taxonomy (12)
protein (142)
source (25)
structure (32)
composition (1)
disease (13)
reference (51)
site (192)
peptide (171)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis lupus familiaris (Dog)
- Desmodus rotundus (Common vampire bat)
- Equus caballus (Domestic horse)
- Felis catus (Cat)
- Mus musculus (House mouse)
- Ovis aries (Sheep)
- Sus scrofa (Pig)
- Gallus gallus (Chicken)
- Calloselasma rhodostoma (Malayan pit viper)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-fetoprotein / Homo sapiens P02771
- Alpha-S1-casein / Homo sapiens P47710
- Angiopoietin-related protein 4 / Homo sapiens Q9BY76
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Asporin / Homo sapiens Q9BXN1
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Biglycan / Homo sapiens P21810
- Calumenin / Homo sapiens O43852
- Calumenin, isoform CRA_a / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cation-independent mannose-6-phosphate receptor / Homo sapiens P11717
- CD16A-NK09-V/F genotype / Homo sapiens P08637
- CD59 glycoprotein / Homo sapiens P13987
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens Q96KA5
- Clusterin / Homo sapiens P10909
- Coagulation factor XII / Homo sapiens P00748
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-1(XIV) chain / Homo sapiens Q05707
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- Contactin-4 / Homo sapiens Q8IWV2
- Corticosteroid-binding globulin / Homo sapiens P08185
- Decorin / Homo sapiens P07585
- Desmocollin-2 / Homo sapiens Q02487
- ER membrane protein complex subunit 1 / Homo sapiens Q8N766
- Erythropoietin / Homo sapiens P01588
- Fibrinogen beta chain / Homo sapiens P02675
- Fibronectin / Homo sapiens P02751
- Fibulin-2 / Homo sapiens P98095
- Galectin-3-binding protein / Homo sapiens Q08380
- Hemopexin / Homo sapiens P02790
- HLA class I histocompatibility antigen, A-23 alpha chain / Homo sapiens P30447
- HLA class I histocompatibility antigen, A-24 alpha chain / Homo sapiens P05534
- IgG1-NK08-V/F genotype / Homo sapiens P01857
- IgG1-NK09-V/F genotype / Homo sapiens P01857
- IgG1-NK11-F/F genotype / Homo sapiens P01857
- IgG1-NK12-V/F genotype / Homo sapiens P01857
- IgG1-NK13-V/F genotype / Homo sapiens P01857
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01860 P01857
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Integrin alpha-5 / Homo sapiens P08648
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Junctional adhesion molecule A / Homo sapiens Q9Y624
- Lactotransferrin / Homo sapiens P02788
- Lumican / Homo sapiens P51884
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Matrix metalloproteinase-9 / Homo sapiens P14780
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Nidogen-2 / Homo sapiens Q14112
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Periostin / Homo sapiens Q15063
- Phospholipase B-like 1 / Homo sapiens Q6P4A8
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prosaposin / Homo sapiens P07602
- Prostaglandin F2 receptor negative regulator / Homo sapiens Q9P2B2
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Receptor-type tyrosine-protein phosphatase zeta / Homo sapiens P23471
- Reticulocalbin-1 / Homo sapiens Q15293
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens Q5H9R7
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Sortilin / Homo sapiens Q99523
- Stanniocalcin-2 / Homo sapiens O76061
- SUN domain-containing protein 1 / Homo sapiens O94901
- Thrombospondin-1 / Homo sapiens P07996
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens Q9NYU2
- Uncharacterized protein / Homo sapiens
- Uncharacterized protein from Blood Serum / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Acetylcholinesterase / Bos taurus P23795
- Immunoglobulin gamma / Canis lupus familiaris
