Hex:4 HexNAc:4 dHex:2

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Bufo bufo (European toad)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-S1-casein / Homo sapiens    P47710
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Asporin / Homo sapiens    Q9BXN1
• Attractin / Homo sapiens    O75882
• Biglycan / Homo sapiens    P21810
• Calumenin / Homo sapiens    O43852
• Calumenin, isoform CRA_a / Homo sapiens    
• Chymotrypsin-like elastase family member 3B / Homo sapiens    P08861
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Fibronectin / Homo sapiens    P02751
• Gamma-glutamyl hydrolase / Homo sapiens    Q92820
• Golgi apparatus protein 1 / Homo sapiens    Q92896
• Haptoglobin / Homo sapiens    P00738
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Lumican / Homo sapiens    P51884
• Lysosomal Pro-X carboxypeptidase / Homo sapiens    P42785
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Periostin / Homo sapiens    Q15063
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Reticulocalbin-1 / Homo sapiens    Q15293
• Reticulocalbin-3 / Homo sapiens    Q96D15
• RNA polymerase II elongation factor ELL2 / Homo sapiens    O00472
• Sclerostin domain-containing protein 1 / Homo sapiens    Q6X4U4
• Serotransferrin / Homo sapiens    P02787
• Serpin h1 / Homo sapiens    P50454
• Sparc / Homo sapiens    P09486
• Thrombospondin-1 / Homo sapiens    P07996
• Thyroglobulin / Homo sapiens    P01266
• Transmembrane emp24 domain-containing protein 9 / Homo sapiens    Q9BVK6
• Uncharacterized protein from Ovary / Homo sapiens    
• Uncharacterized protein from Urine / Homo sapiens    
• Uncharacterized protein KIAA0232 / Homo sapiens    Q92628
• Unspecified mucin / Homo sapiens    
• Uromodulin / Homo sapiens    P07911
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Cell adhesion molecule 4 / Mus musculus    Q8R464
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Hepatocyte cell adhesion molecule / Mus musculus    Q640R3
• Hyaluronan and proteoglycan link protein 1 / Mus musculus    Q9QUP5
• Integrin alpha-V / Mus musculus    P43406
• Integrin beta-1 / Mus musculus    P09055
• Intercellular adhesion molecule 5 / Mus musculus    Q60625
• Isoform 2 of Cell adhesion molecule 2 / Mus musculus    Q8BLQ9-2
• Limbic system-associated membrane protein / Mus musculus    Q8BLK3
• Metabotropic glutamate receptor 3 / Mus musculus    Q9QYS2
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Neuronal pentraxin-1 / Mus musculus    Q62443
• Noelin / Mus musculus    O88998
• Phospholipase D3 / Mus musculus    O35405
• Plexin-B1 / Mus musculus    Q8CJH3
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Receptor-type tyrosine-protein phosphatase zeta / Mus musculus    B9EKR1
• Serine/arginine-rich splicing factor 3 / Mus musculus    P84104
• Sortilin-related receptor / Mus musculus    O88307
• Tenascin-r / Mus musculus    Q8BYI9
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Vascular cell adhesion protein 1 / Mus musculus    P29533
• Zinc transporter ZIP14 / Mus musculus    Q75N73
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries    Q712V9
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries    Q712V9
• Mucin / Bufo bufo    
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Mucosa of Stomach (UBERON_0001199)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Stomach (UBERON_0000945)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Egg Cell   Jelly Coat  

Reported structure

• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Fuc(a1-?)[Gal(b1-?)]GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 9523
• N-Linked / Complex / Structure 9558
• N-Linked / Complex / Structure 9958
• N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-?)GlcNAc(b1-6)]Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 1 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-?)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-?)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(b1-?)]Gal(b1-3)[Gal(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-6)[Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)]GalNAc

Composition

• Hex:4 HexNAc:4 dHex:2 (avg mass : 1771.6509 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Fucosidosis (DOID:14500)
• Ovarian cyst (DOID:5119)
• Prostate cancer (DOID:10283)
• Scrapie (DOID:5434)

Reference

• Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Structural analysis of hexa to dodecaoligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo. (1997 - Morelle W, Strecker G) / Status : Reviewed
• Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
• Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
• Structural characterization of neutral oligosaccharides of human H+Leb+ gastric mucin. (1984 - Slomiany B, Zdebska E, Slomiany A) / Status : Reviewed
• Structures of oligosaccharides cleaved by base-borohydride from an I, H and Lea active ovarian cyst glycoprotein. (1984 - Tanaka M, Dube V, Anderson B) / Status : Reviewed
• Structures of the neutral oligosaccharides isolated from A-active human gastric mucin. (1984 - Slomiany A, Zdebska E, Slomiany BL) / Status : Reviewed
• Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed

Reported glycosite

• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Asporin / Homo sapiens
  •        Asn-282
• Attractin / Homo sapiens
  •        Asn-863
• Biglycan / Homo sapiens
  •        Asn-270
• Calumenin / Homo sapiens
  •        Asn-131
• Calumenin, isoform CRA_a / Homo sapiens
  •        Asn-131
• Chymotrypsin-like elastase family member 3B / Homo sapiens
  •        Asn-114
• Clusterin / Homo sapiens
  •        Asn-354
  •        Asn-374
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2528
  •        Asn-2679
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Fibronectin / Homo sapiens
  •        Asn-528
• Gamma-glutamyl hydrolase / Homo sapiens
  •        Asn-307
• Golgi apparatus protein 1 / Homo sapiens
  •        Asn-786
• Haptoglobin / Homo sapiens
  •        Asn-211
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-440
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-215
• Lumican / Homo sapiens
  •        Asn-127
• Lysosomal Pro-X carboxypeptidase / Homo sapiens
  •        Asn-415
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-249
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
• Periostin / Homo sapiens
  •        Asn-599
• Plexin-B2 / Homo sapiens
  •        Asn-528
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-469
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Reticulocalbin-1 / Homo sapiens
  •        Asn-53
• Reticulocalbin-3 / Homo sapiens
  •        Asn-140
• RNA polymerase II elongation factor ELL2 / Homo sapiens
  •        Asn-500
• Sclerostin domain-containing protein 1 / Homo sapiens
  •        Asn-47
• Serotransferrin / Homo sapiens
  •        Asn-432
• Serpin h1 / Homo sapiens
  •        Asn-125
• Sparc / Homo sapiens
  •        Asn-116
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
• Thyroglobulin / Homo sapiens
  •        Asn-1365
• Transmembrane emp24 domain-containing protein 9 / Homo sapiens
  •        Asn-125
• Uncharacterized protein from Ovary / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Urine / Homo sapiens
  •        Undefined site
• Uncharacterized protein KIAA0232 / Homo sapiens
  •        Asn-724
• Unspecified mucin / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-275
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-307
• Cell adhesion molecule 4 / Mus musculus
  •        Asn-262
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-505
• Hepatocyte cell adhesion molecule / Mus musculus
  •        Asn-189
• Hyaluronan and proteoglycan link protein 1 / Mus musculus
  •        Asn-58
• Integrin alpha-V / Mus musculus
  •        Asn-869
• Integrin beta-1 / Mus musculus
  •        Asn-669
• Intercellular adhesion molecule 5 / Mus musculus
  •        Asn-397
• Isoform 2 of Cell adhesion molecule 2 / Mus musculus
  •        Asn-220
• Limbic system-associated membrane protein / Mus musculus
  •        Asn-300
• Metabotropic glutamate receptor 3 / Mus musculus
  •        Asn-439
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-613
• Neuronal pentraxin-1 / Mus musculus
  •        Asn-193
• Noelin / Mus musculus
  •        Asn-473
• Phospholipase D3 / Mus musculus
  •        Asn-234
• Plexin-B1 / Mus musculus
  •        Asn-1314
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-2128
  •        Asn-3090
• Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
  •        Asn-501
• Serine/arginine-rich splicing factor 3 / Mus musculus
  •        Asn-22
• Sortilin-related receptor / Mus musculus
  •        Asn-674
• Tenascin-r / Mus musculus
  •        Undefined site
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
  •        Asn-94
• Vascular cell adhesion protein 1 / Mus musculus
  •        Asn-225
• Zinc transporter ZIP14 / Mus musculus
  •        Asn-75
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •        Asn-184
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •        Asn-184
• Mucin / Bufo bufo
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-331
  •        Asn-343
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VYVGNLGNNGNK (12aa)
  •    P84104    Asn-22     Serine/arginine-rich splicing factor 3 / Mus musculus
• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• KNDATEILYSHVVKPVPAHPSSNSTLNQARN (31aa)
  •    Q6X4U4    Asn-47     Sclerostin domain-containing protein 1 / Homo sapiens
• VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
  •    Q15293    Asn-53     Reticulocalbin-1 / Homo sapiens
• GGNVTLPCK (9aa)
  •    Q9QUP5    Asn-58     Hyaluronan and proteoglycan link protein 1 / Mus musculus
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• IIVPINNRENISDPTSPIR (19aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SLLDHLHVGVGRDNVSQPK (19aa)
  •    Q75N73    Asn-75     Zinc transporter ZIP14 / Mus musculus
• VLTLANFTTK (10aa)
  •    P01831    Asn-94     Thy-1 membrane glycoprotein / Mus musculus
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• VCSNDNK (7aa)
