taxonomy (19)
protein (166)
source (53)
structure (47)
composition (1)
disease (21)
reference (75)
site (236)
peptide (222)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Cricetulus griseus (Chinese hamster)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Bufo bufo (European toad)
- Physomitrella patens
- Trichinella spiralis
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Locusta migratoria (Migratory locust)
- Armoracia rusticana (Horseradish)
- Lupinus luteus (Yellow lupine)
- SARS coronavirus CUHK-W1
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens Q16880
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens P30533
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Anion exchange transporter / Homo sapiens Q8TE54
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens Q12797
- Attractin / Homo sapiens O75882
- Beta-secretase / Homo sapiens P56817
- Cadherin-5 / Homo sapiens P33151
- Calreticulin / Homo sapiens P27797
- Calumenin / Homo sapiens O43852
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- CD63 antigen / Homo sapiens P08962
- Ceramide synthase 6 / Homo sapiens Q6ZMG9
- Chymotrypsin-like elastase family member 3B / Homo sapiens P08861
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens Q96KA5
- Clusterin / Homo sapiens P10909
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens Q6UXH1
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Endoplasmin / Homo sapiens P14625
- Erythropoietin / Homo sapiens P01588
- Fibronectin / Homo sapiens P02751
- Glucosidase 2 subunit beta / Homo sapiens P14314
- Glycosylated lysosomal membrane protein / Homo sapiens Q8WWB7
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens P04440
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Interferon-gamma receptor alpha chain / Homo sapiens P15260
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens P08637
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Mammaglobin-A / Homo sapiens Q13296
- Matrix metalloproteinase-9 / Homo sapiens P14780
- Matrix-remodeling-associated protein 5 / Homo sapiens Q9NR99
- Melanoma inhibitory activity protein 3 / Homo sapiens Q5JRA6
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Multimerin-1 / Homo sapiens Q13201
- Myeloperoxidase / Homo sapiens P05164
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens Q96AY3
- Periostin / Homo sapiens Q15063
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Procollagen galactosyltransferase 1 / Homo sapiens Q8NBJ5
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens O60568
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Reticulocalbin-1 / Homo sapiens Q15293
- Reticulocalbin-3 / Homo sapiens Q96D15
- Rhodopsin / Homo sapiens P08100
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Thyroglobulin / Homo sapiens P01266
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Translocon-associated protein subunit beta / Homo sapiens P43308
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Uncharacterized protein from Ovary / Homo sapiens
- Uncharacterized protein from Urine / Homo sapiens
- Unspecified mucin / Homo sapiens
- UPF0688 protein C1orf174 / Homo sapiens Q8IYL3
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Thyrotropin-aplha and beta chains / Bos taurus P01223 P01217
- Uncharacterized protein from Ovary / Cricetulus griseus
- Uncharacterized protein from Ovary / Cricetulus griseus
- Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- 4F2 cell-surface antigen heavy chain / Mus musculus P10852
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Brevican core protein / Mus musculus Q61361
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- CD166 antigen / Mus musculus Q61490
- Cell adhesion molecule 1 / Mus musculus Q8R5M8
- Cerebellin-2 / Mus musculus Q8BGU2
- Contactin-1 / Mus musculus P12960
- Contactin-4 / Mus musculus Q69Z26
- Delta and Notch-like epidermal growth factor-related receptor / Mus musculus Q8JZM4
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus Q8BGN3
- Endoplasmin / Mus musculus P08113
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus P22723
- Gamma-aminobutyric acid type B receptor subunit 2 / Mus musculus Q80T41
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Hyaluronan and proteoglycan link protein 1 / Mus musculus Q9QUP5