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Immunoglobulin gamma / Equus caballus
- Immunoglobulin gamma / Felis catus
- Attractin / Mus musculus Q9WU60
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus Q8BTJ4
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Contactin-1 / Mus musculus P12960
- Endoplasmin / Mus musculus P08113
- Glutamate receptor ionotropic, delta-2 / Mus musculus Q61625
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Hyaluronan and proteoglycan link protein 1 / Mus musculus Q9QUP5
- Integrin alpha-V / Mus musculus P43406
- Integrin beta-1 / Mus musculus P09055
- Laminin subunit beta-2 / Mus musculus Q61292
- Laminin subunit gamma-1 / Mus musculus P02468
- Limbic system-associated membrane protein / Mus musculus Q8BLK3
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Neural cell adhesion molecule 1 / Mus musculus P13595
- Neural cell adhesion molecule 2 / Mus musculus O35136
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neural cell adhesion molecule L1-like protein / Mus musculus P70232
- Neurexin-1 / Mus musculus Q9CS84
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuronal pentraxin-1 / Mus musculus Q62443
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus B9EKR1
- Synaptophysin-like protein 1 / Mus musculus O09117
- Tetraspanin-2 / Mus musculus Q922J6
- Immunoglobulin gamma / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries Q712V9
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries Q712V9
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Thyroglobulin / Sus scrofa
- Ancrod / Calloselasma rhodostoma P26324
- L-amino acid oxidase / Calloselasma rhodostoma P81382
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Seminal Fluid (UBERON_0006530)
- Thyroid (UBERON_0002046)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- C10 (CVCL_5245)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- T84 (CVCL_0555)
- Granulocyte (CL_0000094)
- Neutrophil (CL_0000775)
Source
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 908
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / Structure 9317
- N-Linked / Complex / Structure 9469
- N-Linked / Complex / Structure 9879
- N-Linked / Complex / Structure 9932
- N-Linked / Complex / Structure 10022
- N-Linked / Complex / Structure 10250
- N-Linked / Complex / Structure 10302
- N-Linked / Complex / Structure 10404
- N-Linked / Complex / Structure 10643
- N-Linked / Complex / Structure 10764
- N-Linked / Complex / Structure 10778
- N-Linked / Complex / Structure 10914
- N-Linked / Complex / Structure 10917
- N-Linked / Complex / Structure 10943
- N-Linked / Complex / Structure 10954
- N-Linked / Complex / Structure 10983
- N-Linked / Complex / Structure 11183
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc+"+ Fuc(a1-3)"
- O-Linked / Core 2 / Structure 11029
- O-Linked / Core 2 / Structure 11075
- O-Linked / Core 2 / Structure 11079
Reported structure
- Asymptomatic myositis (DOID:633)
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Myositis (DOID:633)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
- Scrapie (DOID:5434)
- Systemic lupus erythematosus (DOID:9074)
Disease
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- Structure and characterization of the glycan moiety of L-amino-acid oxidase from the Malayan pit viper Calloselasma rhodostoma. (2001 - Geyer A, Fitzpatrick T, Pawelek P, Kitzing K, Vrielink A, Ghisla S, Macheroux P) / Status : Reviewed
- Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Three-dimensional elution mapping of pyridylaminated N-linked neutral and sialyl oligosaccharides. (1995 - Takahashi N, Nakagawa H, Fujikawa K, Kawamura Y, Tomiya N) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Carbohydrate structure of a thrombin-like serine protease from Agkistrodon rhodostoma. Structure elucidation of oligosaccharides by methylation analysis, liquid secondary-ion mass spectrometry and proton magnetic resonance. (1992 - Pfeiffer G, Dabrowski U, Dabrowski J, Stirm S, Strube K, Geyer R) / Status : Reviewed
