GlyConnect

taxonomy (16) protein (25) source (20) structure (21) composition (1) disease (7) reference (32) site (25) peptide (2)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:2 HexNAc:2 dHex:2 (avg mass : 1040.9761 )

Disease

Reference

Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
Species-specificity of amphibia carbohydrate chains: the Bufo viridis case study (2002 - Coppin, Maes, Strecker) / Status : Reviewed
Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
Oligosaccharide structures of the low-molecular-weight salivary mucin from a normal individual and one with cystic fibrosis. (1985 - Reddy M, Levine M, Prakobphol A) / Status : Reviewed
Primary structures and Lewis blood-group-dependent expression of major sialylated saccharides from mucus glycoproteins of human seminal plasma. (1985 - Hanisch F, Egge H, Peter-Katalini J, Uhlenbruck G, Dienst C, Fangmann R) / Status : Reviewed
The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
Further characterization, by a combined high-performance liquid chromatography/1H-NMR approach, of the heterogeneity displayed by the neutral carbohydrate chains of human bronchial mucins. (1984 - Lamblin G, Boersma A, Lhermitte M, Roussel P, Mutsaers J, van Halbeek H, Vliegenthart J) / Status : Reviewed
Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
Structural characterization of neutral oligosaccharides of human midcycle cervical mucin. (1982 - Yurewicz E, Matsuura F, Moghissi K) / Status : Reviewed
Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed

Reported glycosite

Glycoprotein ln / Homo sapiens
- Undefined site
Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Asn-1366
Muc1 fusion protein / Homo sapiens
- Undefined site
Mucin / Homo sapiens
- Undefined site
Mucin - mg2 / Homo sapiens
- Undefined site
Plasma protease c1 inhibitor / Homo sapiens
- Thr-47
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
Mucin / Bos taurus
- Undefined site
Muc2 / Mus musculus
- Undefined site
Mucin / Rattus norvegicus
- Undefined site
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
Mucin / Sus scrofa
- Undefined site
Mucin / Bufo bufo
- Undefined site
Mucin / Bufo viridis
- Undefined site
Mucin / Rana utricularia
- Undefined site
Mucin / Xenopus laevis
- Undefined site
Toxin Aah6 / Androctonus australis hector
- Asn-9
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
Phospholipase a2 / Apis mellifera
- Asn-46
Membrane glycoproteins / Bombyx mori
- Undefined site
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
Membrane glycoproteins / Mamestra brassicae
- Undefined site
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site

Mass spectrometry observed peptide

VATTVISK (8aa)
- P05155 Thr-47
CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- Q14766 Asn-1366

- O-Linked / Undefined core (avg mass : 1040.9761)
- O-Linked / Undefined core (avg mass : 1040.9761)
- O-Linked / No-core (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- O-Linked / Core 1 (avg mass : 1040.9761)
- O-Linked / Core 1 (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- O-Linked / Core 1 (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- O-Linked / Core 1 (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- O-Linked / Core 1 (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- O-Linked / Core 2 (avg mass : 1040.9761)
- N-Linked / No-core (avg mass : 1040.9761)
- N-Linked / No-core (avg mass : 1040.9761)

- Hex:2 HexNAc:2 dHex:2 / O-Linked (avg mass : 1040.9761)