taxonomy (9)
protein (45)
source (16)
structure (13)
composition (1)
disease (6)
reference (23)
site (50)
peptide (30)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Gallus gallus (Chicken)
- Dirofilaria immitus (Canine heartworm nematode)
- Trichinella spiralis
- Bothrops moojeni (Brazilian lancehead)
Taxonomy
- Acid ceramidase / Homo sapiens Q13510
- Amyloid beta a4 protein / Homo sapiens P05067
- Asporin / Homo sapiens Q9BXN1
- Biglycan / Homo sapiens P21810
- Calumenin / Homo sapiens O43852
- Calumenin, isoform CRA_a / Homo sapiens
- Cathepsin D / Homo sapiens P07339
- Ceramide synthase 2 / Homo sapiens Q96G23
- Clusterin / Homo sapiens P10909
- Decorin / Homo sapiens P07585
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- DnaJ homolog subfamily B member 11 / Homo sapiens Q9UBS4
- Fibronectin / Homo sapiens P02751
- Glandular kallikrein 1 / Homo sapiens P06870
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Interstitial collagenase / Homo sapiens P03956
- Lysosomal Pro-X carboxypeptidase / Homo sapiens P42785
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Mucin - species III / Homo sapiens
- Mucin - species IV / Homo sapiens
- Periostin / Homo sapiens Q15063
- Proheparin-binding EGF-like growth factor / Homo sapiens Q99075
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens P13674
- Reticulocalbin-1 / Homo sapiens Q15293
- Serpin h1 / Homo sapiens P50454
- Thrombospondin-1 / Homo sapiens P07996
- Tissue-type plasminogen activator / Homo sapiens P00750
- Zymogen granule protein 16 homolog B / Homo sapiens Q96DA0
- Platelet glycoprotein IV / Bos taurus P26201
- Thyrotropin-aplha and beta chains / Bos taurus P01223 P01217
- Uncharacterized protein from Milk Fat Globule Membrane / Bos taurus
- Uncharacterized protein from Zona Pellucida / Bos taurus
- Zona pellucida sperm-binding protein 2 / Bos taurus Q9BH10
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Neuroligin 1 / Rattus norvegicus Q62765
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Uncharacterized protein from Fibroblast / Gallus gallus
- Uncharacterized protein from Whole Organism / Dirofilaria immitus
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein from Whole Organism / Trichinella spiralis
- Batroxobin / Bothrops moojeni
Protein
- Acetabular Part of Hip Bone (UBERON_0001269) HT-1080 (CVCL_0317) Fibroblast (CL_0000057)
- Blood Serum (UBERON_0001977)
- Colonic Mucosa (UBERON_0000317)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913) Plasma Membrane (GO_0005886)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Pituitary Gland (UBERON_0000007)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- C6 (CVCL_0194) Glial Cell (CL_0000125)
- Fibroblast (CL_0000057)
Source
- O-Linked / Core 3 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-3)[GalNAc(a1-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-3)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]ManNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GalNAc(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HexNAc(?1-?)HexNAc(?1-?)Man(a1-3)[HexNAc(?1-?)HexNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 4 x HexNAc"
Reported structure
- Hex:3 HexNAc:6 dHex:1 (avg mass : 1869.7555 )
Composition
- Cancer, breast (DOID:1612)
- Diverticulosis (DOID:7475)
- Fibrosarcoma (DOID:3355)
- Melanoma (DOID:1909)
- Prostate cancer (DOID:10283)
- Tumor, Glial (DOID:3070)
Disease
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
- Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- N-linked oligosaccharide of beta-amyloid precursor protein (beta APP) of C6 glioma cells: putative regulatory role in beta APP processing. (1995 - Saito F, Tani A, Miyatake T, Yanagisawa K) / Status : Reviewed
- Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
- Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
- A novel sialylated N-acetylgalactosamine-containing oligosaccharide is the major complex-type structure present in Bowes melanoma tissue plasminogen activator. (1991 - Chan A, Morris H, Panico M, Etienne A, Rogers M, Gaffney P, Creighton-Kempsford L, Dell A) / Status : Reviewed
- Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
Reference
- Acid ceramidase / Homo sapiens
-
Amyloid beta a4 protein / Homo sapiens
- Undefined site
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Cathepsin D / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Clusterin / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- DnaJ homolog subfamily B member 11 / Homo sapiens
- Fibronectin / Homo sapiens
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Interstitial collagenase / Homo sapiens
- Lysosomal Pro-X carboxypeptidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
-
Mucin - species III / Homo sapiens
- Undefined site
-
Mucin - species IV / Homo sapiens
- Undefined site
- Periostin / Homo sapiens
- Proheparin-binding EGF-like growth factor / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Serpin h1 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tissue-type plasminogen activator / Homo sapiens
- Zymogen granule protein 16 homolog B / Homo sapiens
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Uncharacterized protein from Milk Fat Globule Membrane / Bos taurus
- Undefined site
-
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Uncharacterized protein from Fibroblast / Gallus gallus
- Undefined site
-
Uncharacterized protein from Whole Organism / Dirofilaria immitus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein from Whole Organism / Trichinella spiralis
