taxonomy (3)
protein (20)
source (7)
structure (5)
composition (1)
disease (4)
reference (10)
site (23)
peptide (22)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Biglycan / Homo sapiens P21810
- Clusterin / Homo sapiens P10909
- Fibrillin-1 / Homo sapiens P35555
- Fibronectin / Homo sapiens P02751
- Glandular kallikrein 1 / Homo sapiens P06870
- IgGFc-binding protein / Homo sapiens Q9Y6R7
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Kininogen-1 / Homo sapiens P01042
- Lactotransferrin / Homo sapiens P02788
- N-acetylmuramoyl-l-alanine amidase / Homo sapiens Q96PD5
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens Q02809
- Tissue-type plasminogen activator / Homo sapiens P00750
- Uromodulin / Homo sapiens P07911
- Platelet glycoprotein IV / Bos taurus P26201
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4) + 2 x GalNAc(b1-4)"
- N-Linked / Complex / Structure 9394
Reported structure
- Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )
Composition
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Melanoma (DOID:1909)
- Prostate cancer (DOID:10283)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
Reference
- Alpha-2-HS-glycoprotein / Homo sapiens
- Biglycan / Homo sapiens
- Clusterin / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
- IgGFc-binding protein / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- N-acetylmuramoyl-l-alanine amidase / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- KKEDALNETRESETKL (16aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- TQSLLIVNNATNVVIK (16aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- VCQDCPIIAPINDTR (15aa)
- VYSSANNCTFE (11aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- MIENGSISFIPTIR (14aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
- NGTITDAVDCALDPLSE (17aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- LNAENNATFYFK (12aa)
- INAENNATFYFK (12aa)
- RFPNIT (6aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- GFGVAIVGNYTAALPTEAALR (21aa)
- DQCIVDDITYNVNDTFHK (18aa)
- YIHQNYTK (8aa)
- AGCLIGAEHVNNSYE (15aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- FDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHR (34aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2235.0929)
- Urine (UBERON_0001088)
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2235.0929)
- Urine (UBERON_0001088)
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2235.0929)
- Melanoma (DOID:1909)
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2235.0929)
- Mammary Gland (UBERON_0001911)
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2235.0929)
- Milk (UBERON_0001913)
- Clusterin / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- KKEDALNETRESETKL (16aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
-
- Hex:4 HexNAc:7 dHex:1 / N-Linked
(avg mass : 2235.0929)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4) + 2 x GalNAc(b1-4)"
- N-Linked / Complex / Structure 9394
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Alpha-2-HS-glycoprotein / Homo sapiens
- Biglycan / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- IgGFc-binding protein / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Kininogen-1 / Homo sapiens
- N-acetylmuramoyl-l-alanine amidase / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Uromodulin / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VCQDCPIIAPINDTR (15aa)
- VYSSANNCTFE (11aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- MIENGSISFIPTIR (14aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
- NGTITDAVDCALDPLSE (17aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- LNAENNATFYFK (12aa)
- INAENNATFYFK (12aa)
- RFPNIT (6aa)
- GFGVAIVGNYTAALPTEAALR (21aa)
- DQCIVDDITYNVNDTFHK (18aa)
- YIHQNYTK (8aa)
- AGCLIGAEHVNNSYE (15aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- FDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHR (34aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:7 dHex:1 / N-Linked
(avg mass : 2235.0929)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2235.0929)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2235.0929)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2235.0929)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2235.0929)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2235.0929)
