taxonomy (8)
protein (71)
source (27)
structure (23)
composition (1)
disease (11)
reference (26)
site (91)
peptide (72)
- Homo sapiens (Human)
- Mesocricetus auratus (Golden hamster)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Gallus gallus (Chicken)
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Marburg virus (strain musoke)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Acid ceramidase / Homo sapiens Q13510
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-S1-casein / Homo sapiens P47710
- Beta-secretase-fc fusion protein / Homo sapiens P56817
- Biglycan / Homo sapiens P21810
- Bone morphogenetic protein receptor type-2 / Homo sapiens Q13873
- BRCA2-interacting transcriptional repressor EMSY / Homo sapiens Q7Z589
- Carboxypeptidase D / Homo sapiens O75976
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- CD97 antigen / Homo sapiens P48960
- Choriogonadotropin - alpha and beta chains / Homo sapiens P0DN86 P01215
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Collagen alpha-3(VI) chain / Homo sapiens P12111
- Complement c3 / Homo sapiens P01024
- Contactin-4 / Homo sapiens Q8IWV2
- Desmoglein-2 / Homo sapiens Q14126
- Dipeptidase 1 / Homo sapiens P16444
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Epidermal growth factor receptor / Homo sapiens P00533
- Epithelial cell adhesion molecule / Homo sapiens P16422
- Erythropoietin / Homo sapiens P01588
- Fibrillin-1 / Homo sapiens P35555
- Fibronectin / Homo sapiens P02751
- Follistatin-related protein 1 / Homo sapiens Q12841
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- Hemopexin / Homo sapiens P02790
- Heparan sulfate 2-O-sulfotransferase 1 / Homo sapiens Q7LGA3
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Interleukin-1 receptor accessory protein / Homo sapiens Q9NPH3
- Laminin subunit alpha-5 / Homo sapiens O15230
- Laminin subunit gamma-1 / Homo sapiens P11047
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Low-density lipoprotein receptor-related protein 10 / Homo sapiens Q7Z4F1
- Lumican / Homo sapiens P51884
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens P16455
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Periostin / Homo sapiens Q15063
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Prolactin-inducible protein / Homo sapiens P12273
- Protein AMBP / Homo sapiens P02760
- Prothrombin / Homo sapiens P00734
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Secretogranin-3 / Homo sapiens Q8WXD2
- Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165
- Sparc / Homo sapiens P09486
- Thrombospondin-1 / Homo sapiens P07996
- Tigger transposable element-derived protein 6 / Homo sapiens Q17RP2
- Tissue alpha-L-fucosidase / Homo sapiens P04066
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens Q9Y3B3
- Tripeptidyl-peptidase 1 / Homo sapiens O14773
- tRNA (cytosine(34)-C(5))-methyltransferase / Homo sapiens Q08J23
- Major prion protein / Mesocricetus auratus P04273
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Structural glycoprotein / Marburg virus (strain musoke) P35253
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- Seminal Fluid (UBERON_0006530)
- Urine (UBERON_0001088)
- 3Y1-B clone 1 (CVCL_4563)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- LS174T (CVCL_1384)
- RPMI-1788 (CVCL_2710) B-Lymphocyte (CL_0000236)
- Adipocytes (CL_0000136)
- EBV-transformed B-cell (CL_0000236)
- Leukocyte (CL_0000738)
- Microsome (GO_0005792)
Source
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)]Man(a1-6)]Man(a1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4) + GlcNAc(b1-?)"