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus P01872
- Inter-alpha-trypsin inhibitor heavy chain H5 / Mus musculus Q8BJD1
- Intercellular adhesion molecule 5 / Mus musculus Q60625
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Laminin subunit alpha-4 / Mus musculus P97927
- Laminin subunit beta-2 / Mus musculus Q61292
- Laminin subunit gamma-1 / Mus musculus P02468
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Metabotropic glutamate receptor 2 / Mus musculus Q14BI2
- Metabotropic glutamate receptor 3 / Mus musculus Q9QYS2
- Myelin-oligodendrocyte glycoprotein / Mus musculus Q61885
- Neural cell adhesion molecule 1 / Mus musculus P13595
- Neural cell adhesion molecule 2 / Mus musculus O35136
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neurexin-3 / Mus musculus Q6P9K9
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuroplastin / Mus musculus P97300
- Phospholipase D3 / Mus musculus O35405
- Plexin-B1 / Mus musculus Q8CJH3
- Plexin-B2 / Mus musculus B2RXS4
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Protein disulfide-isomerase TMX3 / Mus musculus Q8BXZ1
- Protocadherin-1 / Mus musculus F7BJK1
- Receptor-type tyrosine-protein phosphatase gamma / Mus musculus Q05909
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus B9EKR1
- Reticulocalbin-1 / Mus musculus Q05186
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Sortilin-related receptor / Mus musculus O88307
- Synaptophysin-like protein 1 / Mus musculus O09117
- Tenascin-r / Mus musculus Q8BYI9
- Teneurin-3 / Mus musculus Q9WTS6
- Tetraspanin-2 / Mus musculus Q922J6
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Transmembrane emp24 domain-containing protein 4 / Mus musculus Q8R1V4
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Tyrosine-protein kinase receptor / Mus musculus Q6VNS1
- Vascular cell adhesion protein 1 / Mus musculus P29533
- Versican core protein / Mus musculus Q62059
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus Q9Z1L5
- Zinc transporter ZIP6 / Mus musculus Q8C145
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Mucin / Bufo bufo
- Uncharacterized protein / Physomitrella patens
- Tsl-1 antigens / Trichinella spiralis
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein / Drosophila melanogaster
- Apolipophorin-3a / Locusta migratoria
- Apolipophorin-3b / Locusta migratoria P10762
- Peroxidase / Armoracia rusticana
- Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Recombinant Spike glycoprotein (HEK293) - RBD domain / SARS coronavirus CUHK-W1 P59594
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cerebellum (UBERON_0002037)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Embryo (UBERON_0000922)
- Frontal Cortex (UBERON_0001870)
- Hemolymph (UBERON_0001011)
- Hippocampul formation (UBERON:0002421)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- neocortex (UBERON:0001950)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) LEC14 (CVCL_VU62)
- Ovary (UBERON_0000992) LEC18 (CVCL_VU63)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Pituitary Gland (UBERON_0000007)
- Prefrontal Cortex (UBERON:0000451)
- Pulmonary Mucosa
- Retina (UBERON_0000966)
- Seminal Fluid (UBERON_0006530)
- Stomach (UBERON_0000945)
- Striatum (UBERON_0002345)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- C10 (CVCL_5245)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- LS174T (CVCL_1384)
- NS0 (CVCL_3940)
- P3X63Ag8U.1 (CVCL_3412)
- RPMI-1788 (CVCL_2710) B-Lymphocyte (CL_0000236)
- T84 (CVCL_0555)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell Jelly Coat
- Neutrophil (CL_0000775)
- Seed (BTO_0001226)
Source
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-4)[Man(a1-3)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GlcNAc(b1-2)"
- N-Linked / Complex / Structure 1850
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ GlcNAc"
- N-Linked / Complex / Structure 9710
- N-Linked / Complex / Structure 10449
- N-Linked / Complex / Structure 10476
- N-Linked / Complex / Structure 10614
- N-Linked / Complex / Structure 11684
- N-Linked / Hybrid / Structure 9767
- N-Linked / Hybrid / Structure 11620