- Structure determination by 1H NMR spectroscopy of (sulfated) sialylated N-linked carbohydrate chains released from porcine thyroglobulin by peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase-F. (1991 - de Waard P, Koorevaar A, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structures of O-linked oligosaccharides isolated from normal granulocytes, chronic myelogenous leukemia cells, and acute myelogenous leukemia cells. (1986 - Fukuda M, Carlsson S, Klock J, Dell A) / Status : Reviewed
Reference
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Alpha-fetoprotein / Homo sapiens
- Alpha-S1-casein / Homo sapiens
- Angiopoietin-related protein 4 / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Asporin / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- CD16A-NK09-V/F genotype / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor XII / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-1(XIV) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Contactin-4 / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Decorin / Homo sapiens
- Desmocollin-2 / Homo sapiens
- ER membrane protein complex subunit 1 / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibrinogen beta chain / Homo sapiens
- Fibronectin / Homo sapiens
- Fibulin-2 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Hemopexin / Homo sapiens
- HLA class I histocompatibility antigen, A-23 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-24 alpha chain / Homo sapiens
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Asn-340
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Asn-205
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Integrin alpha-5 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Junctional adhesion molecule A / Homo sapiens
- Lactotransferrin / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
- Metalloproteinase inhibitor 1 / Homo sapiens
- Nidogen-2 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Phospholipase B-like 1 / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin F2 receptor negative regulator / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Receptor-type tyrosine-protein phosphatase zeta / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Serpin h1 / Homo sapiens
- Sortilin / Homo sapiens
- Stanniocalcin-2 / Homo sapiens
- SUN domain-containing protein 1 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
- Attractin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Contactin-1 / Mus musculus
- Endoplasmin / Mus musculus
- Glutamate receptor ionotropic, delta-2 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Hyaluronan and proteoglycan link protein 1 / Mus musculus
- Integrin alpha-V / Mus musculus
- Integrin beta-1 / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Limbic system-associated membrane protein / Mus musculus
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
- Neural cell adhesion molecule 1 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurexin-1 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
- Synaptophysin-like protein 1 / Mus musculus
- Tetraspanin-2 / Mus musculus
-
Immunoglobulin gamma / Ovis aries
- Undefined site
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Thyroglobulin / Sus scrofa
- Undefined site
-
Ancrod / Calloselasma rhodostoma
- Undefined site
-
L-amino acid oxidase / Calloselasma rhodostoma
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- ASSNPNATSSSSQDPESLQDRGEGK (25aa)
- YVNMSNHHR (9aa)
- TAVNCSSDFDACLITK (16aa)
- EAENITTGC (9aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- FVGTPEVNQTTIYQR (15aa)