- N-Linked / Complex / Structure 9412
- N-Linked / Complex / Structure 9561
- N-Linked / Complex / Structure 9593
- N-Linked / Complex / Structure 10058
- N-Linked / Complex / Structure 10087
- N-Linked / Complex / Structure 10146
- N-Linked / Complex / Structure 10198
- N-Linked / Complex / Structure 10265
- N-Linked / Complex / Structure 10288
- N-Linked / Complex / Structure 10498
- N-Linked / Complex / Structure 10529
- N-Linked / Complex / Structure 11242
- N-Linked / Undefined core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
Reported structure
- Hex:6 HexNAc:6 dHex:1 (avg mass : 2356.1827 )
Composition
- Cancer, breast (DOID:1612)
- Carcinoma, Squamous cell (DOID:1749)
- Choriocarcinoma (DOID:3594)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Prostate cancer (DOID:10283)
- Schizophrenia (DOID:5419)
- Scrapie (DOID:5434)
Disease
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
- Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
Reference
- Acid ceramidase / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-S1-casein / Homo sapiens
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
- Biglycan / Homo sapiens
- Bone morphogenetic protein receptor type-2 / Homo sapiens
- BRCA2-interacting transcriptional repressor EMSY / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- CD97 antigen / Homo sapiens
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dipeptidase 1 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
- Epithelial cell adhesion molecule / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparan sulfate 2-O-sulfotransferase 1 / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Low-density lipoprotein receptor-related protein 10 / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Protein AMBP / Homo sapiens
- Prothrombin / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Secretogranin-3 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Sparc / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tigger transposable element-derived protein 6 / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens
- Tripeptidyl-peptidase 1 / Homo sapiens
- tRNA (cytosine(34)-C(5))-methyltransferase / Homo sapiens
-
Major prion protein / Mesocricetus auratus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- NGTILCSK (8aa)
- NCTWLILGSK (10aa)
- YETTNK (6aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- AEMNGSK (7aa)
- NQNGTFK (7aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- NGTYKF (6aa)
- TFYWDFYTNR (10aa)
- ISISNETK (8aa)
- YHVIHINTTK (10aa)
- AVIVNNITTGER (12aa)
- VCSNDNK (7aa)
- NTTYCSK (7aa)
- TQSLLIVNNATNVVIK (16aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- YPEELAWHTNLSR (13aa)
- GSNYSEILDK (10aa)
- NYSGGLAVK (9aa)
- VYSSANNCTFE (11aa)
- NNQSLP (6aa)
- SWPAVGNCSSAIR (13aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- YNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMR (37aa)
- SPLNTS (6aa)
- FHLANR (6aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- MNLTQLK (7aa)
- TVIENSTSYEEAK (13aa)
- IININPNK (8aa)
- MIENGSISFIPTIR (14aa)
- YIGNATAIFFIPDEGK (16aa)
- NGTITDAVDCALDPLSE (17aa)
- IIQVVYIHSNNITK (14aa)
- LHSNNITK (8aa)
- MFSQNDTR (8aa)
- FPNIT (5aa)
- FPNITNLCPFGE (12aa)
- RFPNIT (6aa)
- RNWTEAEVK (9aa)
- GEVFNATR (8aa)
- NATDNISK (8aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- NTTSVWYTSK (10aa)
- NFTENDLLVR (10aa)
- DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa)
- SIFLSHNNTK (10aa)
- YVQNGTYTVK (10aa)
- CYPTPSSSNDTR (12aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- FANEYPNITR (10aa)
- EVNDTLLVNELK (12aa)
- TPNNNGT (7aa)
- NMTLFSDLVAEK (12aa)
- TVGNQTSTK (9aa)
- VVPEGIRMNK (10aa)
- VPAQEKNF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- IVNNT (5aa)
- GINASVV (7aa)
- NSTPQQQK (8aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- NISQDLEK (8aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- DACGNGTCR (9aa)
- QIINAIQINNTAVGHAIVIPAGR (23aa)
- EAGNITTDGYEIIGK (15aa)
- NASLALSASIGR (12aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Carcinoma, Squamous cell (DOID:1749)
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Carcinoma, Squamous cell (DOID:1749)
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Kidney (UBERON_0002113)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Leukocyte (CL_0000738)
- Choriocarcinoma (DOID:3594)
- Colon adenocarcinoma (DOID:234)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Scrapie (DOID:5434)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Major prion protein / Mesocricetus auratus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
-
- N-Linked / Complex
(avg mass : 2356.1827)
- 3Y1-B clone 1 (CVCL_4563)
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Schizophrenia (DOID:5419)
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Microsome (GO_0005792)
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- KDTRNESTQNCVVAEPEKM (19aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Adipocytes (CL_0000136)
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Adipocytes (CL_0000136)
-
- N-Linked / Complex
(avg mass : 2356.1827)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
-
- N-Linked / Complex
(avg mass : 2356.1827)
- CHO (CVCL_0213)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
-
- N-Linked / Complex
(avg mass : 2356.1827)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2356.1827)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2356.1827)
-
- N-Linked / Complex
(avg mass : 2356.1827)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Colon (UBERON_0001155)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2356.1827)
- Colon (UBERON_0001155)
-
- N-Linked / Undefined core
(avg mass : 2356.1827)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
-
- Hex:6 HexNAc:6 dHex:1 / N-Linked
(avg mass : 2356.1827)
- Ascitic fluid (UBERON_0007795)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)]Man(a1-6)]Man(a1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4) + GlcNAc(b1-?)"
