• GlyConnect
  •     |    
  • Search
  •     |    
  • Browse :
  • Structures
  • Compositions
  • Proteins
  • Tissues
  • Taxonomy
  • Diseases
  • References
  • Help
  • Contact
  • GlyConnect >
  • Compositions >
  • Hex:4 HexNAc:7 dHex:1

Hex:4 HexNAc:7 dHex:1

SNFG, Text, Oxford
Taxonomy (2) Protein (14) Source (4) Structure (4) Composition (1) Disease (3) Site (14) Peptide (11)

    Taxonomy

  • Homo sapiens (Human)
  • Bos taurus (Bovine)

    Protein

  • N-acetylmuramoyl-l-alanine amidase / Homo sapiens    Q96PD5
  • Platelet glycoprotein IV / Bos taurus    P26201
  • Fibronectin / Homo sapiens    P02751
  • Uromodulin / Homo sapiens    P07911
  • Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens    Q02809
  • Biglycan / Homo sapiens    P21810
  • Alpha-2-hs-glycoprotein / Homo sapiens    P02765
  • Ig alpha-2 chain c region / Homo sapiens    P01877
  • Kininogen-1 / Homo sapiens    P01042
  • Immunoglobulin heavy constant mu / Homo sapiens    P01871
  • Tissue-type plasminogen activator / Homo sapiens    P00750
  • Fibrillin-1 / Homo sapiens    P35555
  • Glandular kallikrein 1 / Homo sapiens    P06870
  • IgGFc-binding protein / Homo sapiens    Q9Y6R7

    Source

  • Blood Serum (UBERON_0001977)  
  • HMCB (CVCL_3317)   Skin of Body (UBERON_0002097)  
  • Mammary Gland (UBERON_0001911)  
  • Urine (UBERON_0001088)  

    Reported structure

  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
  • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
  • N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4) + 2 x GalNAc(b1-4)"

    Composition

  • Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )

    Disease

  • Prostate cancer (DOID:10283)
  • Cancer, breast (DOID:1612)
  • Melanoma (DOID:1909)

    Reported glycosite

  • Fibronectin / Homo sapiens :
    •        Asn-528
  • Platelet glycoprotein IV / Bos taurus :
    •        Undefined site
  • Alpha-2-hs-glycoprotein / Homo sapiens :
    •        Asn-156
  • Glandular kallikrein 1 / Homo sapiens :
    •        Undefined site
  • Biglycan / Homo sapiens :
    •        Asn-270
  • Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens :
    •        Asn-538
  • Fibrillin-1 / Homo sapiens :
    •        Asn-1581
  • Uromodulin / Homo sapiens :
    •        Asn-275
  • Tissue-type plasminogen activator / Homo sapiens :
    •        Undefined site
  • N-acetylmuramoyl-l-alanine amidase / Homo sapiens :
    •        Asn-485
  • IgGFc-binding protein / Homo sapiens :
    •        Asn-2111
  • Kininogen-1 / Homo sapiens :
    •        Asn-294
  • Ig alpha-2 chain c region / Homo sapiens :
    •        Undefined site
  • Immunoglobulin heavy constant mu / Homo sapiens :
    •        Asn-209

    Mass spectrometry validated peptide

  • VCQDCPIIAPINDTR (15aa)
    •    P02765    Asn-156
  • GLTFQQNASSMCGPDQDTAIR (21aa)
    •    P01871    Asn-209
    •    VAR_003904   215:V→G   dbSNP:rs12365
  • MIENGSISFIPTIR (14aa)
    •    P21810    Asn-270
  • ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
    •    P07911    Asn-275
  • LNAENNATFYFK (12aa)
    •    P01042    Asn-294
  • INAENNATFYFK (12aa)
    •    P01042    Asn-294
  • GFGVAIVGNYTAALPTEAALR (21aa)
    •    Q96PD5    Asn-485
  • DQCIVDDITYNVNDTFHK (18aa)
    •    P02751    Asn-528
  • YIHQNYTK (8aa)
    •    Q02809    Asn-538
  • AWGTPCEMCPAVNTSEYK (18aa)
    •    P35555    Asn-1581
  • FDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHR (34aa)
    •    Q9Y6R7    Asn-2111
  • No image
    • N-Linked / Complex (avg mass : 2235.0929 )
    • Site (1)

        Reported glycosite

      • Platelet glycoprotein IV / Bos taurus :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2235.0929 )
    • Site (1)

        Reported glycosite

      • Glandular kallikrein 1 / Homo sapiens :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2235.0929 )
    • Site (1)

        Reported glycosite

      • Tissue-type plasminogen activator / Homo sapiens :
        •        Undefined site
  • No image
    • N-Linked / Complex (avg mass : 2235.0929 )
    • Site (1)

        Reported glycosite

      • Glandular kallikrein 1 / Homo sapiens :
        •        Undefined site
  • 4 x 7 x 1 x
    • Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )
    • Site (11) Suggested Structure (4)

        Suggested structure

      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
      • N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4) + 2 x GalNAc(b1-4)"

        Reported glycosite

      • Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens :
        •        Asn-538
      • Fibrillin-1 / Homo sapiens :
        •        Asn-1581
      • Uromodulin / Homo sapiens :
        •        Asn-275
      • Fibronectin / Homo sapiens :
        •        Asn-528
      • N-acetylmuramoyl-l-alanine amidase / Homo sapiens :
        •        Asn-485
      • Alpha-2-hs-glycoprotein / Homo sapiens :
        •        Asn-156
      • IgGFc-binding protein / Homo sapiens :
        •        Asn-2111
      • Kininogen-1 / Homo sapiens :
        •        Asn-294
      • Ig alpha-2 chain c region / Homo sapiens :
        •        Undefined site
      • Biglycan / Homo sapiens :
        •        Asn-270
      • Immunoglobulin heavy constant mu / Homo sapiens :
        •        Asn-209

Composition mass

Average mass : 2235.0929 Da

Monoisotopic mass : 2233.8355 Da

References (7)

Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018)
Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang
Pubmed : 29741879   DOI : 10.1021/acs.analchem.8b01137
Status : Unreviewed

Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018)
Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang
Pubmed : 29671580   DOI : 10.1021/acs.analchem.8b01051
Status : Unreviewed

Distinct urinary glycoprotein signatures in prostate cancer patients (2018)
Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano
Pubmed : 30237853   DOI : 10.18632/oncotarget.26005
Status : Unreviewed

Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014)
Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P
Pubmed : 24766575   DOI : 10.1021/pr500238v
Status : Reviewed

The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996)
Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S
Pubmed : 8687384  
Status : Reviewed

Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993)
Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A
Pubmed : 7682847  
Status : Reviewed

Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993)
Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N
Pubmed : 8416919  
Status : Reviewed

GlyConnect Creative Commons License

Supported by SIB ExPASy