Hex:4 HexNAc:7 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Biglycan / Homo sapiens    P21810
• Clusterin / Homo sapiens    P10909
• Fibrillin-1 / Homo sapiens    P35555
• Fibronectin / Homo sapiens    P02751
• Glandular kallikrein 1 / Homo sapiens    P06870
• IgGFc-binding protein / Homo sapiens    Q9Y6R7
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Kininogen-1 / Homo sapiens    P01042
• Lactotransferrin / Homo sapiens    P02788
• N-acetylmuramoyl-l-alanine amidase / Homo sapiens    Q96PD5
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens    Q02809
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Uromodulin / Homo sapiens    P07911
• Platelet glycoprotein IV / Bos taurus    P26201
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Serum (UBERON_0001977)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4) + 2 x GalNAc(b1-4)"
• N-Linked / Complex / Structure 9394

Composition

• Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Melanoma (DOID:1909)
• Prostate cancer (DOID:10283)

Reference

• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
• Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed

Reported glycosite

• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
• Biglycan / Homo sapiens
  •        Asn-270
• Clusterin / Homo sapiens
  •        Asn-86
• Fibrillin-1 / Homo sapiens
  •        Asn-1581
• Fibronectin / Homo sapiens
  •        Asn-528
• Glandular kallikrein 1 / Homo sapiens
  •        Undefined site
• IgGFc-binding protein / Homo sapiens
  •        Asn-2111
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-205
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-209
• Kininogen-1 / Homo sapiens
  •        Asn-294
• Lactotransferrin / Homo sapiens
  •        Asn-156
• N-acetylmuramoyl-l-alanine amidase / Homo sapiens
  •        Asn-485
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-90
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
  •        Asn-538
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-275
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331

Mass spectrometry observed peptide

• KKEDALNETRESETKL (16aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-90     Polymeric immunoglobulin receptor / Homo sapiens
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• VCQDCPIIAPINDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• GLTFQQNASSMCGPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
  •    VAR_003904   215:V→G   dbSNP:rs12365
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
  •    P07911    Asn-275     Uromodulin / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• INAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• GFGVAIVGNYTAALPTEAALR (21aa)
  •    Q96PD5    Asn-485     N-acetylmuramoyl-l-alanine amidase / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• YIHQNYTK (8aa)
  •    Q02809    Asn-538     Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581     Fibrillin-1 / Homo sapiens
• FDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHR (34aa)
  •    Q9Y6R7    Asn-2111     IgGFc-binding protein / Homo sapiens