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / No-core / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Pauci-Mannose / GlcNAc(b1-2)[Man(a1-3)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)[GlcNAc(?1-6)]GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 10067
- N-Linked / Undefined core / HexNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- O-Linked / Core 1 / Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)[GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 11071
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 11044
- O-Linked / Core 9 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-6)]GalNAc
- O-Linked / No-core / Fuc(?1-?)[Gal(?1-?)]GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Gal(?1-3)GalNAc
Reported structure
- Hex:3 HexNAc:3 dHex:1 (avg mass : 1260.1705 )
Composition
- Adenocarcinoma (DOID:299)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Fucosidosis (DOID:14500)
- Gangliosidosis GM1 (DOID:3322)
- Gastritis (DOID:4029)
- Hypersensitivity reaction disease (DOID:0060056)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Oral squamous cell carcinoma (DOID:0050866)
- Ovarian cyst (DOID:5119)
- Plasmacytoma (Mouse) (DOID:3721)
- Prostate cancer (DOID:10283)
- severe acute respiratory syndrome (DOID:2945)
- Systemic lupus erythematosus (DOID:9074)
Disease
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
- Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Structural analysis of hexa to dodecaoligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo. (1997 - Morelle W, Strecker G) / Status : Reviewed
- LEC14, a dominant Chinese hamster ovary glycosylation mutant expresses complex N-glycans with a new N-acetylglucosamine residue in the core region. (1996 - Raju T, Stanley P) / Status : Reviewed
- LEC18, a dominant Chinese hamster ovary glycosylation mutant synthesizes N-linked carbohydrates with a novel core structure. (1995 - Raju T, Ray M, Stanley P) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Structure of the asn-linked oligosaccharides of apolipophorin III from the insect Locusta migratoria. Carbohydrate-linked 2-aminoethylphosphonate as a constituent of a glycoprotein. (1993 - Hard K, Van Doorn J, Thomas-Oates J, Kamerling J, Van der Horst D) / Status : Reviewed
- Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
- N-glycosylation of horseradish peroxidase from cell culture. (1992 - Harthill J, Ashford D) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Isolation and structural characterization of novel neutral oligosaccharide-alditols from respitatory-mucus glycoproteins of a patient suffering from bronchiectasis. 2. Structure of twelve hepta-to-nonasaccharide, six of which possess the GlcNAc beta(1----3)[Gal beta(1----4)GlcNAc beta(1----6)]Gal be (1991 - van Kuik J, de Waard P, Vliegenthart J, Klein A, Carnoy C, Lamblin G, Roussel P) / Status : Reviewed
- Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structures of oligosaccharides cleaved by base-borohydride from an I, H and Lea active ovarian cyst glycoprotein. (1984 - Tanaka M, Dube V, Anderson B) / Status : Reviewed
- Structures of the neutral oligosaccharides isolated from A-active human gastric mucin. (1984 - Slomiany A, Zdebska E, Slomiany BL) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
Reference
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Anion exchange transporter / Homo sapiens
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
- Attractin / Homo sapiens
-
Beta-secretase / Homo sapiens
- Undefined site
- Cadherin-5 / Homo sapiens
- Calreticulin / Homo sapiens
- Calumenin / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- CD63 antigen / Homo sapiens
- Ceramide synthase 6 / Homo sapiens
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
- Clusterin / Homo sapiens
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibronectin / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Glycosylated lysosomal membrane protein / Homo sapiens
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Mammaglobin-A / Homo sapiens
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Melanoma inhibitory activity protein 3 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Multimerin-1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Procollagen galactosyltransferase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
-
Rhodopsin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
