Hex:4 HexNAc:4 dHex:2

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Bufo bufo (European toad)
• Human immunodeficiency virus type 1 (HIV-1)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-S1-casein / Homo sapiens    P47710
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Asporin / Homo sapiens    Q9BXN1
• Attractin / Homo sapiens    O75882
• Biglycan / Homo sapiens    P21810
• Calumenin / Homo sapiens    O43852
• Chymotrypsin-like elastase family member 3B / Homo sapiens    P08861
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Fibronectin / Homo sapiens    P02751
• Gamma-glutamyl hydrolase / Homo sapiens    Q92820
• Golgi apparatus protein 1 / Homo sapiens    Q92896
• Haptoglobin / Homo sapiens    P00738
• High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens    P12314-2
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens    P12318-1
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens    P31994-3
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens    O75015
• Lumican / Homo sapiens    P51884
• Lysosomal Pro-X carboxypeptidase / Homo sapiens    P42785
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Periostin / Homo sapiens    Q15063
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Reticulocalbin-1 / Homo sapiens    Q15293
• Reticulocalbin-3 / Homo sapiens    Q96D15
• RNA polymerase II elongation factor ELL2 / Homo sapiens    O00472
• Sclerostin domain-containing protein 1 / Homo sapiens    Q6X4U4
• Serotransferrin / Homo sapiens    P02787
• Serpin h1 / Homo sapiens    P50454
• Sparc / Homo sapiens    P09486
• Thrombospondin-1 / Homo sapiens    P07996
• Thyroglobulin / Homo sapiens    P01266
• Transmembrane emp24 domain-containing protein 9 / Homo sapiens    Q9BVK6
• Uncharacterized protein from Ovary / Homo sapiens    
• Uncharacterized protein from Urine / Homo sapiens    
• Uncharacterized protein KIAA0232 / Homo sapiens    Q92628
• Unspecified mucin / Homo sapiens    
• Uromodulin / Homo sapiens    P07911
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Cell adhesion molecule 4 / Mus musculus    Q8R464
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Hepatocyte cell adhesion molecule / Mus musculus    Q640R3
• Hyaluronan and proteoglycan link protein 1 / Mus musculus    Q9QUP5
• Integrin alpha-V / Mus musculus    P43406
• Integrin beta-1 / Mus musculus    P09055
• Intercellular adhesion molecule 5 / Mus musculus    Q60625
• Isoform 2 of Cell adhesion molecule 2 / Mus musculus    Q8BLQ9-2
• Limbic system-associated membrane protein / Mus musculus    Q8BLK3
• Metabotropic glutamate receptor 3 / Mus musculus    Q9QYS2
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Neuronal pentraxin-1 / Mus musculus    Q62443
• Noelin / Mus musculus    O88998
• Phospholipase D3 / Mus musculus    O35405
• Plexin-B1 / Mus musculus    Q8CJH3
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Receptor-type tyrosine-protein phosphatase zeta / Mus musculus    B9EKR1
• Serine/arginine-rich splicing factor 3 / Mus musculus    P84104
• Sortilin-related receptor / Mus musculus    O88307
• Tenascin-r / Mus musculus    Q8BYI9
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Vascular cell adhesion protein 1 / Mus musculus    P29533
• Zinc transporter ZIP14 / Mus musculus    Q75N73
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries    Q712V9
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries    Q712V9
• Mucin / Bufo bufo    
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Cerebellum (UBERON_0002037)  
• Cerebrospinal Fluid (UBERON_0001359)  
• Frontal Cortex (UBERON_0001870)  
• Hippocampul formation (UBERON:0002421)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Mucosa of Stomach (UBERON_0001199)  
• neocortex (UBERON:0001950)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Prefrontal Cortex (UBERON:0000451)  
• Stomach (UBERON_0000945)  
• Striatum (UBERON_0002345)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293SF-3F6 (CVCL_4V95)  
• LS180 (CVCL_0397)  
• T84 (CVCL_0555)  
• Egg Cell   Jelly Coat  

Reported structure

• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Fuc(a1-?)[Gal(b1-?)]GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 9523
• N-Linked / Complex / Structure 9558
• N-Linked / Complex / Structure 9958
• N-Linked / Complex / Structure 11525
• N-Linked / Complex / Structure 11581
• N-Linked / Complex / Structure 11622
• N-Linked / Complex / Structure 11821
• N-Linked / Complex / Structure 11835
• N-Linked / Complex / Structure 11902
• N-Linked / Complex / Structure 11945
• N-Linked / Hybrid / Structure 11429
• N-Linked / Hybrid / Structure 11588
• N-Linked / Hybrid / Structure 11698
• N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• O-Linked / Core 1 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-?)GlcNAc(b1-6)]Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 1 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-?)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-?)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(b1-?)]Gal(b1-3)[Gal(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-6)[Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)]GalNAc

Composition

• Hex:4 HexNAc:4 dHex:2 (avg mass : 1771.6509 )

Disease

• Alzheimer's disease (DOID:10652)
• Cancer, breast (DOID:1612)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Fucosidosis (DOID:14500)
• Mild Cognitive Impairment (DOID:0080832)
• Ovarian cyst (DOID:5119)
• Prostate cancer (DOID:10283)
• Schizophrenia (DOID:5419)
• Scrapie (DOID:5434)

Reference

• Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
• Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
• Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
• Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
• N-Glycosylation in isolated rat nerve terminals (2021 - Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR) / Status : Reviewed
• Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• CSF N-glycoproteomics for early diagnosis in Alzheimer's disease (2016 - Palmigiano A, Barone R, Sturiale L, Sanfilippo C, Bua RO, Romeo DA, Messina A, Capuana ML, Maci T, Le Pira F, Zappia M, Garozzo D) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
• Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Neutral N-glycans in adult rat brain tissue--complete characterisation reveals fucosylated hybrid and complex structures (1998 - Chen YJ, Wing DR, Guile GR, Dwek RA, Harvey DJ, Zamze S) / Status : Reviewed
• Structural analysis of hexa to dodecaoligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo. (1997 - Morelle W, Strecker G) / Status : Reviewed
• Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
• Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
• Structures of oligosaccharides cleaved by base-borohydride from an I, H and Lea active ovarian cyst glycoprotein. (1984 - Tanaka M, Dube V, Anderson B) / Status : Reviewed
• Structures of the neutral oligosaccharides isolated from A-active human gastric mucin. (1984 - Slomiany A, Zdebska E, Slomiany BL) / Status : Reviewed
• Structural characterization of neutral oligosaccharides of human H+Leb+ gastric mucin. (1984 - Slomiany B, Zdebska E, Slomiany A) / Status : Reviewed
• Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed

