taxonomy (11)
protein (51)
source (30)
structure (29)
composition (1)
disease (13)
reference (40)
site (71)
peptide (49)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Gallus gallus (Chicken)
- Dirofilaria immitus (Canine heartworm nematode)
- Trichinella spiralis
- Bothrops moojeni (Brazilian lancehead)
- SARS coronavirus CUHK-W1
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Acid ceramidase / Homo sapiens Q13510
- Amyloid beta a4 protein / Homo sapiens P05067
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Asporin / Homo sapiens Q9BXN1
- Biglycan / Homo sapiens P21810
- Calumenin / Homo sapiens O43852
- Cathepsin D / Homo sapiens P07339
- Ceramide synthase 2 / Homo sapiens Q96G23
- Clusterin / Homo sapiens P10909
- Coagulation factor V / Homo sapiens P12259
- Decorin / Homo sapiens P07585
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- DnaJ homolog subfamily B member 11 / Homo sapiens Q9UBS4
- Fibronectin / Homo sapiens P02751
- Glandular kallikrein 1 / Homo sapiens P06870
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Interstitial collagenase / Homo sapiens P03956
- Lysosomal Pro-X carboxypeptidase / Homo sapiens P42785
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Mucin-2 / Homo sapiens Q02817
- Periostin / Homo sapiens Q15063
- Proheparin-binding EGF-like growth factor / Homo sapiens Q99075
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens P13674
- Reticulocalbin-1 / Homo sapiens Q15293
- Serpin h1 / Homo sapiens P50454
- Thrombospondin-1 / Homo sapiens P07996
- Tissue-type plasminogen activator / Homo sapiens P00750
- Zymogen granule protein 16 homolog B / Homo sapiens Q96DA0
- Platelet glycoprotein IV / Bos taurus P26201
- Thyrotropin-aplha and beta chains / Bos taurus P01217 P01223
- Uncharacterized protein from Milk / Bos taurus
- Uncharacterized protein from Zona Pellucida / Bos taurus
- Zona pellucida sperm-binding protein 2 / Bos taurus Q9BH10
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Neuroligin 1 / Rattus norvegicus Q62765
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Uncharacterized protein / Gallus gallus
- Uncharacterized protein / Dirofilaria immitus
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Batroxobin / Bothrops moojeni
- Recombinant Spike glycoprotein (HEK293) - RBD domain / SARS coronavirus CUHK-W1 P59594
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Acetabular Part of Hip Bone (UBERON_0001269) HT-1080 (CVCL_0317) Fibroblast (CL_0000057)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cerebellum (UBERON_0002037)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Colonic Mucosa (UBERON_0000317)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913) Plasma Membrane (GO_0005886)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Pituitary Gland (UBERON_0000007)
- Prefrontal Cortex (UBERON:0000451)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Striatum (UBERON_0002345)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- C6 (CVCL_0194) Glial Cell (CL_0000125)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- Fibroblast (CL_0000057)
Source
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-3)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]ManNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GalNAc(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HexNAc(?1-?)HexNAc(?1-?)Man(a1-3)[HexNAc(?1-?)HexNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 4 x HexNAc"
- N-Linked / Complex / Structure 9713
- N-Linked / Complex / Structure 10159
- N-Linked / Complex / Structure 10651
- N-Linked / Complex / Structure 10754
- N-Linked / Complex / Structure 11145
- N-Linked / Complex / Structure 11146
- N-Linked / Complex / Structure 11147
- N-Linked / Complex / Structure 11466
- N-Linked / Complex / Structure 11481
- N-Linked / Complex / Structure 11609
- N-Linked / Complex / Structure 11626
- N-Linked / Complex / Structure 11671
- N-Linked / Complex / Structure 11677
- N-Linked / Complex / Structure 11833
- N-Linked / Complex / Structure 11867
- N-Linked / Complex / Structure 11877
- O-Linked / Core 3 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-3)[GalNAc(a1-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc
Reported structure
- Hex:3 HexNAc:6 dHex:1 (avg mass : 1869.7555 )
Composition
- Alzheimer's disease (DOID:10652)
- Cancer, breast (DOID:1612)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Diverticulosis (DOID:7475)
- Fibrosarcoma (DOID:3355)
- Melanoma (DOID:1909)
- Mild Cognitive Impairment (DOID:0080832)
- Mixed phenotype acute leukemia (DOID:9953)
- Prostate cancer (DOID:10283)
- Schizophrenia (DOID:5419)
- severe acute respiratory syndrome (DOID:2945)