- Thyroglobulin / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- UPF0688 protein C1orf174 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
- 4F2 cell-surface antigen heavy chain / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- CD166 antigen / Mus musculus
- Cell adhesion molecule 1 / Mus musculus
- Cerebellin-2 / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-4 / Mus musculus
- Delta and Notch-like epidermal growth factor-related receptor / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus
- Endoplasmin / Mus musculus
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 2 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
- Hyaluronan and proteoglycan link protein 1 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
- Immunoglobulin mu chain C region / Mus musculus
- Inter-alpha-trypsin inhibitor heavy chain H5 / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Laminin subunit alpha-4 / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
- Metabotropic glutamate receptor 2 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Myelin-oligodendrocyte glycoprotein / Mus musculus
- Neural cell adhesion molecule 1 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurexin-3 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuroplastin / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Protocadherin-1 / Mus musculus
- Receptor-type tyrosine-protein phosphatase gamma / Mus musculus
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sortilin-related receptor / Mus musculus
- Synaptophysin-like protein 1 / Mus musculus
- Tenascin-r / Mus musculus
- Teneurin-3 / Mus musculus
- Tetraspanin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Transmembrane emp24 domain-containing protein 4 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Tyrosine-protein kinase receptor / Mus musculus
- Vascular cell adhesion protein 1 / Mus musculus
- Versican core protein / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
- Zinc transporter ZIP6 / Mus musculus
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Apolipophorin-3a / Locusta migratoria
- Undefined site
-
Apolipophorin-3b / Locusta migratoria
- Undefined site
-
Peroxidase / Armoracia rusticana
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Recombinant Spike glycoprotein (HEK293) - RBD domain / SARS coronavirus CUHK-W1
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- VNLTTR (6aa)
- QCVNLTTR (8aa)
- FWIPHNVTWADIK (13aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- TNATLDQITGK (11aa)
- HENNTKDNSIQHEFSLTR (18aa)
- YKNNSDISSTR (11aa)
- NNSDISSTR (9aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGK (29aa)
- QECYAFNGTQR (11aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- GGNVTLPCK (9aa)
- ISPGKNATGMEVGWYR (16aa)
- FSNVTWF (7aa)
- QGNASDVILR (10aa)
- EEEAIQLDGLNASQIR (16aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- SVVAPATDGGLNLTSTFLRKNQCETR (26aa)
- NKSVLLGR (8aa)
- NK (2aa)
- RNESTQNCVVAEPEKM (16aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- YHYNGTFEDGK (11aa)
- DVTVIEGEVATISCQVNK (18aa)
- IIVPINNRENISDPTSPIR (19aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- VGVNKNQTVTATFGYPFR (18aa)
- FHAIHVSGTNGTK (13aa)
- FHAIHVSGTNGTKR (14aa)
- HAIHVSGTNGTKR (13aa)
- HAIHVSGTNGTKRF (14aa)
- HAIHVSGTNGTK (12aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRYKC (30aa)
- TVNVSVPK (8aa)
- VLTLANFTTK (10aa)
- ELLSNQSEVMLR (12aa)
- TNKSFDIGVNR (11aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- ISNVTPADAGIYYCVK (16aa)
- STNHEPSEMSNR (12aa)
- NVETNNSTVLIEGK (14aa)
- FTFTSHTPGDHQICLHSNSTR (21aa)
- SISNSTAR (8aa)
- IVNNATNVVIKVCEF (15aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- IVPQNMQNLTTQSNTSVLGLSDFEMQR (27aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- FGCEIENNR (9aa)
- FGCEIENNRSSGAFWK (16aa)
- LKFNSTIK (8aa)
- NNHTASIIDR (10aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- NATYGHYAPGEEFHDVEDAETYK (23aa)
- ANDSDQGANAEIDYTFHQAPEVVR (24aa)
- YHKNNKSWMESEF (13aa)
- NSSSTVQK (8aa)
- VEFHWGHSNGSAGSEHSVNGR (21aa)
- AGPNGTLFVADAYK (14aa)
- AGPNGTIFVADAYK (14aa)
- LEQNFFNCSCDIR (13aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- NQKDEINETDLK (12aa)
- TKPREEQFNSTFR (13aa)
- EEQFNSTFR (9aa)
- KTKPREEQFNSTFRV (15aa)
