GlyConnect

taxonomy (12) protein (19) source (9) structure (21) composition (1) disease (3) reference (19) site (27) peptide (11)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:11 HexNAc:2 (avg mass : 2207.9717 )

Disease

Reference

Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
N-linked glycosylation of native and recombinant cauliflower xyloglucan endotransglycosylase 16A. (2003 - Henriksson H, Denman SE, Campuzano ID, Ademark P, Master ER, Teeri TT, Brumer H) / Status : Reviewed
Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
Characterization of glycosylated variants of beta-lactoglobulin expressed in Pichia pastoris (2001 - Kalidas, Joshi, Batt) / Status : Reviewed
Novel Schizosaccharomyces pombe N-linked GalMan9GlcNAc isomers: role of the Golgi GMA12 galactosyltransferase in core glycan galactosylation. (1999 - Ziegler F, Cavanagh J, Lubowski C, Trimble R) / Status : Reviewed
Identification of the glycosylation site and glycan structures of recombinant endopolygalacturonase II by mass spectrometry (1997 - Yang, Bergmann, Benen, Orlando) / Status : Reviewed
Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. I. Role of glucose in the initial glycosylation of invertase in the endoplasmic reticulum. (1993 - Verostek M, Atkinson P, Trimble R) / Status : Reviewed
Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
Structural heterogeneity in the Man8-13GlcNAc oligosaccharides from log-phase Saccharomyces yeast: a one- and two-dimensional 1H NMR spectroscopic study. (1992 - Trimble R, Atkinson P) / Status : Reviewed
Structure of oligosaccharides on Saccharomyces SUC2 invertase secreted by the methylotrophic yeast Pichia pastoris. (1991 - Trimble R, Atkinson P, Tschopp J, Townsend R, Maley F) / Status : Reviewed
A novel glycosylation phenotype expressed by Lec23, a Chinese hamster ovary mutant deficient in alpha-glucosidase I. (1991 - Ray M, Yang J, Sundaram S, Stanley P) / Status : Reviewed
Localization of alpha 1----3-linked mannoses in the N-linked oligosaccharides of Saccharomyces cerevisiae mnn mutants. (1990 - Alvarado E, Ballou L, Hernandez L, Ballou C) / Status : Reviewed
Structural characterization of several galactofuranose-containing, high-mannose-type oligosaccharides present in glycoproteins of the trypanosomatid Leptomonas samueli. (1988 - Moraes CT, Bosch M, Parodi AJ) / Status : Reviewed
Characterization of N-linked gluco-oligomannose type of carbohydrate chains of glycoproteins from the ovary of the starfish Asterias rubens (L.). (1987 - De Waard P, Kamerling JP, Van Halbeek H, Vliegenthart JF, Broertjes JJ) / Status : Reviewed
The effect of castanospermine on the oligosaccharide structures of glycoproteins from lymphoma cell lines. (1985 - Palamarczyk G, Elbein AD) / Status : Reviewed

Reported glycosite

Cap-gly domain-containinglinker protein 1 / Homo sapiens
- Asn-187
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
Uromodulin / Homo sapiens
- Asn-513
Beta-lactoglobulin / Bos taurus
- Undefined site
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
Quinone oxidoreductase-like protein 2 / Mus musculus
- Asn-281
Uncharacterized protein from Mononuclear Leukocyte / Mus musculus
- Undefined site
Uncharacterized protein from Ovary / Asterias rubens
- Undefined site
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
Endopolygalacturonase II / Aspergillus niger
- Undefined site
Uncharacterized protein from Whole Cell / Leptomonas Samueli
- Undefined site
Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis
- Undefined site
Invertase / Saccharomyces cerevisiae
- Undefined site
Invertase 2 / Saccharomyces cerevisiae
- Undefined site
Invertase [er form] / Saccharomyces cerevisiae
- Undefined site
Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Undefined site
Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Undefined site
Whole-cell glycoproteins / Schizosaccharomyces pombe
- Undefined site
Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Asn-61
- Asn-74
- Asn-122
- Asn-331
- Asn-343
- Asn-717
- Asn-1074
- Asn-1098
- Asn-1159

Mass spectrometry observed peptide

SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- P0DTC2 Asn-74
SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- P0DTC2 Asn-61
SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- P0DTC2 Asn-74
IVNNATNVVIK (11aa)
- P0DTC2 Asn-122
NISAMGLYWGR (11aa)
- Q3UNZ8 Asn-281
VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- P0DTC2 Asn-331
VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- P0DTC2 Asn-343
FALLMTNCYATPSSNATDPLK (21aa)
- P07911 Asn-513
NSVAYSNNSIAIPTNFTISVTTE (23aa)
- P0DTC2 Asn-717
KNFTTAPAICHDGK (14aa)
- P0DTC2 Asn-1074
EGVFVSNGTHWFVTQR (16aa)
- P0DTC2 Asn-1098
GVFVSNGTHWFVTQR (15aa)
- P0DTC2 Asn-1098
ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
- P0DTC2 Asn-1159

- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)
- N-Linked / High-Mannose (avg mass : 2207.9717)

- Hex:11 HexNAc:2 / N-Linked (avg mass : 2207.9717)