- Undefined site
-
Batroxobin / Bothrops moojeni
- Undefined site
Reported glycosite
- IWIPVNITWADIEDRDGR (18aa)
- GLAAGTSNPDPPTVSTDQLLPLGGGR (26aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- DMSDGFISNITIQR (14aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- SISNSTAR (8aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- SIGFEWNYPLEEPTTEPPVNLTYSANSPVGR (31aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- IININPNK (8aa)
- RGDDIYTNVTISIVESIVGFEMDITHIDGHK (31aa)
- GLSFNSISAVDNGSLANTPHLR (22aa)
- MIENGSISFIPTIR (14aa)
- ITDIENGSIANIPR (14aa)
- ILAPAYFILGGNQSGEG (17aa)
- IIQVVYIHSNNITK (14aa)
- LHSNNITK (8aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- IANITQGEDQYYIR (14aa)
- NISSHTNIVFSNGELDPWSGGGVTK (25aa)
- RHEEGHMINCTCFGQGR (17aa)
- LGNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGSK (37aa)
- EVNDTLLVNELK (12aa)
- AEPPINASASDQGEK (15aa)
- VVNSTTGPGEHIR (13aa)
Mass spectrometry observed peptide
-
- O-Linked / Core 3 (avg mass : 1869.7555)
- Colonic Mucosa (UBERON_0000317)
- Diverticulosis (DOID:7475)
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
-
Mucin - species III / Homo sapiens
- Undefined site
-
Mucin - species IV / Homo sapiens
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
- Melanoma (DOID:1909)
- Tissue-type plasminogen activator / Homo sapiens
-
- N-Linked / Complex (avg mass : 1869.7555)
- Acetabular Part of Hip Bone (UBERON_0001269) HT-1080 (CVCL_0317) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Mammary Gland (UBERON_0001911)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Fibrosarcoma (DOID:3355)
- Melanoma (DOID:1909)
- N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
- Interstitial collagenase / Homo sapiens
- Tissue-type plasminogen activator / Homo sapiens
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
- Venom (UBERON_0007113)
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Zona Pellucida (UBERON_0000086)
- Fibroblast (CL_0000057)
- Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
- Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
-
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Fibroblast / Gallus gallus
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
-
Uncharacterized protein from Whole Organism / Dirofilaria immitus
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
- C6 (CVCL_0194) Glial Cell (CL_0000125)
- Tumor, Glial (DOID:3070)
-
Amyloid beta a4 protein / Homo sapiens
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
-
Uncharacterized protein from Whole Organism / Dirofilaria immitus
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
-
Uncharacterized protein from Milk Fat Globule Membrane / Bos taurus
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex (avg mass : 1869.7555)
-
Uncharacterized protein from Whole Organism / Trichinella spiralis
- Undefined site
-
- Hex:3 HexNAc:6 dHex:1 / N-Linked (avg mass : 1869.7555)
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-3)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]ManNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GalNAc(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HexNAc(?1-?)HexNAc(?1-?)Man(a1-3)[HexNAc(?1-?)HexNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 4 x HexNAc"
- Cancer, breast (DOID:1612)
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Acid ceramidase / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Cathepsin D / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Clusterin / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- DnaJ homolog subfamily B member 11 / Homo sapiens
- Fibronectin / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Lysosomal Pro-X carboxypeptidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Periostin / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Serpin h1 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Zymogen granule protein 16 homolog B / Homo sapiens
- IWIPVNITWADIEDRDGR (18aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- DMSDGFISNITIQR (14aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- SISNSTAR (8aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- SIGFEWNYPLEEPTTEPPVNLTYSANSPVGR (31aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- IININPNK (8aa)
- RGDDIYTNVTISIVESIVGFEMDITHIDGHK (31aa)
- GLSFNSISAVDNGSLANTPHLR (22aa)
- MIENGSISFIPTIR (14aa)
- ITDIENGSIANIPR (14aa)
- ILAPAYFILGGNQSGEG (17aa)
- IIQVVYIHSNNITK (14aa)
- LHSNNITK (8aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- IANITQGEDQYYIR (14aa)
- NISSHTNIVFSNGELDPWSGGGVTK (25aa)
- RHEEGHMINCTCFGQGR (17aa)
- LGNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGSK (37aa)
- EVNDTLLVNELK (12aa)
- AEPPINASASDQGEK (15aa)
- VVNSTTGPGEHIR (13aa)
-
- Hex:3 HexNAc:6 dHex:1 / O-Linked (avg mass : 1869.7555)
- Urine (UBERON_0001088)
- O-Linked / Core 3 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-3)[GalNAc(a1-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc
- Prostate cancer (DOID:10283)
- Proheparin-binding EGF-like growth factor / Homo sapiens
- GLAAGTSNPDPPTVSTDQLLPLGGGR (26aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
Source
Disease
Reported glycosite
Disease
Reported glycosite
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reference
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reference
Reported glycosite
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reference
Reported glycosite