Reported glycosite

• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Asporin / Homo sapiens
  •        Asn-282
• Attractin / Homo sapiens
  •        Asn-863
• Biglycan / Homo sapiens
  •        Asn-270
• Calumenin / Homo sapiens
  •        Asn-131
• Chymotrypsin-like elastase family member 3B / Homo sapiens
  •        Asn-114
• Clusterin / Homo sapiens
  •        Asn-354
  •        Asn-374
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2528
  •        Asn-2679
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Fibronectin / Homo sapiens
  •        Asn-528
• Gamma-glutamyl hydrolase / Homo sapiens
  •        Asn-307
• Golgi apparatus protein 1 / Homo sapiens
  •        Asn-786
• Haptoglobin / Homo sapiens
  •        Asn-211
• High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-440
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-215
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
  •        Undefined site
• Lumican / Homo sapiens
  •        Asn-127
• Lysosomal Pro-X carboxypeptidase / Homo sapiens
  •        Asn-415
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-249
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
• Periostin / Homo sapiens
  •        Asn-599
• Plexin-B2 / Homo sapiens
  •        Asn-528
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-469
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Reticulocalbin-1 / Homo sapiens
  •        Asn-53
• Reticulocalbin-3 / Homo sapiens
  •        Asn-140
• RNA polymerase II elongation factor ELL2 / Homo sapiens
  •        Asn-500
• Sclerostin domain-containing protein 1 / Homo sapiens
  •        Asn-47
• Serotransferrin / Homo sapiens
  •        Asn-432
• Serpin h1 / Homo sapiens
  •        Asn-125
• Sparc / Homo sapiens
  •        Asn-116
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
• Thyroglobulin / Homo sapiens
  •        Asn-1365
• Transmembrane emp24 domain-containing protein 9 / Homo sapiens
  •        Asn-125
• Uncharacterized protein from Ovary / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Urine / Homo sapiens
  •        Undefined site
• Uncharacterized protein KIAA0232 / Homo sapiens
  •        Asn-724
• Unspecified mucin / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-275
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-307
• Cell adhesion molecule 4 / Mus musculus
  •        Asn-262
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-505
• Hepatocyte cell adhesion molecule / Mus musculus
  •        Asn-189
• Hyaluronan and proteoglycan link protein 1 / Mus musculus
  •        Asn-58
• Integrin alpha-V / Mus musculus
  •        Asn-869
• Integrin beta-1 / Mus musculus
  •        Asn-669
• Intercellular adhesion molecule 5 / Mus musculus
  •        Asn-397
• Isoform 2 of Cell adhesion molecule 2 / Mus musculus
  •        Asn-220
• Limbic system-associated membrane protein / Mus musculus
  •        Asn-300
• Metabotropic glutamate receptor 3 / Mus musculus
  •        Asn-439
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-613
• Neuronal pentraxin-1 / Mus musculus
  •        Asn-193
• Noelin / Mus musculus
  •        Asn-473
• Phospholipase D3 / Mus musculus
  •        Asn-234
• Plexin-B1 / Mus musculus
  •        Asn-1314
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-2128
  •        Asn-3090
• Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
  •        Asn-501
• Serine/arginine-rich splicing factor 3 / Mus musculus
  •        Asn-22
• Sortilin-related receptor / Mus musculus
  •        Asn-674
• Tenascin-r / Mus musculus
  •        Undefined site
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
  •        Asn-94
• Vascular cell adhesion protein 1 / Mus musculus
  •        Asn-225
• Zinc transporter ZIP14 / Mus musculus
  •        Asn-75
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •        Asn-184
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •        Asn-184
• Mucin / Bufo bufo
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-331
  •        Asn-343
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Undefined site
  •        Asn-331
  •        Asn-343

