taxonomy (13)
protein (20)
source (11)
structure (23)
composition (1)
disease (3)
reference (21)
site (28)
peptide (12)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Cricetulus griseus (Chinese hamster)
- Mus musculus (House mouse)
- Asterias rubens (European starfish)
- Coturnix coturnix japonica (Japanese quail)
- Aspergillus niger
- Drosophila melanogaster (Fruit fly)
- Leptomonas Samueli
- Brassica oleracea var. botrytis (Cauliflower)
- Saccharomyces cerevisiae (Baker's yeast)
- Schizosaccharomyces pombe (Fission yeast)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-S1-casein / Homo sapiens P47710
- Cap-gly domain-containinglinker protein 1 / Homo sapiens P30622
- Tumor necrosis factor ligand superfamily member 5 / Homo sapiens P29965
- Uromodulin / Homo sapiens P07911
- Beta-lactoglobulin / Bos taurus P02754
- Uncharacterized protein from Ovary / Cricetulus griseus
- Quinone oxidoreductase-like protein 2 / Mus musculus Q3UNZ8
- Uncharacterized protein from Mononuclear Leukocyte / Mus musculus
- Uncharacterized protein from Ovary / Asterias rubens
- Immunoglobulin y / Coturnix coturnix japonica
- Endopolygalacturonase II / Aspergillus niger P26214
- Uncharacterized protein from Whole Cell / Leptomonas Samueli
- Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis Q6YDN9
- Invertase / Saccharomyces cerevisiae
- Invertase 2 / Saccharomyces cerevisiae P00724
- Invertase [er form] / Saccharomyces cerevisiae
- Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Whole-cell glycoproteins / Schizosaccharomyces pombe
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Brain (UBERON_0000955)
- Embryo (UBERON_0000922)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) Lec23 (CVCL_VU64)
- Ovary (UBERON_0000992)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- BW5147 (CVCL_3896) Leukocyte (CL_0000738)
- BW5147.PHAR2.7 (CVCL_VT60) Leukocyte (CL_0000738)
- Yolk (GO_0060417)
Source
- N-Linked / High-Mannose / Gal(?1-?)Man(a1-2)Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Gal(?1-?)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Gal(?1-?)Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-2)Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-2)Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-2)Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-3)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-2)[Man(a1-6)Man(a1-6)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Gal(?1-?)Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Glc(a1-2)Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)Man(a1-6)[Man(a1-2)Man(a1-2)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 6 x Man"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 6 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-3)Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 8 x Man"
- N-Linked / High-Mannose / Structure 9516
- N-Linked / Undefined core / Structure 9862
Reported structure
- Hex:11 HexNAc:2 (avg mass : 2207.9717 )
Composition
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- N-linked glycosylation of native and recombinant cauliflower xyloglucan endotransglycosylase 16A. (2003 - Henriksson H, Denman SE, Campuzano ID, Ademark P, Master ER, Teeri TT, Brumer H) / Status : Reviewed
- Characterization of glycosylated variants of beta-lactoglobulin expressed in Pichia pastoris (2001 - Kalidas, Joshi, Batt) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- Novel Schizosaccharomyces pombe N-linked GalMan9GlcNAc isomers: role of the Golgi GMA12 galactosyltransferase in core glycan galactosylation. (1999 - Ziegler F, Cavanagh J, Lubowski C, Trimble R) / Status : Reviewed
- Identification of the glycosylation site and glycan structures of recombinant endopolygalacturonase II by mass spectrometry (1997 - Yang, Bergmann, Benen, Orlando) / Status : Reviewed
- Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. I. Role of glucose in the initial glycosylation of invertase in the endoplasmic reticulum. (1993 - Verostek M, Atkinson P, Trimble R) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Structural heterogeneity in the Man8-13GlcNAc oligosaccharides from log-phase Saccharomyces yeast: a one- and two-dimensional 1H NMR spectroscopic study. (1992 - Trimble R, Atkinson P) / Status : Reviewed
- A novel glycosylation phenotype expressed by Lec23, a Chinese hamster ovary mutant deficient in alpha-glucosidase I. (1991 - Ray M, Yang J, Sundaram S, Stanley P) / Status : Reviewed
- Structure of oligosaccharides on Saccharomyces SUC2 invertase secreted by the methylotrophic yeast Pichia pastoris. (1991 - Trimble R, Atkinson P, Tschopp J, Townsend R, Maley F) / Status : Reviewed
- Localization of alpha 1----3-linked mannoses in the N-linked oligosaccharides of Saccharomyces cerevisiae mnn mutants. (1990 - Alvarado E, Ballou L, Hernandez L, Ballou C) / Status : Reviewed
- Structural characterization of several galactofuranose-containing, high-mannose-type oligosaccharides present in glycoproteins of the trypanosomatid Leptomonas samueli. (1988 - Moraes CT, Bosch M, Parodi AJ) / Status : Reviewed
- Characterization of N-linked gluco-oligomannose type of carbohydrate chains of glycoproteins from the ovary of the starfish Asterias rubens (L.). (1987 - De Waard P, Kamerling JP, Van Halbeek H, Vliegenthart JF, Broertjes JJ) / Status : Reviewed
- The effect of castanospermine on the oligosaccharide structures of glycoproteins from lymphoma cell lines. (1985 - Palamarczyk G, Elbein AD) / Status : Reviewed
Reference
- Alpha-S1-casein / Homo sapiens
- Cap-gly domain-containinglinker protein 1 / Homo sapiens
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
-
Beta-lactoglobulin / Bos taurus
- Undefined site
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
- Quinone oxidoreductase-like protein 2 / Mus musculus
-
Uncharacterized protein from Mononuclear Leukocyte / Mus musculus
- Undefined site
-
Uncharacterized protein from Ovary / Asterias rubens
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Endopolygalacturonase II / Aspergillus niger
- Undefined site
-
Uncharacterized protein from Whole Cell / Leptomonas Samueli
- Undefined site
-
Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis
- Undefined site
-
Invertase / Saccharomyces cerevisiae
- Undefined site
-
Invertase 2 / Saccharomyces cerevisiae
- Undefined site
-
Invertase [er form] / Saccharomyces cerevisiae
- Undefined site
-
Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Undefined site
-
Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Undefined site
-
Whole-cell glycoproteins / Schizosaccharomyces pombe
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- IVNNATNVVIK (11aa)
- NISAMGLYWGR (11aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- KNFTTAPAICHDGK (14aa)
- GVFVSNGTHWFVTQR (15aa)
- EGVFVSNGTHWFVTQR (16aa)
- ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
Mass spectrometry observed peptide
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Uncharacterized protein from Whole Cell / Leptomonas Samueli
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Uncharacterized protein from Whole Cell / Leptomonas Samueli
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
- Ovary (UBERON_0000992) Lec23 (CVCL_VU64)
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
- Ovary (UBERON_0000992) Lec23 (CVCL_VU64)
- Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. I. Role of glucose in the initial glycosylation of invertase in the endoplasmic reticulum. (1993 - Verostek M, Atkinson P, Trimble R) / Status : Reviewed
- A novel glycosylation phenotype expressed by Lec23, a Chinese hamster ovary mutant deficient in alpha-glucosidase I. (1991 - Ray M, Yang J, Sundaram S, Stanley P) / Status : Reviewed
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Invertase [er form] / Saccharomyces cerevisiae
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
- Yolk (GO_0060417)
- Novel Schizosaccharomyces pombe N-linked GalMan9GlcNAc isomers: role of the Golgi GMA12 galactosyltransferase in core glycan galactosylation. (1999 - Ziegler F, Cavanagh J, Lubowski C, Trimble R) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Whole-cell glycoproteins / Schizosaccharomyces pombe
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
- Ovary (UBERON_0000992)
-
Uncharacterized protein from Ovary / Asterias rubens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
- Structural heterogeneity in the Man8-13GlcNAc oligosaccharides from log-phase Saccharomyces yeast: a one- and two-dimensional 1H NMR spectroscopic study. (1992 - Trimble R, Atkinson P) / Status : Reviewed