- EEQYNSTYR (9aa)
- TKPREEQYNSTYR (13aa)
- TVNITITQG (9aa)
- DGKPLLNDSR (10aa)
- LLNQTLR (7aa)
- VSMGQNGDLYFANVLTSDNHSDYICNAHFPGTR (33aa)
- TPLTANITK (9aa)
- FVSQTNGNLYIANVESSDRGNYSCFVSSPSITK (33aa)
- TNSSFIQGFVDHVKEDCDR (19aa)
- HNNDTQHIWESDSNEFSVIADPR (23aa)
- FNHTQTIQQK (10aa)
- NTTISVHPSTR (11aa)
- AEGDVGPPPSTLINQNETFAK (21aa)
- GINIT (5aa)
- HMNETSHTQGSLR (13aa)
- LLFPTNSSSR (10aa)
- KDNTTVTR (8aa)
- TSNSSQVSNEQDK (13aa)
- FLNVTPNVEVNVECR (15aa)
- NANGSYTCEECDSSCVGCTGEGPGNCK (27aa)
- ITNISSDDSGK (11aa)
- YQYVDCGRNTT (11aa)
- IININPNK (8aa)
- LVAIAVIDEKNTSLEHTR (18aa)
- VIDLWDLAQSANLTDK (16aa)
- ERPPTFLTPEGNESHKEELR (20aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- IMESHPNGTFSAK (13aa)
- KKENGVFEEISNSSGR (16aa)
- LLTSHGMSIQALLNATEFNYLCPAIINQIDAR (32aa)
- VIYQNHNK (8aa)
- HVTDMNSTIHLLR (13aa)
- QAFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVPEITWK (43aa)
- FENQTCFPLPDSR (13aa)
- FPNITNLCPF (10aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- NLGNNTK (7aa)
- TLFLFPNQTGFPSK (14aa)
- GEVFNATRF (9aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VFNATR (6aa)
- NATRF (5aa)
- CPFGEVFNATR (11aa)
- SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
- NISSEEK (7aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- ALVTLEGIPAAVPGQPAELQLNVTK (25aa)
- IANITQGEDQYYIR (14aa)
- KPCQNEASCIDANEKQDGSNFTCLCLPGYTGELCQSK (37aa)
- AMNTSQVEAIGIQMIPGYR (19aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- IQDFNYTDHTLGR (13aa)
- GFFCDAALDVDGETLRKNQSSELR (24aa)
- ALCPNTTR (8aa)
- INFTAPFNPNK (11aa)
- VICTGPNDTSPGSPR (15aa)
- LLLPAKNTTHLK (12aa)
- EKLLLPAKNTTHLK (14aa)
- IVQIFPNDTSIK (12aa)
- IINVTK (6aa)
- VPGNVTAVIGETIK (14aa)
- NNEGGVIAQLPSDVTSFNQTGLKPGEEYIVNVVALK (36aa)
- YEQGTGCWQGPNR (13aa)
- IIISPEENVTLTCTAENQLER (21aa)
- SYNDSVDPR (9aa)
- GKANSTGTLVITNPTR (16aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- SDVPNTSPNSTSQHVAEFETER (22aa)
- DQCIVDDITYNVNDTFHK (18aa)
- RHEEGHMINCTCFGQGR (17aa)
- EQYIHENYSR (10aa)
- GDSDKYFIEDGKLVIQSLDYSDQGNYSCVASTELDEVESR (40aa)
- LGNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGSK (37aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- VITPGTNTS (9aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- QDVNCTEVPVAIHADQL (17aa)
- LYQDVNCT (8aa)
- GNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHR (35aa)
- NNSYECDIPI (10aa)
- EYCNDLKPSDNNTEFLLNFNEFIDRK (26aa)
- VPGNQTSTTLK (11aa)
- NSIAIPTNFTISVTTEILPVSMTK (24aa)
- SIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGS (68aa)
- NFTIS (5aa)
- IETILLNGTDRK (12aa)
- LSHDGNETLPLHLYVK (16aa)
- ETWNNVTVWGSR (12aa)
- QKDGDDEWTSVVVANVSK (18aa)
- FGGFNFS (7aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- RPASNISASIQR (12aa)
- LSALDNLLNHSSIFLK (16aa)
- VSVVNSTLAEVHWDPVPPK (19aa)
- VINETWAWK (9aa)
- FKVLASNR (8aa)
- QMVENFSPNQTK (12aa)
- AEPPINASASDQGEK (15aa)
- AEPPLNASAGDQEEK (15aa)
- KNNTCVKEENTCLR (14aa)
- VPAQEKNF (8aa)
- P0DTC2 Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VVFLHVTYVPAQEKNFTTAPAICHDGKAHFPR (32aa)
- HVTYVPAQEKNF (12aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWF (12aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- GVFVSNGTHWFVTQR (15aa)
- VNSSLHSQISR (11aa)
- LQRVNSSLHSQISR (14aa)
- IGIVNNT (7aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- NGGNATLQVDNWPVNEHYPTGNTDNER (27aa)
- TLAGENQTALEIEELNRK (18aa)
- TLAGENQTALEIEELNR (17aa)
- YEQAKNISQDLEK (13aa)
- KYEQAKNISQDLEK (14aa)
- YTSDPNVTSVGPSK (14aa)
- IGSYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYK (39aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- FYFGGSPISAQYANFTGCISNAYFTR (26aa)
- RVNDNKTAAEEALR (14aa)
- VNDNKTAAEEALR (13aa)
- RIPAINR (7aa)
- IASAVQKNATSTK (13aa)
- AQAALDKANASR (12aa)
- ITLHENR (7aa)
- GCKDNATDSVPLR (13aa)
- RGCKDNATDSVPLR (14aa)
- EIKIGPFANTTK (12aa)
- VETGENCTSPAPK (13aa)
- KLNLDGSNYTLLK (13aa)
- RMHLNGSNVQVLHR (14aa)
- MHLNGSNVQVLHR (13aa)
- GVTHLNISGLK (11aa)
- LNGTDPIVAADSKR (14aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Hemolymph (UBERON_0001011)
- neocortex (UBERON:0001950)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Retina (UBERON_0000966)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- HEK293 (CVCL_0045)
- NS0 (CVCL_3940)
- P3X63Ag8U.1 (CVCL_3412)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Plasmacytoma (Mouse) (DOID:3721)
- Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Structure of the asn-linked oligosaccharides of apolipophorin III from the insect Locusta migratoria. Carbohydrate-linked 2-aminoethylphosphonate as a constituent of a glycoprotein. (1993 - Hard K, Van Doorn J, Thomas-Oates J, Kamerling J, Van der Horst D) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
-
Rhodopsin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Apolipophorin-3a / Locusta migratoria
- Undefined site
-
Apolipophorin-3b / Locusta migratoria
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Seed (BTO_0001226)
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Blood Plasma (UBERON_0001969)
- Bone Marrow (UBERON_0002371)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Pancreas (UBERON_0001264)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Chymotrypsin-like elastase family member 3B / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
-
Peroxidase / Armoracia rusticana
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1260.1705)
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Kidney (UBERON_0002113)
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Brain (UBERON_0000955)
-
Tenascin-r / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Blood Serum (UBERON_0001977)
- Milk (UBERON_0001913)
- Seminal Fluid (UBERON_0006530)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Hypersensitivity reaction disease (DOID:0060056)
- Systemic lupus erythematosus (DOID:9074)
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- NK (2aa)
- RNESTQNCVVAEPEKM (16aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRYKC (30aa)
- KTKPREEQFNSTFRV (15aa)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
-
- N-Linked / Complex
(avg mass : 1260.1705)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Cerebellum (UBERON_0002037)
- Embryo (UBERON_0000922)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Striatum (UBERON_0002345)
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- TKPREEQYNSTYR (13aa)
- TVNITITQG (9aa)
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Bone Marrow (UBERON_0002371)
-
- N-Linked / Complex
(avg mass : 1260.1705)
- HEK293T (CVCL_0063)
- Adipocyte plasma membrane-associated protein / Homo sapiens
- AGPNGTLFVADAYK (14aa)
-
- N-Linked / Hybrid
(avg mass : 1260.1705)
- Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1260.1705)
-
- N-Linked / No-core
(avg mass : 1260.1705)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1260.1705)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1260.1705)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1260.1705)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1260.1705)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1260.1705)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1260.1705)
- Ovary (UBERON_0000992) LEC14 (CVCL_VU62)
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1260.1705)
- Ovary (UBERON_0000992) LEC18 (CVCL_VU63)
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1260.1705)
- BTI-Tn-5B1-4 (CVCL_C190)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VNLTTR (6aa)
- TQSLLIVNNATNVVIK (16aa)
- VFNATR (6aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
-
- N-Linked / Undefined core
(avg mass : 1260.1705)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
-
Beta-secretase / Homo sapiens
- Undefined site
-
- N-Linked / Undefined core
(avg mass : 1260.1705)
- Blood Serum (UBERON_0001977)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- TKPREEQFNSTFR (13aa)
- TKPREEQYNSTYR (13aa)
-
- O-Linked / Core 1
(avg mass : 1260.1705)
- Ovary (UBERON_0000992)
- Ovarian cyst (DOID:5119)
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1260.1705)
- Egg Cell Jelly Coat
-
Mucin / Bufo bufo
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1260.1705)
- T84 (CVCL_0555)
- Colon adenocarcinoma (DOID:234)
-
- O-Linked / Core 2
(avg mass : 1260.1705)
- Milk (UBERON_0001913)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1260.1705)
- Milk (UBERON_0001913)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1260.1705)
- Pulmonary Mucosa
- Cystic Fibrosis (DOID:1485)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1260.1705)
- Pulmonary Mucosa
