taxonomy (17)
protein (26)
source (22)
structure (23)
composition (1)
disease (8)
reference (35)
site (32)
peptide (8)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Bufo bufo (European toad)
- Bufo viridis
- Rana utricularia
- Xenopus laevis (African clawed frog)
- Androctonus australis hector (Sahara scorpion)
- Caenorhabditis elegans
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Glycoprotein ln / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Muc1 fusion protein / Homo sapiens
- Mucin-7 / Homo sapiens Q8TAX7
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Uncharacterized protein from Ovary / Homo sapiens
- Uncharacterized protein from Seminal Fluid / Homo sapiens
- Unspecified mucin / Homo sapiens
- Mucin / Bos taurus
- Muc2 / Mus musculus
- Mucin / Rattus norvegicus
- Mucin-2 glycopeptide a / Rattus norvegicus Q62635
- Mucin-2 glycopeptide b / Rattus norvegicus Q62635
- Mucin / Sus scrofa
- Mucin / Bufo bufo
- Mucin / Bufo viridis
- Mucin / Rana utricularia
- Mucin / Xenopus laevis
- Toxin Aah6 / Androctonus australis hector P56743
- Uncharacterized protein / Caenorhabditis elegans
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Cervical Mucosa (UBERON_0012248)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Duodenal Gland (UBERON_0001212)
- Embryo (UBERON_0000922)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Seminal Fluid (UBERON_0006530)
- Small Intestine (UBERON_0002108)
- Submandibular Gland (UBERON_0001736)
- Tracheal Mucosa (UBERON_0000379)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Egg Cell Jelly Coat
Source
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-?)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 9617
- N-Linked / Undefined core / Structure 9777
- O-Linked / Core 1 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)[Fuc(a1-2)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-2)][GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)[Fuc(a1-?)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(a1-4)]Gal(b1-3)[Fuc(a1-3)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(b1-3)]Gal(b1-3)[Fuc(a1-3)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-2)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)[Fuc(a1-?)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc+"+Fuc(a1-2)"
- O-Linked / Core 2 / Fuc(a1-?)[Gal(b1-?)]GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / No-core / Fuc(?1-?)Gal(?1-?)[Fuc(?1-?)]GlcNAc(?1-?)Gal(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)GlcNAc(?1-6)[Fuc(?1-2)Gal(?1-3)]GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-4)GlcNAc(?1-6)[Fuc(?1-2)Gal(?1-3)]GalNAc
Reported structure
- Hex:2 HexNAc:2 dHex:2 (avg mass : 1040.9761 )
Composition
- Adenocarcinoma (DOID:299)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, breast (DOID:1612)
- Cancer, Ovarian (Cystic) (DOID:2394)
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Ovarian cyst (DOID:5119)
- Prostate cancer (DOID:10283)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- Species-specificity of amphibia carbohydrate chains: the Bufo viridis case study (2002 - Coppin, Maes, Strecker) / Status : Reviewed
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
- Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
- Oligosaccharide structures of the low-molecular-weight salivary mucin from a normal individual and one with cystic fibrosis. (1985 - Reddy M, Levine M, Prakobphol A) / Status : Reviewed
- Primary structures and Lewis blood-group-dependent expression of major sialylated saccharides from mucus glycoproteins of human seminal plasma. (1985 - Hanisch F, Egge H, Peter-Katalini J, Uhlenbruck G, Dienst C, Fangmann R) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- Further characterization, by a combined high-performance liquid chromatography/1H-NMR approach, of the heterogeneity displayed by the neutral carbohydrate chains of human bronchial mucins. (1984 - Lamblin G, Boersma A, Lhermitte M, Roussel P, Mutsaers J, van Halbeek H, Vliegenthart J) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
- Structural characterization of neutral oligosaccharides of human midcycle cervical mucin. (1982 - Yurewicz E, Matsuura F, Moghissi K) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
Reference
-
Glycoprotein ln / Homo sapiens
- Undefined site
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Mucin-7 / Homo sapiens
- Undefined site
- Plasma protease c1 inhibitor / Homo sapiens
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Muc2 / Mus musculus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Bufo viridis
- Undefined site
-
Mucin / Rana utricularia
- Undefined site
-
Mucin / Xenopus laevis
- Undefined site
- Toxin Aah6 / Androctonus australis hector
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
-
- N-Linked / No-core
(avg mass : 1040.9761)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
- N-Linked / No-core
(avg mass : 1040.9761)
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Toxin Aah6 / Androctonus australis hector
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1040.9761)
Detected as released in some experiments - COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- VFNATR (6aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- KNFTTAPAICHDGK (14aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