- YETTNK (6aa)
- GGNVTLPCK (9aa)
- LNGTDVDTGMDFR (13aa)
- LEPNSVDPENITEILIANQK (20aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- RNESTQNCVVAEPEKM (16aa)
- AIGFENATQAIGR (13aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- NK (2aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- VGVNKNQTVTATFGYPFR (18aa)
- LSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIR (35aa)
- HAIHVSGTNGTKRF (14aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- DNATEEEILVYLEK (14aa)
- ENTSDPSIVIAFGR (14aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- TVNVSVPK (8aa)
- AIIQGLMPDQNYTVQIIAYNK (21aa)
- TFYWDFYTNR (10aa)
- YYNQSEAGSHTIQMMFGCDVGSDGR (25aa)
- SISNSTAR (8aa)
- TQSLLIVNNATNVVIK (16aa)
- AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
- SIDSVSFSYNTGDNTTFPDAEDK (23aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- GLSFDVSLEVSQGPGLLNDTK (21aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- YHKNNKSWMESEF (13aa)
- VCQDCPIIAPINDTR (15aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- AGPNGTIFVADAYK (14aa)
- VYKPSAGNNSLYR (13aa)
- DITDLINNTFIR (12aa)
- TKPREEQFNSTFR (13aa)
- EEQFNSTF (8aa)
- AALAAFNAQNNGSNFQLEEISR (22aa)
- EEQFNSTFR (9aa)
- KTKPREEQFNSTFRV (15aa)
- KRLPEMAQPVDPAHNVSRL (19aa)
- EEQFNSTYR (9aa)
- EEQYNSTYR (9aa)
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
- TNPCLHGGR (9aa)
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
- RAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEAR (35aa)
- KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
- TVNITITQG (9aa)
- SWPAVGNCSSAIR (13aa)
- DGKPLLNDSR (10aa)
- VNTLEEGKGGPKNDTEER (18aa)
- LAAPNLTVEEGK (12aa)
- TPLTANITK (9aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- TNSTFVQALVEHVK (14aa)
- HNNDTQHIWESDSNEFSVIADPR (23aa)
- FINDSIVDPVDSEWFGFYR (19aa)
- GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
- FHLANR (6aa)
- KDNTTVTR (8aa)
- GLSFNSISAVDNGSLANTPHLR (22aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- SISAVDNGSLANTPHLR (17aa)
- GTEVNTTVIGENDPIDEVQGFIFGK (25aa)
- MIENGSISFIPTIR (14aa)
- YIGNATAIFFIPDEGK (16aa)
- THTNISE (7aa)
- ITDIENGSIANIPR (14aa)
- NVSVAEGK (8aa)
- VIYQNHNK (8aa)
- LGVTNASLVLFRPGSVR (17aa)
- FFHVNGSAFLPR (12aa)
- IIQVVYIHSNNITK (14aa)
- LQVVYLHSNNITK (13aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- IIDNNKTEK (9aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- GEVFNATRF (9aa)
- VFNATR (6aa)
- GEVFNATR (8aa)
- NATRF (5aa)
- NISSEEK (7aa)
- IANITQGEDQYYIR (14aa)
- QSTINTVDIYPMMCHILGLKPHPNNGTLSHTK (32aa)
- ANYTILK (7aa)
- GTAGNAIMDGASQIMGENR (19aa)
- IYNWSGYPIIVQK (13aa)
- LSLLEEPGNGTFTVILNQLTSR (22aa)
- NYTDCTSEGR (10aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
- CGIVPVIAENYNK (13aa)
- IISENKTDEEPGYIKK (16aa)
- LLLPAKNTTHLK (12aa)
- EKLLLPAKNTTHLK (14aa)
- AIPQPQNVTSIIGCTH (16aa)
- VPGNVTAVIGETIK (14aa)
- KVPGNVTAVLGETLKV (16aa)
- GKANSTGTLVITNPTR (16aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- SDVPNTSPNSTSQHVAEFETER (22aa)
- DQCIVDDITYNVNDTFHK (18aa)
- YLHTAVIVSGTMLVFGGNTHNDTSMSHGAK (30aa)
- YTCTAQTIVDNSSASADLVVR (21aa)
- EVNDTLLVNELK (12aa)
- FSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASASAVLR (39aa)
- LYQDVNCT (8aa)
- TEGENCTVFDSQAGFSFDLSPLTK (24aa)
- QQQHLFGSNVTDCSGNFCLFR (21aa)
- KDTCAQECSHFNLTK (15aa)
- MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
- IHQNITYQVCR (11aa)
- SNGSENNVLESQAGIQK (17aa)
- NFTIS (5aa)
- TISPTGNISSAPK (13aa)
- VSWKPQGAPEEWEEEIVTNHTLR (23aa)
- NMTLFSDLVAEK (12aa)
- NFSQILPDPSKPS (13aa)
- FGGFNFS (7aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- NFNFSQILPDPSKPSKR (17aa)
- NFSQILPDPSKPSK (14aa)
- VTGLNCTTNHPINPK (15aa)
- IKTPEKNDTAAAGQGER (17aa)
- QMVENFSPNQTK (12aa)
- FINYNQTVSR (10aa)
- DVDECAIGTHNCSEAETCHNIQGSFR (26aa)
