taxonomy (7)
protein (66)
source (17)
structure (11)
composition (1)
disease (7)
reference (19)
site (81)
peptide (72)
- Homo sapiens (Human)
- Mesocricetus auratus (Golden hamster)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Marburg virus (strain musoke)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Acid ceramidase / Homo sapiens Q13510
- Alpha-1-antitrypsin / Homo sapiens P01009
- Beta-secretase-fc fusion protein / Homo sapiens P56817
- Biglycan / Homo sapiens P21810
- Bone morphogenetic protein receptor type-2 / Homo sapiens Q13873
- Carboxypeptidase D / Homo sapiens O75976
- CD97 antigen / Homo sapiens P48960
- Choriogonadotropin - alpha and beta chains / Homo sapiens P01215 P0DN86
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Collagen alpha-3(VI) chain / Homo sapiens P12111
- Complement c3 / Homo sapiens P01024
- Contactin-4 / Homo sapiens Q8IWV2
- Desmoglein-2 / Homo sapiens Q14126
- Dipeptidase 1 / Homo sapiens P16444
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Epidermal growth factor receptor / Homo sapiens P00533
- Epithelial cell adhesion molecule / Homo sapiens P16422
- Erythropoietin / Homo sapiens P01588
- Fibrillin-1 / Homo sapiens P35555
- Fibronectin / Homo sapiens P02751
- Follistatin-related protein 1 / Homo sapiens Q12841
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- Hemopexin / Homo sapiens P02790
- Heparan sulfate 2-O-sulfotransferase 1 / Homo sapiens Q7LGA3
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Interleukin-1 receptor accessory protein / Homo sapiens Q9NPH3
- Laminin subunit alpha-5 / Homo sapiens O15230
- Laminin subunit gamma-1 / Homo sapiens P11047
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Low-density lipoprotein receptor-related protein 10 / Homo sapiens Q7Z4F1
- Lumican / Homo sapiens P51884
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens P16455
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Periostin / Homo sapiens Q15063
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Prolactin-inducible protein / Homo sapiens P12273
- Protein AMBP / Homo sapiens P02760
- Protein EMSY / Homo sapiens Q7Z589
- Prothrombin / Homo sapiens P00734
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Secretogranin-3 / Homo sapiens Q8WXD2
- Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165
- Sparc / Homo sapiens P09486
- Thrombospondin-1 / Homo sapiens P07996
- Tigger transposable element-derived protein 6 / Homo sapiens Q17RP2
- Tissue alpha-L-fucosidase / Homo sapiens P04066
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens Q9Y3B3
- Tripeptidyl-peptidase 1 / Homo sapiens O14773
- tRNA (cytosine(34)-C(5))-methyltransferase / Homo sapiens Q08J23
- Major prion protein / Mesocricetus auratus P04273
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Structural glycoprotein / Marburg virus (strain musoke) P35253
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Kidney (UBERON_0002113)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- Seminal Fluid (UBERON_0006530)
- Urine (UBERON_0001088)
- 3Y1-B clone 1 (CVCL_4563)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- RPMI-1788 (CVCL_2710) B-Lymphocyte (CL_0000236)
- Leukocyte (CL_0000738)
- Microsome (GO_0005792)
Source
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)]Man(a1-6)]Man(a1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4) + GlcNAc(b1-?)"
- N-Linked / Undefined core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
Reported structure
- Hex:6 HexNAc:6 dHex:1 (avg mass : 2356.1827 )
Composition
- Cancer, breast (DOID:1612)
- Carcinoma, Squamous cell (DOID:1749)
- Choriocarcinoma (DOID:3594)
- COVID-19 (DOID:0080600)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Prostate cancer (DOID:10283)
- Scrapie (DOID:5434)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
- Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
Reference
- Acid ceramidase / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
- Biglycan / Homo sapiens
- Bone morphogenetic protein receptor type-2 / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- CD97 antigen / Homo sapiens
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dipeptidase 1 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
- Epithelial cell adhesion molecule / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparan sulfate 2-O-sulfotransferase 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Low-density lipoprotein receptor-related protein 10 / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Protein AMBP / Homo sapiens
- Protein EMSY / Homo sapiens
- Prothrombin / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Sparc / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tigger transposable element-derived protein 6 / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens
- Tripeptidyl-peptidase 1 / Homo sapiens
- tRNA (cytosine(34)-C(5))-methyltransferase / Homo sapiens
-
Major prion protein / Mesocricetus auratus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- NGTILCSK (8aa)
- NCTWLILGSK (10aa)
- YETTNK (6aa)
- AEMNGSK (7aa)
- NQNGTFK (7aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- NGTYKF (6aa)
- TFYWDFYTNR (10aa)
- ISISNETK (8aa)
- YHVIHINTTK (10aa)
- AVIVNNITTGER (12aa)
- VCSNDNK (7aa)
- NTTYCSK (7aa)
- TQSLLIVNNATNVVIK (16aa)
- LHINHNNLTESVGPLPK (17aa)
- KLHINHNNLTESVGPLPK (18aa)
- YPEELAWHTNLSR (13aa)
- GSNYSEILDK (10aa)
- VCEFQFCNDPFLGVYYHKNNK (21aa)
- NYSGGLAVK (9aa)
- VYSSANNCTFEYVSQPFLMDLEGK (24aa)
- VYSSANNCTFE (11aa)
- SWPAVGNCSSAIR (13aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- YNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMR (37aa)
- FHLANR (6aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- MNLTQLK (7aa)
- TVIENSTSYEEAK (13aa)
- IININPNK (8aa)
- MIENGSISFIPTIR (14aa)