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VYVGNLGNNGNK (12aa)
  •    P84104    Asn-22     Serine/arginine-rich splicing factor 3 / Mus musculus
• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• KNDATEILYSHVVKPVPAHPSSNSTLNQARN (31aa)
  •    Q6X4U4    Asn-47     Sclerostin domain-containing protein 1 / Homo sapiens
• VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
  •    Q15293    Asn-53     Reticulocalbin-1 / Homo sapiens
• GGNVTLPCK (9aa)
  •    Q9QUP5    Asn-58     Hyaluronan and proteoglycan link protein 1 / Mus musculus
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• IIVPINNRENISDPTSPIR (19aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SLLDHLHVGVGRDNVSQPK (19aa)
  •    Q75N73    Asn-75     Zinc transporter ZIP14 / Mus musculus
• VLTLANFTTK (10aa)
  •    P01831    Asn-94     Thy-1 membrane glycoprotein / Mus musculus
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• VCSNDNK (7aa)
  •    P09486    Asn-116     Sparc / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FTFTSHTPGEHQICIHSNSTK (21aa)
  •    Q9BVK6    Asn-125     Transmembrane emp24 domain-containing protein 9 / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FGCEIENNRSSGAFWK (16aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NVTYGTYIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGHYAPGEEFHDVEDAETYKK (24aa)
  •    Q96D15    Asn-140     Reticulocalbin-3 / Homo sapiens
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SSANNCTFEYVSQPF (15aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EEQFNSTFR (9aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• KTKPREEQYNSTYRV (15aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
• DGKPLLNDSR (10aa)
  •    Q640R3    Asn-189     Hepatocyte cell adhesion molecule / Mus musculus
• VNTLEEGKGGPKNDTEER (18aa)
  •    Q62443    Asn-193     Neuronal pentraxin-1 / Mus musculus
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
• NTTGFK (6aa)
  •    Q16363    Asn-215     Laminin subunit alpha-4 / Homo sapiens
• VDHESLNATPQVAMQVLEIHYTPSVK (26aa)
  •    Q8BLQ9-2    Asn-220     Isoform 2 of Cell adhesion molecule 2 / Mus musculus
• NTTISVHPSTR (11aa)
  •    P29533    Asn-225     Vascular cell adhesion protein 1 / Mus musculus
• ELGVVMYNCSCLAR (14aa)
  •    O35405    Asn-234     Phospholipase D3 / Mus musculus
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• WNRGNESLPER (11aa)
  •    Q8R464    Asn-262     Cell adhesion molecule 4 / Mus musculus
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Asn-275     Uromodulin / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• LGVTNASLVLFRPGSVR (17aa)
  •    Q8BLK3    Asn-300     Limbic system-associated membrane protein / Mus musculus
• ALIYQFSPIYTGNISSFQQCYIFD (24aa)
  •    Q92820    Asn-307     Gamma-glutamyl hydrolase / Homo sapiens
• FFHVNGSAFLPR (12aa)
  •    Q9DB72    Asn-307     BTB/POZ domain-containing protein 17 / Mus musculus
• ALIYQFSPIYTGNISSF (17aa)
  •    Q92820    Asn-307     Gamma-glutamyl hydrolase / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATRF (9aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NATRF (5aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• GFFCDAALDVDGETLRKNQSSELR (24aa)
  •    Q60625    Asn-397     Intercellular adhesion molecule 5 / Mus musculus
• NISSHTNIVFSNGELDPWSGGGVTK (25aa)
  •    P42785    Asn-415     Lysosomal Pro-X carboxypeptidase / Homo sapiens
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• INFTAPFNPNK (11aa)
  •    Q9QYS2    Asn-439     Metabotropic glutamate receptor 3 / Mus musculus
• KVPGNVTAVLGETLKV (16aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• ALYAWNNGHQTLYNVTLFHVIR (22aa)
  •    O88998    Asn-473     Noelin / Mus musculus
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• LNNSSPNSSGGVK (13aa)
  •    O00472    Asn-500     RNA polymerase II elongation factor ELL2 / Homo sapiens
• SDVPNTSPNSTSQHVAEFETER (22aa)
  •    B9EKR1    Asn-501     Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
• CEGPGVPTVTVHNTTDKR (18aa)
  •    Q9Z218    Asn-505     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• SCVAVTSAQPQNMSRR (16aa)
  •    O15031    Asn-528     Plexin-B2 / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• FSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASASAVLR (39aa)
  •    Q810U4    Asn-613     Neuronal cell adhesion molecule / Mus musculus
• KDTCAQECSHFNLTK (15aa)
  •    P09055    Asn-669     Integrin beta-1 / Mus musculus
• TPHATCFNGEDFDRPVVVSNCSCTR (25aa)
  •    O88307    Asn-674     Sortilin-related receptor / Mus musculus
• RTPHATCFNGEDFDRPVVVSNCSCTR (26aa)
  •    O88307    Asn-674     Sortilin-related receptor / Mus musculus
• NFTIS (5aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TCSPWSHSEETRSDNETLNIQFEESTQFNAEDINYVVPR (39aa)
  •    Q92628    Asn-724     Uncharacterized protein KIAA0232 / Homo sapiens
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• NDTLQEAK (8aa)
  •    Q92896    Asn-786     Golgi apparatus protein 1 / Homo sapiens
• DFGGFNFSQILPDPSKPSK (19aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• INVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTR (41aa)
  •    O75882    Asn-863     Attractin / Homo sapiens
• IKTPEKNDTAAAGQGER (17aa)
  •    P43406    Asn-869     Integrin alpha-V / Mus musculus
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QHVVPEKFEEPCLVNSSHLLMCR (23aa)
  •    Q8CJH3    Asn-1314     Plexin-B1 / Mus musculus
• GCKDNATDSVPLR (13aa)
  •    Q91ZX7    Asn-2128     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens
• MHLNGSNVQVLHR (13aa)
  •    Q91ZX7    Asn-3090     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• RMHLNGSNVQVLHR (14aa)
  •    Q91ZX7    Asn-3090     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus