Hex:6 HexNAc:6 dHex:1

Taxonomy

• Homo sapiens (Human)
• Mesocricetus auratus (Golden hamster)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Human immunodeficiency virus type 1 (lw12.3 isolate)
• Marburg virus (strain musoke)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Acid ceramidase / Homo sapiens    Q13510
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-S1-casein / Homo sapiens    P47710
• Beta-secretase-fc fusion protein / Homo sapiens    P56817
• Biglycan / Homo sapiens    P21810
• Bone morphogenetic protein receptor type-2 / Homo sapiens    Q13873
• BRCA2-interacting transcriptional repressor EMSY / Homo sapiens    Q7Z589
• Carboxypeptidase D / Homo sapiens    O75976
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• CD97 antigen / Homo sapiens    P48960
• Choriogonadotropin - alpha and beta chains / Homo sapiens    P0DN86    P01215
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Complement c3 / Homo sapiens    P01024
• Contactin-4 / Homo sapiens    Q8IWV2
• Desmoglein-2 / Homo sapiens    Q14126
• Dipeptidase 1 / Homo sapiens    P16444
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens    P04844
• Epidermal growth factor receptor / Homo sapiens    P00533
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• Erythropoietin / Homo sapiens    P01588
• Fibrillin-1 / Homo sapiens    P35555
• Fibronectin / Homo sapiens    P02751
• Follistatin-related protein 1 / Homo sapiens    Q12841
• Golgi membrane protein 1 / Homo sapiens    Q8NBJ4
• Hemopexin / Homo sapiens    P02790
• Heparan sulfate 2-O-sulfotransferase 1 / Homo sapiens    Q7LGA3
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Interleukin-1 receptor accessory protein / Homo sapiens    Q9NPH3
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Low-density lipoprotein receptor-related protein 10 / Homo sapiens    Q7Z4F1
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens    P16455
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Periostin / Homo sapiens    Q15063
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Probable lysosomal cobalamin transporter / Homo sapiens    Q9NUN5
• Prolactin-inducible protein / Homo sapiens    P12273
• Protein AMBP / Homo sapiens    P02760
• Prothrombin / Homo sapiens    P00734
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Secretogranin-3 / Homo sapiens    Q8WXD2
• Serum paraoxonase/arylesterase 2 / Homo sapiens    Q15165
• Sparc / Homo sapiens    P09486
• Thrombospondin-1 / Homo sapiens    P07996
• Tigger transposable element-derived protein 6 / Homo sapiens    Q17RP2
• Tissue alpha-L-fucosidase / Homo sapiens    P04066
• Transmembrane emp24 domain-containing protein 7 / Homo sapiens    Q9Y3B3
• Tripeptidyl-peptidase 1 / Homo sapiens    O14773
• tRNA (cytosine(34)-C(5))-methyltransferase / Homo sapiens    Q08J23
• Major prion protein / Mesocricetus auratus    P04273
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• Uncharacterized protein / Rattus norvegicus    
• Uncharacterized protein / Rattus norvegicus    
• Uncharacterized protein / Rattus norvegicus    
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)    Q70626
• Structural glycoprotein / Marburg virus (strain musoke)    P35253
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Ascitic fluid (UBERON_0007795)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)  
• Mammalian Vulva (UBERON_0000997)   A-431 (CVCL_0037)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Placenta (UBERON_0001987)   JEG-3 (CVCL_0363)   Epithelium (CL_0002577)  
• Seminal Fluid (UBERON_0006530)  
• Urine (UBERON_0001088)  
• 3Y1-B clone 1 (CVCL_4563)  
• CHO (CVCL_0213)  
• FreeStyle 293-F (CVCL_D603)  
• H9 (CVCL_1240)   Lymphocyte (CL_0000542)  
• HEK293 (CVCL_0045)  
• HEK293T (CVCL_0063)  
• LS174T (CVCL_1384)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  
• Adipocytes (CL_0000136)  
• EBV-transformed B-cell (CL_0000236)  
• Leukocyte (CL_0000738)  
• Microsome (GO_0005792)  

Reported structure

• N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)]Man(a1-6)]Man(a1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 3 x Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4) + GlcNAc(b1-?)"
• N-Linked / Complex / Structure 9412
• N-Linked / Complex / Structure 9561
• N-Linked / Complex / Structure 9593
• N-Linked / Complex / Structure 10058
• N-Linked / Complex / Structure 10087
• N-Linked / Complex / Structure 10146
• N-Linked / Complex / Structure 10198
• N-Linked / Complex / Structure 10265
• N-Linked / Complex / Structure 10288
• N-Linked / Complex / Structure 10498
• N-Linked / Complex / Structure 10529
• N-Linked / Complex / Structure 11242
• N-Linked / Undefined core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc

Composition

• Hex:6 HexNAc:6 dHex:1 (avg mass : 2356.1827 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma, Squamous cell (DOID:1749)
• Choriocarcinoma (DOID:3594)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
• Leukemia, Acute lymphoblastic (DOID:9952)
• Prostate cancer (DOID:10283)
• Scrapie (DOID:5434)

Reference

• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
• Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
• Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
• Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
• Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
• Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed

Reported glycosite

• Acid ceramidase / Homo sapiens
  •        Asn-259
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-271
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Beta-secretase-fc fusion protein / Homo sapiens
  •        Undefined site
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Bone morphogenetic protein receptor type-2 / Homo sapiens
  •        Asn-55
• BRCA2-interacting transcriptional repressor EMSY / Homo sapiens
  •        Asn-1199
• Carboxypeptidase D / Homo sapiens
  •        Asn-522
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
  •        Asn-182
  •        Asn-246
  •        Asn-360
  •        Asn-650
• CD97 antigen / Homo sapiens
  •        Asn-453
• Choriogonadotropin - alpha and beta chains / Homo sapiens
  •        Undefined site
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2679
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Collagen alpha-3(VI) chain / Homo sapiens
  •        Asn-2558
• Complement c3 / Homo sapiens
  •        Asn-939
• Contactin-4 / Homo sapiens
  •        Asn-858
• Desmoglein-2 / Homo sapiens
  •        Asn-462
• Dipeptidase 1 / Homo sapiens
  •        Asn-332
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
  •        Asn-106
• Epidermal growth factor receptor / Homo sapiens
  •        Undefined site
• Epithelial cell adhesion molecule / Homo sapiens
  •        Asn-74
• Erythropoietin / Homo sapiens
  •        Asn-51
• Fibrillin-1 / Homo sapiens
  •        Asn-1581
  •        Asn-1902
• Fibronectin / Homo sapiens
  •        Asn-1236
• Follistatin-related protein 1 / Homo sapiens
  •        Asn-144
• Golgi membrane protein 1 / Homo sapiens
  •        Asn-109
• Hemopexin / Homo sapiens
  •        Asn-187
• Heparan sulfate 2-O-sulfotransferase 1 / Homo sapiens
  •        Asn-108
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-21
  •        Asn-49
  •        Asn-146
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-209
• Interleukin-1 receptor accessory protein / Homo sapiens
  •        Asn-118
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-479
  •        Asn-2707
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1241
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Low-density lipoprotein receptor-related protein 10 / Homo sapiens
  •        Asn-56
• Lumican / Homo sapiens
  •        Asn-127
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-58
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens
  •        Asn-157
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-248
• Periostin / Homo sapiens
  •        Asn-599
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-499
• Probable lysosomal cobalamin transporter / Homo sapiens
  •        Asn-78
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Protein AMBP / Homo sapiens
  •        Asn-250
• Prothrombin / Homo sapiens
  •        Asn-416
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Secretogranin-3 / Homo sapiens
  •        Asn-346
• Serum paraoxonase/arylesterase 2 / Homo sapiens
  •        Asn-254
• Sparc / Homo sapiens
  •        Asn-116
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
• Tigger transposable element-derived protein 6 / Homo sapiens
  •        Asn-444
• Tissue alpha-L-fucosidase / Homo sapiens
  •        Asn-382
• Transmembrane emp24 domain-containing protein 7 / Homo sapiens
  •        Asn-103
• Tripeptidyl-peptidase 1 / Homo sapiens
  •        Asn-210
• tRNA (cytosine(34)-C(5))-methyltransferase / Homo sapiens
  •        Asn-130
• Major prion protein / Mesocricetus auratus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
  •        Undefined site
• Structural glycoprotein / Marburg virus (strain musoke)
  •        Undefined site
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-331
  •        Asn-1074
  •        Asn-1098
  •        Asn-1134
  •        Asn-1174
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-343