- Tumor, Glial (DOID:3070)
Disease
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- CSF N-glycoproteomics for early diagnosis in Alzheimer's disease (2016 - Palmigiano A, Barone R, Sturiale L, Sanfilippo C, Bua RO, Romeo DA, Messina A, Capuana ML, Maci T, Le Pira F, Zappia M, Garozzo D) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
- Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Neutral N-glycans in adult rat brain tissue--complete characterisation reveals fucosylated hybrid and complex structures (1998 - Chen YJ, Wing DR, Guile GR, Dwek RA, Harvey DJ, Zamze S) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
- N-linked oligosaccharide of beta-amyloid precursor protein (beta APP) of C6 glioma cells: putative regulatory role in beta APP processing. (1995 - Saito F, Tani A, Miyatake T, Yanagisawa K) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
- Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- A novel sialylated N-acetylgalactosamine-containing oligosaccharide is the major complex-type structure present in Bowes melanoma tissue plasminogen activator. (1991 - Chan A, Morris H, Panico M, Etienne A, Rogers M, Gaffney P, Creighton-Kempsford L, Dell A) / Status : Reviewed
- Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
Reference
- Acid ceramidase / Homo sapiens
-
Amyloid beta a4 protein / Homo sapiens
- Undefined site
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Cathepsin D / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- DnaJ homolog subfamily B member 11 / Homo sapiens
- Fibronectin / Homo sapiens
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Interstitial collagenase / Homo sapiens
- Lysosomal Pro-X carboxypeptidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
-
Mucin-2 / Homo sapiens
- Undefined site
- Periostin / Homo sapiens
- Proheparin-binding EGF-like growth factor / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Serpin h1 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tissue-type plasminogen activator / Homo sapiens
- Zymogen granule protein 16 homolog B / Homo sapiens
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Uncharacterized protein from Milk / Bos taurus
- Undefined site
-
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Batroxobin / Bothrops moojeni
- Undefined site
-
Recombinant Spike glycoprotein (HEK293) - RBD domain / SARS coronavirus CUHK-W1
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- GLAAGTSNPDPPTVSTDQLLPLGGGR (26aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- DMSDGFISNITIQR (14aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- SISNSTAR (8aa)
- TQSLLIVNNATNVVIK (16aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- VYSSANNCTFE (11aa)
- SIGFEWNYPLEEPTTEPPVNLTYSANSPVGR (31aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- IININPNK (8aa)
- RGDDIYTNVTISIVESIVGFEMDITHIDGHK (31aa)
- GLSFNSISAVDNGSLANTPHLR (22aa)
- MIENGSISFIPTIR (14aa)
- NGTITDAVDCALDPLSE (17aa)
- ITDIENGSIANIPR (14aa)
- ILAPAYFILGGNQSGEG (17aa)
- IIQVVYIHSNNITK (14aa)
- LHSNNITK (8aa)
- FPNIT (5aa)
- FPNITNLCPFGE (12aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- VFNATR (6aa)
- GEVFNATR (8aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- IANITQGEDQYYIR (14aa)
- NISSHTNIVFSNGELDPWSGGGVTK (25aa)
- RHEEGHMINCTCFGQGR (17aa)
- LGNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGSK (37aa)
- EVNDTLLVNELK (12aa)
- LYQDVNCT (8aa)
- NNSYECDIPI (10aa)
- AEPPINASASDQGEK (15aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- NFTTAP (6aa)
- NGTHWFV (7aa)
- IGIVNNT (7aa)
- GINASVV (7aa)
- GINAS (5aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Melanoma (DOID:1909)
- Tissue-type plasminogen activator / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Acetabular Part of Hip Bone (UBERON_0001269) HT-1080 (CVCL_0317) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Mammary Gland (UBERON_0001911)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- HEK293 (CVCL_0045)
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
- Interstitial collagenase / Homo sapiens
- Tissue-type plasminogen activator / Homo sapiens
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Venom (UBERON_0007113)
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Cerebrospinal Fluid (UBERON_0001359)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Zona Pellucida (UBERON_0000086)
- Fibroblast (CL_0000057)
- Schizophrenia (DOID:5419)
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
- Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
-
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- C6 (CVCL_0194) Glial Cell (CL_0000125)
- Tumor, Glial (DOID:3070)
-
