taxonomy (19)
protein (35)
source (19)
structure (19)
composition (1)
disease (5)
reference (45)
site (37)
peptide (8)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Ambystoma maculatum (Spotted salamander)
- Ambystoma mexicanum (Axolotl)
- Bufo arenarum
- Bufo bufo (European toad)
- Bufo japonicus (Japanese toad)
- Rana arvalis (Moor frog)
- Rana clamitans (Green frog)
- Rana palustris
- Rana temporaria (Common frog)
- Rana utricularia
- Xenopus laevis (African clawed frog)
- Xenopus tropicalis (Western clawed frog)
- Androctonus australis hector (Sahara scorpion)
- Apis mellifera (Honeybee)
Taxonomy
- Glycoprotein ln / Homo sapiens
- Glycoprotein rg / Homo sapiens
- Kappa casein / Homo sapiens P07498
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prosaposin / Homo sapiens P07602
- Protein AMBP / Homo sapiens P02760
- Uncharacterized protein from Seminal Fluid / Homo sapiens
- Unspecified mucin / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Mucin / Bos taurus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus Q9EQG7
- Muc2 / Mus musculus
- Neuronal acetylcholine receptor subunit beta-4 / Mus musculus Q8R493
- Phospholipase D3 / Mus musculus O35405
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus Q9Z1L5
- Mucin / Rattus norvegicus
- Mucin-2 glycopeptide a / Rattus norvegicus Q62635
- Mucin-2 glycopeptide b / Rattus norvegicus Q62635
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Mucin / Sus scrofa
- Mucin / Ambystoma maculatum
- Mucin / Ambystoma mexicanum
- Mucin / Bufo arenarum
- Mucin / Bufo bufo
- Uncharacterized protein / Bufo japonicus
- Mucin / Rana arvalis
- Mucin / Rana clamitans
- Mucin / Rana palustris
- Mucin / Rana temporaria
- Mucin / Rana utricularia
- Mucin / Xenopus laevis
- Mucin / Xenopus tropicalis
- Toxin Aah6 / Androctonus australis hector P56743
- Hyaluronoglucosaminidase / Apis mellifera Q08169
Protein
- Brain (UBERON_0000955)
- Duodenal Gland (UBERON_0001212)
- Intestinal Mucosa
- Kidney (UBERON_0002113)
- Large Intestine (UBERON_0000059)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Seminal Fluid (UBERON_0006530)
- Small Intestine (UBERON_0002108)
- Submandibular Gland (UBERON_0001736)
- Tracheal Mucosa (UBERON_0000379)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Egg Cell Jelly Coat
Source
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- O-Linked / Core 1 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)GalNAc
- O-Linked / Core 14 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-?)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 3 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)GalNAc
- O-Linked / Core 3 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)GalNAc
- O-Linked / Core 3 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)GalNAc
- O-Linked / Core 6 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)GalNAc
- O-Linked / No-core / GlcNAc(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal
- O-Linked / Undefined core / Fuc(?1-2)[GalNAc(?1-3)]Gal(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)[GlcNAc(?1-6)]GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)GlcNAc(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-4)GlcNAc(?1-3)GalNAc
Reported structure
- Hex:1 HexNAc:2 dHex:1 (avg mass : 732.6907 )
Composition
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, Ovarian (Cystic) (DOID:2394)
- Cystic Fibrosis (DOID:1485)
- Gangliosidosis GM1 (DOID:3322)
- Prostate cancer (DOID:10283)
Disease
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- Species specificity of O-linked carbohydrate chains of the oviducal mucins in amphibians: structural analysis of neutral oligosaccharide alditols released by reductive beta-elimination from the egg-jelly coats of Rana clamitans. (2002 - Delplace F, Maes E, Lemoine J, Strecker G) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
- Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
- Structural analysis of 13 neutral oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana temporaria (1999 - Coppin, Maes, Morelle, Strecker) / Status : Reviewed
- Acquisition of species-specific O-linked carbohydrate chains from oviducal mucins in Rana arvalis. A case study (1999 - Coppin, Maes, Flahaut, Coddeville, Strecker) / Status : Reviewed
- Structural analysis of a new series of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana utricularia. (1998 - Morelle W, Strecker G) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
- Structure of the major neutral oligosaccharide-alditols released from the egg jelly coats of Axolotl maculatum. Characterization of the carbohydrate sequence GalNAc(beta 1-4)[Fuc(alpha 1-3)] GlcNAc(beta 1-3/6). (1994 - Strecker G, Wieruszeski J, Fontaine M, Plancke Y) / Status : Reviewed
- Isolation, structural determination, and calcium-binding properties of the major glycoprotein present in Bufo japonicus japonicus egg jelly. (1994 - Shimoda Y, Kitajima K, Inoue S, Inoue Y) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Primary structure of neutral and acidic oligosaccharide-alditols derived from the jelly coat of the Mexican axolotl. Occurence of oliogsaccharides with fucosyl(alpha 1-3)fucosyl(alpha 1-4)-3-deoxy-D-glycero-D-galacto-nonulosonic acid and galactosyl(alpha 1-4)[fucosyl(alpha 1-2)]galactosyl(beta 1-4)- (1992 - Strecker G, Wieruszeski J, Michalski J, Alonso C, Leroy Y, Boilly B, Montreuil J) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Chemical structure of neutral sugar chains isolated from human mature milk kappa-casein. (1988 - Saito T, Itoh T, Adachi S) / Status : Reviewed
- The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
- Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
- Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
- Structure determination of oligosaccharides isolated from A+, H+ and A-H- hog-submaxillary-gland mucin glycoproteins, by 360-MHz 1H-NMR spectroscopy, permethylation analysis and mass spectrometry. (1981 - van Halbeek H, Dorland L, Haverkamp J, Veldink G, Vliegenthart J, Fournet B, Ricart G, Montreuil J, Gathmann W, Aminoff D) / Status : Reviewed
- Glycoproteins and blood group activity. Oligosaccharides of A+ hog submaxillary glycoproteins. (1979 - Aminoff D, Baig MM, Gathmann WD) / Status : Reviewed
- Structure of some oligosaccharides derived from rat-intestinal glycoproteins. (1978 - Carlsson H, Sundblad G, Hammarstrm S, Lnngren J) / Status : Reviewed
- Structures and immunochemical properties of oligosaccharides isolated from pig submaxillary mucins. (1968 - Carlson D) / Status : Reviewed
- Physical and chemical studies on glycoproteins. II. Isolation and characterization of oligosaccharides from porcine submaxillary glycoproteins. (1968 - Katzman RL, Eylar EH) / Status : Reviewed
Reference
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Kappa casein / Homo sapiens
- Undefined site
- Polymeric immunoglobulin receptor / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Protein AMBP / Homo sapiens
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
-
Mucin / Bos taurus
- Undefined site
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
-
Muc2 / Mus musculus
- Undefined site
- Neuronal acetylcholine receptor subunit beta-4 / Mus musculus
- Phospholipase D3 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Mucin / Ambystoma maculatum
- Undefined site
-
Mucin / Ambystoma mexicanum
- Undefined site
-
Mucin / Bufo arenarum
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Uncharacterized protein / Bufo japonicus
- Undefined site
-
Mucin / Rana arvalis
- Undefined site
-
Mucin / Rana clamitans
- Undefined site
-
Mucin / Rana palustris
- Undefined site
-
Mucin / Rana temporaria
- Undefined site
-
Mucin / Rana utricularia
- Undefined site
-
Mucin / Xenopus laevis
- Undefined site
-
Mucin / Xenopus tropicalis
- Undefined site
- Toxin Aah6 / Androctonus australis hector
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
Reported glycosite
-
- N-Linked / No-core
(avg mass : 732.6907)