  •    P09486    Asn-116     Sparc / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FTFTSHTPGEHQICIHSNSTK (21aa)
  •    Q9BVK6    Asn-125     Transmembrane emp24 domain-containing protein 9 / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FGCEIENNRSSGAFWK (16aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NVTYGTYIDDPDPDDGFNYK (20aa)
  •        Asn-131     Calumenin, isoform CRA_a / Homo sapiens
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGHYAPGEEFHDVEDAETYKK (24aa)
  •    Q96D15    Asn-140     Reticulocalbin-3 / Homo sapiens
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SSANNCTFEYVSQPF (15aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EEQFNSTFR (9aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• KTKPREEQYNSTYRV (15aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
• DGKPLLNDSR (10aa)
  •    Q640R3    Asn-189     Hepatocyte cell adhesion molecule / Mus musculus
• VNTLEEGKGGPKNDTEER (18aa)
  •    Q62443    Asn-193     Neuronal pentraxin-1 / Mus musculus
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
• NTTGFK (6aa)
  •    Q16363    Asn-215     Laminin subunit alpha-4 / Homo sapiens
• VDHESLNATPQVAMQVLEIHYTPSVK (26aa)
  •    Q8BLQ9-2    Asn-220     Isoform 2 of Cell adhesion molecule 2 / Mus musculus
• NTTISVHPSTR (11aa)
  •    P29533    Asn-225     Vascular cell adhesion protein 1 / Mus musculus
• ELGVVMYNCSCLAR (14aa)
  •    O35405    Asn-234     Phospholipase D3 / Mus musculus
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• WNRGNESLPER (11aa)
  •    Q8R464    Asn-262     Cell adhesion molecule 4 / Mus musculus
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Asn-275     Uromodulin / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• LGVTNASLVLFRPGSVR (17aa)
  •    Q8BLK3    Asn-300     Limbic system-associated membrane protein / Mus musculus
• ALIYQFSPIYTGNISSFQQCYIFD (24aa)
  •    Q92820    Asn-307     Gamma-glutamyl hydrolase / Homo sapiens
• FFHVNGSAFLPR (12aa)
  •    Q9DB72    Asn-307     BTB/POZ domain-containing protein 17 / Mus musculus
• ALIYQFSPIYTGNISSF (17aa)
  •    Q92820    Asn-307     Gamma-glutamyl hydrolase / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATRF (9aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NATRF (5aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• GFFCDAALDVDGETLRKNQSSELR (24aa)
  •    Q60625    Asn-397     Intercellular adhesion molecule 5 / Mus musculus
• NISSHTNIVFSNGELDPWSGGGVTK (25aa)
  •    P42785    Asn-415     Lysosomal Pro-X carboxypeptidase / Homo sapiens
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• INFTAPFNPNK (11aa)
  •    Q9QYS2    Asn-439     Metabotropic glutamate receptor 3 / Mus musculus
• KVPGNVTAVLGETLKV (16aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• ALYAWNNGHQTLYNVTLFHVIR (22aa)
  •    O88998    Asn-473     Noelin / Mus musculus
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• LNNSSPNSSGGVK (13aa)
  •    O00472    Asn-500     RNA polymerase II elongation factor ELL2 / Homo sapiens
• SDVPNTSPNSTSQHVAEFETER (22aa)
  •    B9EKR1    Asn-501     Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
• CEGPGVPTVTVHNTTDKR (18aa)
  •    Q9Z218    Asn-505     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• SCVAVTSAQPQNMSRR (16aa)
  •    O15031    Asn-528     Plexin-B2 / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• FSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASASAVLR (39aa)
  •    Q810U4    Asn-613     Neuronal cell adhesion molecule / Mus musculus
• KDTCAQECSHFNLTK (15aa)
  •    P09055    Asn-669     Integrin beta-1 / Mus musculus
• TPHATCFNGEDFDRPVVVSNCSCTR (25aa)
  •    O88307    Asn-674     Sortilin-related receptor / Mus musculus
• RTPHATCFNGEDFDRPVVVSNCSCTR (26aa)
  •    O88307    Asn-674     Sortilin-related receptor / Mus musculus
• NFTIS (5aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TCSPWSHSEETRSDNETLNIQFEESTQFNAEDINYVVPR (39aa)
  •    Q92628    Asn-724     Uncharacterized protein KIAA0232 / Homo sapiens
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• NDTLQEAK (8aa)
  •    Q92896    Asn-786     Golgi apparatus protein 1 / Homo sapiens
• DFGGFNFSQILPDPSKPSK (19aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• INVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTR (41aa)
  •    O75882    Asn-863     Attractin / Homo sapiens
• IKTPEKNDTAAAGQGER (17aa)
  •    P43406    Asn-869     Integrin alpha-V / Mus musculus
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QHVVPEKFEEPCLVNSSHLLMCR (23aa)
  •    Q8CJH3    Asn-1314     Plexin-B1 / Mus musculus
• GCKDNATDSVPLR (13aa)
  •    Q91ZX7    Asn-2128     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens
• MHLNGSNVQVLHR (13aa)
  •    Q91ZX7    Asn-3090     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• RMHLNGSNVQVLHR (14aa)
  •    Q91ZX7    Asn-3090     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus