GlyConnect

taxonomy (2) protein (14) source (4) structure (4) composition (1) disease (3) reference (7) site (14) peptide (11)

Taxonomy

Homo sapiens (Human)
Bos taurus (Bovine)

Protein

Source

Reported structure

Composition

Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )

Disease

Reference

Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed

Reported glycosite

Alpha-2-hs-glycoprotein / Homo sapiens
- Asn-156
Biglycan / Homo sapiens
- Asn-270
Fibrillin-1 / Homo sapiens
- Asn-1581
Fibronectin / Homo sapiens
- Asn-528
Glandular kallikrein 1 / Homo sapiens
- Undefined site
IgGFc-binding protein / Homo sapiens
- Asn-2111
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Asn-205
Immunoglobulin heavy constant mu / Homo sapiens
- Asn-209
Kininogen-1 / Homo sapiens
- Asn-294
N-acetylmuramoyl-l-alanine amidase / Homo sapiens
- Asn-485
Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Asn-538
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
Uromodulin / Homo sapiens
- Asn-275
Platelet glycoprotein IV / Bos taurus
- Undefined site

Mass spectrometry observed peptide

VCQDCPIIAPINDTR (15aa)
- P02765 Asn-156
GLTFQQNASSMCGPDQDTAIR (21aa)
- P01871 Asn-209
- VAR_003904 215:V→G dbSNP:rs12365
MIENGSISFIPTIR (14aa)
- P21810 Asn-270
ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
- P07911 Asn-275
LNAENNATFYFK (12aa)
- P01042 Asn-294
INAENNATFYFK (12aa)
- P01042 Asn-294
GFGVAIVGNYTAALPTEAALR (21aa)
- Q96PD5 Asn-485
DQCIVDDITYNVNDTFHK (18aa)
- P02751 Asn-528
YIHQNYTK (8aa)
- Q02809 Asn-538
AWGTPCEMCPAVNTSEYK (18aa)
- P35555 Asn-1581
FDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHR (34aa)
- Q9Y6R7 Asn-2111

- N-Linked / Complex (avg mass : 2235.0929)
- N-Linked / Complex (avg mass : 2235.0929)
- N-Linked / Complex (avg mass : 2235.0929)
- N-Linked / Complex (avg mass : 2235.0929)

- Hex:4 HexNAc:7 dHex:1 / N-Linked (avg mass : 2235.0929)