- Isolation and structural characterization of novel neutral oligosaccharide-alditols from respitatory-mucus glycoproteins of a patient suffering from bronchiectasis. 2. Structure of twelve hepta-to-nonasaccharide, six of which possess the GlcNAc beta(1----3)[Gal beta(1----4)GlcNAc beta(1----6)]Gal be (1991 - van Kuik J, de Waard P, Vliegenthart J, Klein A, Carnoy C, Lamblin G, Roussel P) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1260.1705)
- Neutrophil (CL_0000775)
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1260.1705)
- Ovary (UBERON_0000992)
- Ovarian cyst (DOID:5119)
- Structures of oligosaccharides cleaved by base-borohydride from an I, H and Lea active ovarian cyst glycoprotein. (1984 - Tanaka M, Dube V, Anderson B) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1260.1705)
- Milk (UBERON_0001913)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1260.1705)
- C10 (CVCL_5245)
- Colon adenocarcinoma (DOID:234)
-
- O-Linked / Core 9
(avg mass : 1260.1705)
- Stomach (UBERON_0000945)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / No-core
(avg mass : 1260.1705)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Adenocarcinoma (DOID:299)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- Hex:3 HexNAc:3 dHex:1 / N-Linked
(avg mass : 1260.1705)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-3)]GlcNAc
- N-Linked / Complex / Structure 1850
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-4)[Man(a1-3)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ GlcNAc"
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GlcNAc(b1-2)"
- N-Linked / Complex / Structure 9710
- N-Linked / Complex / Structure 10449
- N-Linked / Complex / Structure 10476
- N-Linked / Complex / Structure 10614
- N-Linked / Complex / Structure 11684
- N-Linked / Hybrid / Structure 9767
- N-Linked / Hybrid / Structure 11620
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / No-core / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Pauci-Mannose / GlcNAc(b1-2)[Man(a1-3)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)[GlcNAc(?1-6)]GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 10067
- N-Linked / Undefined core / HexNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Anion exchange transporter / Homo sapiens
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
- Attractin / Homo sapiens
- Cadherin-5 / Homo sapiens
- Calreticulin / Homo sapiens
- Calumenin / Homo sapiens
- CD63 antigen / Homo sapiens
- Ceramide synthase 6 / Homo sapiens
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
- Clusterin / Homo sapiens
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Fibronectin / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Glycosylated lysosomal membrane protein / Homo sapiens
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Melanoma inhibitory activity protein 3 / Homo sapiens
- Multimerin-1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Procollagen galactosyltransferase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Serpin h1 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- UPF0688 protein C1orf174 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- 4F2 cell-surface antigen heavy chain / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- CD166 antigen / Mus musculus
- Cell adhesion molecule 1 / Mus musculus
- Cerebellin-2 / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-4 / Mus musculus
- Delta and Notch-like epidermal growth factor-related receptor / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus
- Endoplasmin / Mus musculus
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 2 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Hyaluronan and proteoglycan link protein 1 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus
- Inter-alpha-trypsin inhibitor heavy chain H5 / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Laminin subunit alpha-4 / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Metabotropic glutamate receptor 2 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Myelin-oligodendrocyte glycoprotein / Mus musculus
- Neural cell adhesion molecule 1 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurexin-3 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuroplastin / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Protocadherin-1 / Mus musculus