- Structure of oligosaccharides on Saccharomyces SUC2 invertase secreted by the methylotrophic yeast Pichia pastoris. (1991 - Trimble R, Atkinson P, Tschopp J, Townsend R, Maley F) / Status : Reviewed
-
Invertase / Saccharomyces cerevisiae
- Undefined site
-
Invertase 2 / Saccharomyces cerevisiae
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Invertase / Saccharomyces cerevisiae
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Invertase 2 / Saccharomyces cerevisiae
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Beta-lactoglobulin / Bos taurus
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Invertase 2 / Saccharomyces cerevisiae
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Uncharacterized protein from Whole Cell / Leptomonas Samueli
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
- Lymphoma (DOID:0060058)
-
Uncharacterized protein from Mononuclear Leukocyte / Mus musculus
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
- Structural heterogeneity in the Man8-13GlcNAc oligosaccharides from log-phase Saccharomyces yeast: a one- and two-dimensional 1H NMR spectroscopic study. (1992 - Trimble R, Atkinson P) / Status : Reviewed
- Structure of oligosaccharides on Saccharomyces SUC2 invertase secreted by the methylotrophic yeast Pichia pastoris. (1991 - Trimble R, Atkinson P, Tschopp J, Townsend R, Maley F) / Status : Reviewed
-
Invertase / Saccharomyces cerevisiae
- Undefined site
-
Invertase 2 / Saccharomyces cerevisiae
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Endopolygalacturonase II / Aspergillus niger
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
- Structural heterogeneity in the Man8-13GlcNAc oligosaccharides from log-phase Saccharomyces yeast: a one- and two-dimensional 1H NMR spectroscopic study. (1992 - Trimble R, Atkinson P) / Status : Reviewed
- Localization of alpha 1----3-linked mannoses in the N-linked oligosaccharides of Saccharomyces cerevisiae mnn mutants. (1990 - Alvarado E, Ballou L, Hernandez L, Ballou C) / Status : Reviewed
-
Invertase / Saccharomyces cerevisiae
- Undefined site
-
Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Invertase / Saccharomyces cerevisiae
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Invertase / Saccharomyces cerevisiae
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
-
Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2207.9717)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
-
- N-Linked / Undefined core
(avg mass : 2207.9717)
Released - Embryo (UBERON_0000922)
-
- Hex:11 HexNAc:2 / N-Linked
(avg mass : 2207.9717)
- Brain (UBERON_0000955)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- N-Linked / High-Mannose / Gal(?1-?)Man(a1-2)Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Gal(?1-?)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Gal(?1-?)Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-2)Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-2)Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-2)Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-3)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-2)[Man(a1-6)Man(a1-6)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Gal(?1-?)Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Glc(a1-2)Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)Man(a1-6)[Man(a1-2)Man(a1-2)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 6 x Man"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 6 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-3)Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 8 x Man"
- N-Linked / High-Mannose / Structure 9516
- N-Linked / Undefined core / Structure 9862
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Cap-gly domain-containinglinker protein 1 / Homo sapiens
- Uromodulin / Homo sapiens
- Quinone oxidoreductase-like protein 2 / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- IVNNATNVVIK (11aa)
- NISAMGLYWGR (11aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- KNFTTAPAICHDGK (14aa)
- GVFVSNGTHWFVTQR (15aa)
- EGVFVSNGTHWFVTQR (16aa)
- ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:11 HexNAc:2 / N-Linked
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 2207.9717)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Disease
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 2207.9717)