-
- N-Linked / Undefined core
(avg mass : 1040.9761)
Released - Embryo (UBERON_0000922)
-
- O-Linked / Core 1
(avg mass : 1040.9761)
- Egg Cell Jelly Coat
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Rana utricularia
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1040.9761)
- Egg Cell Jelly Coat
-
Mucin / Bufo viridis
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1040.9761)
- Ovary (UBERON_0000992)
- Cancer, Ovarian (Cystic) (DOID:2394)
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1040.9761)
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
- Primary structures and Lewis blood-group-dependent expression of major sialylated saccharides from mucus glycoproteins of human seminal plasma. (1985 - Hanisch F, Egge H, Peter-Katalini J, Uhlenbruck G, Dienst C, Fangmann R) / Status : Reviewed
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1040.9761)
- Ovary (UBERON_0000992)
- Ovarian cyst (DOID:5119)
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Egg Cell Jelly Coat
-
Mucin / Xenopus laevis
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Egg Cell Jelly Coat
-
Mucin / Xenopus laevis
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Egg Cell Jelly Coat
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
-
Mucin / Xenopus laevis
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Saliva (UBERON_0001836)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Cystic Fibrosis (DOID:1485)
-
Muc2 / Mus musculus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Ovary (UBERON_0000992)
- Saliva (UBERON_0001836)
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Duodenal Gland (UBERON_0001212)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Submandibular Gland (UBERON_0001736)
- Tracheal Mucosa (UBERON_0000379)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, Ovarian (Cystic) (DOID:2394)
- Cystic Fibrosis (DOID:1485)
- Ovarian cyst (DOID:5119)
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- Further characterization, by a combined high-performance liquid chromatography/1H-NMR approach, of the heterogeneity displayed by the neutral carbohydrate chains of human bronchial mucins. (1984 - Lamblin G, Boersma A, Lhermitte M, Roussel P, Mutsaers J, van Halbeek H, Vliegenthart J) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Muc2 / Mus musculus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Cervical Mucosa (UBERON_0012248)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Saliva (UBERON_0001836)
- Cystic Fibrosis (DOID:1485)
-
Mucin-7 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1040.9761)
- Cervical Mucosa (UBERON_0012248)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / No-core
(avg mass : 1040.9761)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Adenocarcinoma (DOID:299)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 1040.9761)
- Small Intestine (UBERON_0002108)
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 1040.9761)
- Small Intestine (UBERON_0002108)
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- Hex:2 HexNAc:2 dHex:2 / O-Linked
(avg mass : 1040.9761)
- Urine (UBERON_0001088)
- O-Linked / Core 1 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)[Fuc(a1-2)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-2)][GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)[Fuc(a1-?)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(a1-4)]Gal(b1-3)[Fuc(a1-3)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(b1-3)]Gal(b1-3)[Fuc(a1-3)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-2)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)[Fuc(a1-?)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc+"+Fuc(a1-2)"
- O-Linked / Core 2 / Fuc(a1-?)[Gal(b1-?)]GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / No-core / Fuc(?1-?)Gal(?1-?)[Fuc(?1-?)]GlcNAc(?1-?)Gal(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)GlcNAc(?1-6)[Fuc(?1-2)Gal(?1-3)]GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-4)GlcNAc(?1-6)[Fuc(?1-2)Gal(?1-3)]GalNAc
- Prostate cancer (DOID:10283)
- Plasma protease c1 inhibitor / Homo sapiens
- VATTVISK (8aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:2 HexNAc:2 dHex:2 / O-Linked
(avg mass : 1040.9761)
Source
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1040.9761)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1040.9761)
Source
Disease
Reported glycosite
- O-Linked / No-core
(avg mass : 1040.9761)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Source
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Source
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1040.9761)
Source
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 1040.9761)
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 1040.9761)
Source
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 1040.9761)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1040.9761)
Source
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 1040.9761)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 1040.9761)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1040.9761)
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / No-core
(avg mass : 1040.9761)
Source
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 1040.9761)