- SEIIYGNETELQIPSFNEMVYPSESTVMPNMYDNVNK (37aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- NFTTAP (6aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- VLLHHLDVKTNGTGPVR (17aa)
- IGIVNNT (7aa)
- SGGNATLQVDSWPVIER (17aa)
- KYEQAKNISQDLEK (14aa)
- RVNDNKTAAEEALR (14aa)
- NTTCQDLQIEVTVK (14aa)
- VSNQTLSLFFTVLQDVPVR (19aa)
- IASAVQKNATSTK (13aa)
- AQAALDKANASR (12aa)
- NLQVYNATSNSLTVK (15aa)
- GCKDNATDSVPLR (13aa)
- RGCKDNATDSVPLR (14aa)
- EAGNITTDGYEIIGK (15aa)
- MHLNGSNVQVLHR (13aa)
- RMHLNGSNVQVLHR (14aa)
- LAPVNGTSQGK (11aa)
- SLTQGSLIVGDLAPVNGTSQGK (22aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Venom (UBERON_0007113)
-
L-amino acid oxidase / Calloselasma rhodostoma
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- HEK293 (CVCL_0045)
- Asymptomatic myositis (DOID:633)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- EEQFNSTFR (9aa)
- EEQYNSTYR (9aa)
- EEQYNSTYR (10aa)
- THTNISE (7aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Venom (UBERON_0007113)
-
Ancrod / Calloselasma rhodostoma
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Venom (UBERON_0007113)
-
Ancrod / Calloselasma rhodostoma
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Liver (UBERON_0002107)
- Seminal Fluid (UBERON_0006530)
- Thyroid (UBERON_0002046)
- HEK293 (CVCL_0045)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Three-dimensional elution mapping of pyridylaminated N-linked neutral and sialyl oligosaccharides. (1995 - Takahashi N, Nakagawa H, Fujikawa K, Kawamura Y, Tomiya N) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Structure determination by 1H NMR spectroscopy of (sulfated) sialylated N-linked carbohydrate chains released from porcine thyroglobulin by peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase-F. (1991 - de Waard P, Koorevaar A, Kamerling J, Vliegenthart J) / Status : Reviewed
- Alpha-fetoprotein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Thyroglobulin / Sus scrofa
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Alpha-fetoprotein / Homo sapiens
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Kidney (UBERON_0002113)
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Erythropoietin / Homo sapiens
- EAENITTGC (9aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Milk (UBERON_0001913)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Alpha-S1-casein / Homo sapiens
- Angiopoietin-related protein 4 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- RNESTQNCVVAEPEKM (16aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- KTKPREEQFNSTFRV (15aa)
- KRLPEMAQPVDPAHNVSRL (19aa)
- KTKPREEQYNSTYRV (15aa)
- KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- FPNIT (5aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- GEVFNATR (8aa)
- KVPGNVTAVLGETLKV (16aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Brain (UBERON_0000955)
- Scrapie (DOID:5434)
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Blood Serum (UBERON_0001977)
- Control/Healthy
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Blood Serum (UBERON_0001977)
- Control/Healthy
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Ascitic fluid (UBERON_0007795)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Bone Marrow (UBERON_0002371)
- Control/Healthy
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Blood Plasma (UBERON_0001969)
- Multiple myeloma (DOID:9538)
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Blood Plasma (UBERON_0001969)
- Multiple myeloma (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Blood Plasma (UBERON_0001969)
- Control/Healthy
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Seminal Fluid (UBERON_0006530)
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- CD16A-NK09-V/F genotype / Homo sapiens
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
- TVNITITQG (9aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Colon (UBERON_0001155)
-
- O-Linked / Core 2
(avg mass : 1916.7658)
- Neutrophil (CL_0000775)
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1916.7658)
- Granulocyte (CL_0000094)
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1916.7658)
- C10 (CVCL_5245)
- Colon adenocarcinoma (DOID:234)
-
- O-Linked / Core 2
(avg mass : 1916.7658)
- C10 (CVCL_5245)
- Colon adenocarcinoma (DOID:234)
-
- O-Linked / Core 2
(avg mass : 1916.7658)
- LS174T (CVCL_1384)
- T84 (CVCL_0555)
- Colon adenocarcinoma (DOID:234)
-
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 / N-Linked
(avg mass : 1916.7658)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- N-Linked / Complex / Structure 908
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / Structure 9317
- N-Linked / Complex / Structure 9469
- N-Linked / Complex / Structure 9879
- N-Linked / Complex / Structure 9932
- N-Linked / Complex / Structure 10022
- N-Linked / Complex / Structure 10250
- N-Linked / Complex / Structure 10302
- N-Linked / Complex / Structure 10404
- N-Linked / Complex / Structure 10643
- N-Linked / Complex / Structure 10764
- N-Linked / Complex / Structure 10778
- N-Linked / Complex / Structure 10914
- N-Linked / Complex / Structure 10917
- N-Linked / Complex / Structure 10943
- N-Linked / Complex / Structure 10954
- N-Linked / Complex / Structure 10983
- N-Linked / Complex / Structure 11183
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Asporin / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor XII / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-1(XIV) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Contactin-4 / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Decorin / Homo sapiens
- Desmocollin-2 / Homo sapiens
- ER membrane protein complex subunit 1 / Homo sapiens
- Fibrinogen beta chain / Homo sapiens
- Fibronectin / Homo sapiens
- Fibulin-2 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Hemopexin / Homo sapiens
- HLA class I histocompatibility antigen, A-23 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-24 alpha chain / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integrin alpha-5 / Homo sapiens
- Junctional adhesion molecule A / Homo sapiens
- Lactotransferrin / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Nidogen-2 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Phospholipase B-like 1 / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin F2 receptor negative regulator / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Receptor-type tyrosine-protein phosphatase zeta / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Serpin h1 / Homo sapiens
- Sortilin / Homo sapiens
- Stanniocalcin-2 / Homo sapiens
- SUN domain-containing protein 1 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Attractin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Contactin-1 / Mus musculus
- Endoplasmin / Mus musculus
- Glutamate receptor ionotropic, delta-2 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Hyaluronan and proteoglycan link protein 1 / Mus musculus
- Integrin alpha-V / Mus musculus
- Integrin beta-1 / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Limbic system-associated membrane protein / Mus musculus
- Neural cell adhesion molecule 1 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurexin-1 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
- Synaptophysin-like protein 1 / Mus musculus
- Tetraspanin-2 / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- ASSNPNATSSSSQDPESLQDRGEGK (25aa)
- YVNMSNHHR (9aa)
- TAVNCSSDFDACLITK (16aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- FVGTPEVNQTTIYQR (15aa)
- YETTNK (6aa)
- GGNVTLPCK (9aa)
- LNGTDVDTGMDFR (13aa)
- LEPNSVDPENITEILIANQK (20aa)
- AIGFENATQAIGR (13aa)
- VGVNKNQTVTATFGYPFR (18aa)
- LSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIR (35aa)
- HAIHVSGTNGTKRF (14aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- DNATEEEILVYLEK (14aa)
- ENTSDPSIVIAFGR (14aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- TVNVSVPK (8aa)
- AIIQGLMPDQNYTVQIIAYNK (21aa)
- TFYWDFYTNR (10aa)
- YYNQSEAGSHTIQMMFGCDVGSDGR (25aa)
- SISNSTAR (8aa)
- TQSLLIVNNATNVVIK (16aa)
- AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
- SIDSVSFSYNTGDNTTFPDAEDK (23aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- GLSFDVSLEVSQGPGLLNDTK (21aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- YHKNNKSWMESEF (13aa)
- VCQDCPIIAPINDTR (15aa)
- AGPNGTIFVADAYK (14aa)
- VYKPSAGNNSLYR (13aa)
- DITDLINNTFIR (12aa)
- TKPREEQFNSTFR (13aa)
- EEQFNSTF (8aa)
- AALAAFNAQNNGSNFQLEEISR (22aa)
- EEQFNSTFR (9aa)
- EEQFNSTYR (9aa)
- EEQYNSTYR (9aa)
- TNPCLHGGR (9aa)
- RAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEAR (35aa)
- SWPAVGNCSSAIR (13aa)
- DGKPLLNDSR (10aa)
- VNTLEEGKGGPKNDTEER (18aa)
- LAAPNLTVEEGK (12aa)
- TPLTANITK (9aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- TNSTFVQALVEHVK (14aa)
- HNNDTQHIWESDSNEFSVIADPR (23aa)
- FINDSIVDPVDSEWFGFYR (19aa)
- GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
- FHLANR (6aa)
- KDNTTVTR (8aa)
- GLSFNSISAVDNGSLANTPHLR (22aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- SISAVDNGSLANTPHLR (17aa)
- GTEVNTTVIGENDPIDEVQGFIFGK (25aa)
- MIENGSISFIPTIR (14aa)
- YIGNATAIFFIPDEGK (16aa)
- ITDIENGSIANIPR (14aa)
- NVSVAEGK (8aa)
- VIYQNHNK (8aa)
- LGVTNASLVLFRPGSVR (17aa)
- FFHVNGSAFLPR (12aa)
- IIQVVYIHSNNITK (14aa)
- LQVVYLHSNNITK (13aa)
- RFPNIT (6aa)
- IIDNNKTEK (9aa)
- GEVFNATRF (9aa)
- NATRF (5aa)
- NISSEEK (7aa)
- IANITQGEDQYYIR (14aa)
- QSTINTVDIYPMMCHILGLKPHPNNGTLSHTK (32aa)
- ANYTILK (7aa)
- GTAGNAIMDGASQIMGENR (19aa)
- IYNWSGYPIIVQK (13aa)
- LSLLEEPGNGTFTVILNQLTSR (22aa)
- NYTDCTSEGR (10aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
- CGIVPVIAENYNK (13aa)
- IISENKTDEEPGYIKK (16aa)
- LLLPAKNTTHLK (12aa)
- EKLLLPAKNTTHLK (14aa)
- AIPQPQNVTSIIGCTH (16aa)
- VPGNVTAVIGETIK (14aa)
- GKANSTGTLVITNPTR (16aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- SDVPNTSPNSTSQHVAEFETER (22aa)
- DQCIVDDITYNVNDTFHK (18aa)
- YLHTAVIVSGTMLVFGGNTHNDTSMSHGAK (30aa)
- YTCTAQTIVDNSSASADLVVR (21aa)
- EVNDTLLVNELK (12aa)
- FSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASASAVLR (39aa)
- LYQDVNCT (8aa)
- TEGENCTVFDSQAGFSFDLSPLTK (24aa)
- QQQHLFGSNVTDCSGNFCLFR (21aa)
- KDTCAQECSHFNLTK (15aa)
- MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
- IHQNITYQVCR (11aa)
- SNGSENNVLESQAGIQK (17aa)
- NFTIS (5aa)
- TISPTGNISSAPK (13aa)
- VSWKPQGAPEEWEEEIVTNHTLR (23aa)
- NMTLFSDLVAEK (12aa)
- NFSQILPDPSKPS (13aa)
- FGGFNFS (7aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- NFNFSQILPDPSKPSKR (17aa)
- NFSQILPDPSKPSK (14aa)
- VTGLNCTTNHPINPK (15aa)
- IKTPEKNDTAAAGQGER (17aa)
- QMVENFSPNQTK (12aa)
- FINYNQTVSR (10aa)
- DVDECAIGTHNCSEAETCHNIQGSFR (26aa)
- SEIIYGNETELQIPSFNEMVYPSESTVMPNMYDNVNK (37aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- NFTTAP (6aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- VLLHHLDVKTNGTGPVR (17aa)
- IGIVNNT (7aa)
- SGGNATLQVDSWPVIER (17aa)
- KYEQAKNISQDLEK (14aa)
- RVNDNKTAAEEALR (14aa)
- NTTCQDLQIEVTVK (14aa)
- VSNQTLSLFFTVLQDVPVR (19aa)
- IASAVQKNATSTK (13aa)
- AQAALDKANASR (12aa)
- NLQVYNATSNSLTVK (15aa)
- GCKDNATDSVPLR (13aa)
- RGCKDNATDSVPLR (14aa)
- EAGNITTDGYEIIGK (15aa)
- MHLNGSNVQVLHR (13aa)
- RMHLNGSNVQVLHR (14aa)
- LAPVNGTSQGK (11aa)
- SLTQGSLIVGDLAPVNGTSQGK (22aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 / N-Linked
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1916.7658)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1916.7658)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1916.7658)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)