNIQK (32aa)
- ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
- ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
- YFKNHTSPDVDLGDISGINASVVNIQK (27aa)
- NHTSPDVDLGDISGINASVVNIQKE (25aa)
- NHTSPDVDLGDISGINASVVNIQKE (25aa)
- EELDKYFKNHTSPDVDLGDISGINASVVNIQKE (33aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- NLNESLIDLQELGK (14aa)
- VAKNLNE (7aa)
- IDRLNEVAKNLNESLIDLQE (20aa)
- NLNESLIDLQELGKYEQYIK (20aa)
- VAKNLNESLIDLQE (14aa)
-
- Hex:2 HexNAc:2 dHex:2 / O-Linked (avg mass : 1040.9761)
- Urine (UBERON_0001088)
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)[Fuc(a1-?)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- Prostate cancer (DOID:10283)
- Plasma protease c1 inhibitor / Homo sapiens
- VATTVISK (8aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
Source
Disease
Reference
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Reference
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reference
Reported glycosite
Source
Reference
Reported glycosite
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reference
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Reference
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reference
Reported glycosite
Disease
Reference
Reported glycosite
Source
Disease
Reference
Reported glycosite