- N-Linked / Complex / Structure 9412
- N-Linked / Complex / Structure 9561
- N-Linked / Complex / Structure 9593
- N-Linked / Complex / Structure 10058
- N-Linked / Complex / Structure 10087
- N-Linked / Complex / Structure 10146
- N-Linked / Complex / Structure 10198
- N-Linked / Complex / Structure 10265
- N-Linked / Complex / Structure 10288
- N-Linked / Complex / Structure 10498
- N-Linked / Complex / Structure 10529
- N-Linked / Complex / Structure 11242
- N-Linked / Undefined core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Acid ceramidase / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Biglycan / Homo sapiens
- Bone morphogenetic protein receptor type-2 / Homo sapiens
- BRCA2-interacting transcriptional repressor EMSY / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- CD97 antigen / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dipeptidase 1 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparan sulfate 2-O-sulfotransferase 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Low-density lipoprotein receptor-related protein 10 / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Protein AMBP / Homo sapiens
- Prothrombin / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Sparc / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tigger transposable element-derived protein 6 / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens
- Tripeptidyl-peptidase 1 / Homo sapiens
- tRNA (cytosine(34)-C(5))-methyltransferase / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- NGTILCSK (8aa)
- NCTWLILGSK (10aa)
- YETTNK (6aa)
- AEMNGSK (7aa)
- NQNGTFK (7aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- NGTYKF (6aa)
- TFYWDFYTNR (10aa)
- ISISNETK (8aa)
- YHVIHINTTK (10aa)
- AVIVNNITTGER (12aa)
- VCSNDNK (7aa)
- NTTYCSK (7aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- YPEELAWHTNLSR (13aa)
- GSNYSEILDK (10aa)
- NYSGGLAVK (9aa)
- NNQSLP (6aa)
- SWPAVGNCSSAIR (13aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- YNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMR (37aa)
- SPLNTS (6aa)
- FHLANR (6aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- MNLTQLK (7aa)
- TVIENSTSYEEAK (13aa)
- IININPNK (8aa)
- MIENGSISFIPTIR (14aa)
- YIGNATAIFFIPDEGK (16aa)
- IIQVVYIHSNNITK (14aa)
- LHSNNITK (8aa)
- MFSQNDTR (8aa)
- RFPNIT (6aa)
- RNWTEAEVK (9aa)
- GEVFNATR (8aa)
- NATDNISK (8aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- NTTSVWYTSK (10aa)
- NFTENDLLVR (10aa)
- DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa)
- SIFLSHNNTK (10aa)
- YVQNGTYTVK (10aa)
- CYPTPSSSNDTR (12aa)
- FANEYPNITR (10aa)
- EVNDTLLVNELK (12aa)
- TPNNNGT (7aa)
- NMTLFSDLVAEK (12aa)
- TVGNQTSTK (9aa)
- VVPEGIRMNK (10aa)
- VPAQEKNF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- IVNNT (5aa)
- GINASVV (7aa)
- NSTPQQQK (8aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- NISQDLEK (8aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- DACGNGTCR (9aa)
- QIINAIQINNTAVGHAIVIPAGR (23aa)
- EAGNITTDGYEIIGK (15aa)
- NASLALSASIGR (12aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:6 dHex:1 / N-Linked
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2356.1827)