Amyloid beta a4 protein / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
-
Uncharacterized protein from Milk / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- FPNIT (5aa)
- GEVFNATR (8aa)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1869.7555)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Bone Marrow (UBERON_0002371)
-
- N-Linked / Complex
(avg mass : 1869.7555)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Blood Plasma (UBERON_0001969)
- Coagulation factor V / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Schizophrenia (DOID:5419)
-
- N-Linked / Complex
(avg mass : 1869.7555)
- HEK293 (CVCL_0045)
-
Recombinant Spike glycoprotein (HEK293) - RBD domain / SARS coronavirus CUHK-W1
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Cerebellum (UBERON_0002037)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Striatum (UBERON_0002345)
-
- N-Linked / Complex
(avg mass : 1869.7555)
-
- N-Linked / Complex
(avg mass : 1869.7555)
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Brain (UBERON_0000955)
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Alzheimer's disease (DOID:10652)
-
- N-Linked / Complex
(avg mass : 1869.7555)
-
- O-Linked / Core 3
(avg mass : 1869.7555)
- Colonic Mucosa (UBERON_0000317)
- Diverticulosis (DOID:7475)
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
-
Mucin-2 / Homo sapiens
- Undefined site
-
- Hex:3 HexNAc:6 dHex:1 / N-Linked
(avg mass : 1869.7555)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-3)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]ManNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GalNAc(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HexNAc(?1-?)HexNAc(?1-?)Man(a1-3)[HexNAc(?1-?)HexNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 4 x HexNAc"
- N-Linked / Complex / Structure 9713
- N-Linked / Complex / Structure 10159
- N-Linked / Complex / Structure 10651
- N-Linked / Complex / Structure 10754
- N-Linked / Complex / Structure 11145
- N-Linked / Complex / Structure 11146
- N-Linked / Complex / Structure 11147
- N-Linked / Complex / Structure 11466
- N-Linked / Complex / Structure 11481
- N-Linked / Complex / Structure 11609
- N-Linked / Complex / Structure 11626
- N-Linked / Complex / Structure 11671
- N-Linked / Complex / Structure 11677
- N-Linked / Complex / Structure 11833
- N-Linked / Complex / Structure 11867
- N-Linked / Complex / Structure 11877
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Acid ceramidase / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Cathepsin D / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Clusterin / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- DnaJ homolog subfamily B member 11 / Homo sapiens
- Fibronectin / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Lysosomal Pro-X carboxypeptidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Periostin / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Serpin h1 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Zymogen granule protein 16 homolog B / Homo sapiens
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- DMSDGFISNITIQR (14aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- SISNSTAR (8aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- SIGFEWNYPLEEPTTEPPVNLTYSANSPVGR (31aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- IININPNK (8aa)
- RGDDIYTNVTISIVESIVGFEMDITHIDGHK (31aa)
- GLSFNSISAVDNGSLANTPHLR (22aa)
- MIENGSISFIPTIR (14aa)
- ITDIENGSIANIPR (14aa)
- ILAPAYFILGGNQSGEG (17aa)
- IIQVVYIHSNNITK (14aa)
- LHSNNITK (8aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- GEVFNATR (8aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- IANITQGEDQYYIR (14aa)
- NISSHTNIVFSNGELDPWSGGGVTK (25aa)
- RHEEGHMINCTCFGQGR (17aa)
- LGNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGSK (37aa)
- EVNDTLLVNELK (12aa)
- LYQDVNCT (8aa)
- NNSYECDIPI (10aa)
- AEPPINASASDQGEK (15aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- NFTTAP (6aa)
- NGTHWFV (7aa)
- IGIVNNT (7aa)
- GINASVV (7aa)
- GINAS (5aa)
-
- Hex:3 HexNAc:6 dHex:1 / O-Linked
(avg mass : 1869.7555)
- Urine (UBERON_0001088)
- O-Linked / Core 3 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-3)[GalNAc(a1-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc
- Prostate cancer (DOID:10283)
- Proheparin-binding EGF-like growth factor / Homo sapiens
- GLAAGTSNPDPPTVSTDQLLPLGGGR (26aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:6 dHex:1 / O-Linked
(avg mass : 1869.7555)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:6 dHex:1 / N-Linked
(avg mass : 1869.7555)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 3
(avg mass : 1869.7555)
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)