- Receptor-type tyrosine-protein phosphatase gamma / Mus musculus
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sortilin-related receptor / Mus musculus
- Synaptophysin-like protein 1 / Mus musculus
- Tenascin-r / Mus musculus
- Teneurin-3 / Mus musculus
- Tetraspanin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Transmembrane emp24 domain-containing protein 4 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Tyrosine-protein kinase receptor / Mus musculus
- Vascular cell adhesion protein 1 / Mus musculus
- Versican core protein / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
- Zinc transporter ZIP6 / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- FWIPHNVTWADIK (13aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- TNATLDQITGK (11aa)
- HENNTKDNSIQHEFSLTR (18aa)
- YKNNSDISSTR (11aa)
- NNSDISSTR (9aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGK (29aa)
- QECYAFNGTQR (11aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- GGNVTLPCK (9aa)
- ISPGKNATGMEVGWYR (16aa)
- FSNVTWF (7aa)
- QGNASDVILR (10aa)
- EEEAIQLDGLNASQIR (16aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- NKSVLLGR (8aa)
- YHYNGTFEDGK (11aa)
- DVTVIEGEVATISCQVNK (18aa)
- IIVPINNRENISDPTSPIR (19aa)
- VGVNKNQTVTATFGYPFR (18aa)
- FHAIHVSGTNGTK (13aa)
- FHAIHVSGTNGTKR (14aa)
- HAIHVSGTNGTKR (13aa)
- HAIHVSGTNGTKRF (14aa)
- HAIHVSGTNGTK (12aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- TVNVSVPK (8aa)
- VLTLANFTTK (10aa)
- ELLSNQSEVMLR (12aa)
- TNKSFDIGVNR (11aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- ISNVTPADAGIYYCVK (16aa)
- STNHEPSEMSNR (12aa)
- NVETNNSTVLIEGK (14aa)
- FTFTSHTPGDHQICLHSNSTR (21aa)
- SISNSTAR (8aa)
- IVNNATNVVIKVCEF (15aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- IVPQNMQNLTTQSNTSVLGLSDFEMQR (27aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- FGCEIENNR (9aa)
- FGCEIENNRSSGAFWK (16aa)
- LKFNSTIK (8aa)
- NNHTASIIDR (10aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- NATYGHYAPGEEFHDVEDAETYK (23aa)
- ANDSDQGANAEIDYTFHQAPEVVR (24aa)
- YHKNNKSWMESEF (13aa)
- NSSSTVQK (8aa)
- VEFHWGHSNGSAGSEHSVNGR (21aa)
- AGPNGTIFVADAYK (14aa)
- LEQNFFNCSCDIR (13aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- NQKDEINETDLK (12aa)
- EEQFNSTFR (9aa)
- EEQYNSTYR (9aa)
- DGKPLLNDSR (10aa)
- LLNQTLR (7aa)
- VSMGQNGDLYFANVLTSDNHSDYICNAHFPGTR (33aa)
- TPLTANITK (9aa)
- FVSQTNGNLYIANVESSDRGNYSCFVSSPSITK (33aa)
- TNSSFIQGFVDHVKEDCDR (19aa)
- HNNDTQHIWESDSNEFSVIADPR (23aa)
- FNHTQTIQQK (10aa)
- NTTISVHPSTR (11aa)
- AEGDVGPPPSTLINQNETFAK (21aa)
- GINIT (5aa)
- HMNETSHTQGSLR (13aa)
- LLFPTNSSSR (10aa)
- KDNTTVTR (8aa)
- TSNSSQVSNEQDK (13aa)
- FLNVTPNVEVNVECR (15aa)
- NANGSYTCEECDSSCVGCTGEGPGNCK (27aa)
- ITNISSDDSGK (11aa)
- YQYVDCGRNTT (11aa)
- IININPNK (8aa)
- LVAIAVIDEKNTSLEHTR (18aa)
- VIDLWDLAQSANLTDK (16aa)
- ERPPTFLTPEGNESHKEELR (20aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- IMESHPNGTFSAK (13aa)
- KKENGVFEEISNSSGR (16aa)
- LLTSHGMSIQALLNATEFNYLCPAIINQIDAR (32aa)
- VIYQNHNK (8aa)
- HVTDMNSTIHLLR (13aa)
- QAFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVPEITWK (43aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:3 dHex:1 / N-Linked
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- O-Linked / No-core
(avg mass : 1260.1705)
Source
Reported glycosite
- O-Linked / Core 9
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1260.1705)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1260.1705)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1260.1705)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1260.1705)
Source
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1260.1705)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1260.1705)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 1260.1705)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 1260.1705)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Undefined core
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1260.1705)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / No-core
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1260.1705)
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1260.1705)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1260.1705)
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)