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTILCSK (8aa)
  •    Q13873    Asn-55     Bone morphogenetic protein receptor type-2 / Homo sapiens
• NCTWLILGSK (10aa)
  •    Q7Z4F1    Asn-56     Low-density lipoprotein receptor-related protein 10 / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• AEMNGSK (7aa)
  •    P16422    Asn-74     Epithelial cell adhesion molecule / Homo sapiens
• NQNGTFK (7aa)
  •    Q9NUN5    Asn-78     Probable lysosomal cobalamin transporter / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• NGTYKF (6aa)
  •    Q9Y3B3    Asn-103     Transmembrane emp24 domain-containing protein 7 / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• ISISNETK (8aa)
  •    P04844    Asn-106     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
• YHVIHINTTK (10aa)
  •    Q7LGA3    Asn-108     Heparan sulfate 2-O-sulfotransferase 1 / Homo sapiens
• AVIVNNITTGER (12aa)
  •    Q8NBJ4    Asn-109     Golgi membrane protein 1 / Homo sapiens
• VCSNDNK (7aa)
  •    P09486    Asn-116     Sparc / Homo sapiens
• NTTYCSK (7aa)
  •    Q9NPH3    Asn-118     Interleukin-1 receptor accessory protein / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• YPEELAWHTNLSR (13aa)
  •    Q08J23    Asn-130     tRNA (cytosine(34)-C(5))-methyltransferase / Homo sapiens
• GSNYSEILDK (10aa)
  •    Q12841    Asn-144     Follistatin-related protein 1 / Homo sapiens
• NYSGGLAVK (9aa)
  •    P16455    Asn-157     Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NNQSLP (6aa)
  •    P06731    Asn-182     Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •    P06731    Asn-360     Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
• SWPAVGNCSSAIR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• GLTFQQNASSMCGPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
  •    VAR_003904   215:V→G   dbSNP:rs12365
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• YNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMR (37aa)
  •    O14773    Asn-210     Tripeptidyl-peptidase 1 / Homo sapiens
• SPLNTS (6aa)
  •    P06731    Asn-246     Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
  •    P02760    Asn-250     Protein AMBP / Homo sapiens
• MNLTQLK (7aa)
  •    Q15165    Asn-254     Serum paraoxonase/arylesterase 2 / Homo sapiens
• TVIENSTSYEEAK (13aa)
  •    Q13510    Asn-259     Acid ceramidase / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LHSNNITK (8aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• MFSQNDTR (8aa)
  •    P02750    Asn-325     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RNWTEAEVK (9aa)
  •    P16444    Asn-332     Dipeptidase 1 / Homo sapiens
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NATDNISK (8aa)
  •    Q8WXD2    Asn-346     Secretogranin-3 / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• NTTSVWYTSK (10aa)
  •    P04066    Asn-382     Tissue alpha-L-fucosidase / Homo sapiens
• NFTENDLLVR (10aa)
  •    P00734    Asn-416     Prothrombin / Homo sapiens
• DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa)
  •    Q17RP2    Asn-444     Tigger transposable element-derived protein 6 / Homo sapiens
• SIFLSHNNTK (10aa)
  •    P48960    Asn-453     CD97 antigen / Homo sapiens
• YVQNGTYTVK (10aa)
  •    Q14126    Asn-462     Desmoglein-2 / Homo sapiens
• CYPTPSSSNDTR (12aa)
  •    O15230    Asn-479     Laminin subunit alpha-5 / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• FANEYPNITR (10aa)
  •    O75976    Asn-522     Carboxypeptidase D / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• TPNNNGT (7aa)
  •    P06731    Asn-650     Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• TVGNQTSTK (9aa)
  •    Q8IWV2    Asn-858     Contactin-4 / Homo sapiens
• VVPEGIRMNK (10aa)
  •    P01024    Asn-939     Complement c3 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IVNNT (5aa)
  •    P0DTC2    Asn-1134     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GINASVV (7aa)
  •    P0DTC2    Asn-1174     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NSTPQQQK (8aa)
  •    Q7Z589    Asn-1199     BRCA2-interacting transcriptional repressor EMSY / Homo sapiens
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236     Fibronectin / Homo sapiens
• NISQDLEK (8aa)
  •    P11047    Asn-1241     Laminin subunit gamma-1 / Homo sapiens
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581     Fibrillin-1 / Homo sapiens
• DACGNGTCR (9aa)
  •    P35555    Asn-1902     Fibrillin-1 / Homo sapiens
• QIINAIQINNTAVGHAIVIPAGR (23aa)
  •    P12111    Asn-2558     Collagen alpha-3(VI) chain / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens
• NASLALSASIGR (12aa)
  •    O15230    Asn-2707     Laminin subunit alpha-5 / Homo sapiens