- YIGNATAIFFIPDEGK (16aa)
- NGTITDAVDCALDPLSE (17aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- IIQVVYIHSNNITK (14aa)
- LHSNNITK (8aa)
- MFSQNDTR (8aa)
- FPNITNLCPFGE (12aa)
- RFPNIT (6aa)
- RNWTEAEVK (9aa)
- NATDNISK (8aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- NTTSVWYTSK (10aa)
- NFTENDLLVR (10aa)
- SIGLLSPDFQEDNETEI (17aa)
- DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa)
- SIFLSHNNTK (10aa)
- YVQNGTYTVK (10aa)
- CYPTPSSSNDTR (12aa)
- FANEYPNITR (10aa)
- EVNDTLLVNELK (12aa)
- AGCLIGAEHVNNSYE (15aa)
- HVNNSYE (7aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- NMTLFSDLVAEK (12aa)
- TVGNQTSTK (9aa)
- VVPEGIRMNK (10aa)
- VPAQEKNF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- IVNNT (5aa)
- GINASVV (7aa)
- NSTPQQQK (8aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- NISQDLEK (8aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- DACGNGTCR (9aa)
- QIINAIQINNTAVGHAIVIPAGR (23aa)
- EAGNITTDGYEIIGK (15aa)
- NASLALSASIGR (12aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex (avg mass : 2356.1827)
- Carcinoma, Squamous cell (DOID:1749)
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
- N-Linked / Complex (avg mass : 2356.1827)
- Carcinoma, Squamous cell (DOID:1749)
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
- N-Linked / Complex (avg mass : 2356.1827)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex (avg mass : 2356.1827)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex (avg mass : 2356.1827)
- Brain (UBERON_0000955)
- Kidney (UBERON_0002113)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- Leukocyte (CL_0000738)
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Major prion protein / Mesocricetus auratus
- Undefined site
-
Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
-
- N-Linked / Complex (avg mass : 2356.1827)
- 3Y1-B clone 1 (CVCL_4563)
-
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Undefined tissue / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex (avg mass : 2356.1827)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
-
Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
- N-Linked / Complex (avg mass : 2356.1827)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex (avg mass : 2356.1827)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Complex (avg mass : 2356.1827)
- Microsome (GO_0005792)
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
- N-Linked / Undefined core (avg mass : 2356.1827)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
-
- Hex:6 HexNAc:6 dHex:1 / N-Linked (avg mass : 2356.1827)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)]Man(a1-6)]Man(a1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4) + GlcNAc(b1-?)"
- N-Linked / Undefined core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Acid ceramidase / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Biglycan / Homo sapiens
- Bone morphogenetic protein receptor type-2 / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- CD97 antigen / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dipeptidase 1 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparan sulfate 2-O-sulfotransferase 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Low-density lipoprotein receptor-related protein 10 / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Protein AMBP / Homo sapiens
- Protein EMSY / Homo sapiens
- Prothrombin / Homo sapiens
- Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Sparc / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tigger transposable element-derived protein 6 / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens
- Tripeptidyl-peptidase 1 / Homo sapiens
- tRNA (cytosine(34)-C(5))-methyltransferase / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- NGTILCSK (8aa)
- NCTWLILGSK (10aa)
- YETTNK (6aa)
- AEMNGSK (7aa)
- NQNGTFK (7aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- NGTYKF (6aa)
- TFYWDFYTNR (10aa)
- ISISNETK (8aa)
- YHVIHINTTK (10aa)
- AVIVNNITTGER (12aa)
- VCSNDNK (7aa)
- NTTYCSK (7aa)
- TQSLLIVNNATNVVIK (16aa)
- LHINHNNLTESVGPLPK (17aa)
- KLHINHNNLTESVGPLPK (18aa)
- YPEELAWHTNLSR (13aa)
- GSNYSEILDK (10aa)
- VCEFQFCNDPFLGVYYHKNNK (21aa)
- NYSGGLAVK (9aa)
- VYSSANNCTFEYVSQPFLMDLEGK (24aa)
- VYSSANNCTFE (11aa)
- SWPAVGNCSSAIR (13aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- YNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMR (37aa)
- FHLANR (6aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- MNLTQLK (7aa)
- TVIENSTSYEEAK (13aa)
- IININPNK (8aa)
- MIENGSISFIPTIR (14aa)
- YIGNATAIFFIPDEGK (16aa)
- NGTITDAVDCALDPLSE (17aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- IIQVVYIHSNNITK (14aa)
- LHSNNITK (8aa)
- MFSQNDTR (8aa)
- FPNITNLCPFGE (12aa)
- RFPNIT (6aa)
- RNWTEAEVK (9aa)
- NATDNISK (8aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- NTTSVWYTSK (10aa)
- NFTENDLLVR (10aa)
- SIGLLSPDFQEDNETEI (17aa)
- DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa)
- SIFLSHNNTK (10aa)
- YVQNGTYTVK (10aa)
- CYPTPSSSNDTR (12aa)
- FANEYPNITR (10aa)
- EVNDTLLVNELK (12aa)
- AGCLIGAEHVNNSYE (15aa)
- HVNNSYE (7aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- NMTLFSDLVAEK (12aa)
- TVGNQTSTK (9aa)
- VVPEGIRMNK (10aa)
- VPAQEKNF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- IVNNT (5aa)
- GINASVV (7aa)
- NSTPQQQK (8aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- NISQDLEK (8aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- DACGNGTCR (9aa)
- QIINAIQINNTAVGHAIVIPAGR (23aa)
- EAGNITTDGYEIIGK (15aa)
- NASLALSASIGR (12aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Reported glycosite
Source
Disease
Reported glycosite
Source
Reference
Reported glycosite
Source
Disease
Reported glycosite
Disease
Reported glycosite
Disease
Reported glycosite
Disease
Reported glycosite