- Venom (UBERON_0007113)
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
-
- N-Linked / No-core
(avg mass : 732.6907)
- Gangliosidosis GM1 (DOID:3322)
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
- N-Linked / No-core
(avg mass : 732.6907)
- Venom (UBERON_0007113)
- Toxin Aah6 / Androctonus australis hector
-
- O-Linked / Core 1
(avg mass : 732.6907)
- Intestinal Mucosa
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Submandibular Gland (UBERON_0001736)
- Egg Cell Jelly Coat
- Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
- Structural analysis of a new series of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana utricularia. (1998 - Morelle W, Strecker G) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
- Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
- Structure determination of oligosaccharides isolated from A+, H+ and A-H- hog-submaxillary-gland mucin glycoproteins, by 360-MHz 1H-NMR spectroscopy, permethylation analysis and mass spectrometry. (1981 - van Halbeek H, Dorland L, Haverkamp J, Veldink G, Vliegenthart J, Fournet B, Ricart G, Montreuil J, Gathmann W, Aminoff D) / Status : Reviewed
- Glycoproteins and blood group activity. Oligosaccharides of A+ hog submaxillary glycoproteins. (1979 - Aminoff D, Baig MM, Gathmann WD) / Status : Reviewed
- Structure of some oligosaccharides derived from rat-intestinal glycoproteins. (1978 - Carlsson H, Sundblad G, Hammarstrm S, Lnngren J) / Status : Reviewed
- Structures and immunochemical properties of oligosaccharides isolated from pig submaxillary mucins. (1968 - Carlson D) / Status : Reviewed
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Mucin / Bufo arenarum
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Rana utricularia
- Undefined site
-
Mucin / Xenopus tropicalis
- Undefined site
-
- O-Linked / Core 1
(avg mass : 732.6907)
- Egg Cell Jelly Coat
-
Mucin / Xenopus tropicalis
- Undefined site
-
- O-Linked / Core 14
(avg mass : 732.6907)
-
Mucin / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 732.6907)
- Duodenal Gland (UBERON_0001212)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Submandibular Gland (UBERON_0001736)
- Tracheal Mucosa (UBERON_0000379)
- Egg Cell Jelly Coat
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, Ovarian (Cystic) (DOID:2394)
- Cystic Fibrosis (DOID:1485)
- Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Acquisition of species-specific O-linked carbohydrate chains from oviducal mucins in Rana arvalis. A case study (1999 - Coppin, Maes, Flahaut, Coddeville, Strecker) / Status : Reviewed
- Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
- Structural analysis of 13 neutral oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana temporaria (1999 - Coppin, Maes, Morelle, Strecker) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
- Isolation, structural determination, and calcium-binding properties of the major glycoprotein present in Bufo japonicus japonicus egg jelly. (1994 - Shimoda Y, Kitajima K, Inoue S, Inoue Y) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Muc2 / Mus musculus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Mucin / Bufo arenarum
- Undefined site
-
Uncharacterized protein / Bufo japonicus
- Undefined site
-
Mucin / Rana arvalis
- Undefined site
-
Mucin / Rana palustris
- Undefined site
-
Mucin / Rana temporaria
- Undefined site
-
Mucin / Xenopus laevis
- Undefined site
-
Mucin / Xenopus tropicalis
- Undefined site
-
- O-Linked / Core 2
(avg mass : 732.6907)
- Egg Cell Jelly Coat
-
Mucin / Rana clamitans
- Undefined site
-
- O-Linked / Core 2
(avg mass : 732.6907)
- Milk (UBERON_0001913)
-
Kappa casein / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 732.6907)
- Pulmonary Mucosa
- Cystic Fibrosis (DOID:1485)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 3
(avg mass : 732.6907)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, Ovarian (Cystic) (DOID:2394)
- Cystic Fibrosis (DOID:1485)
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 3
(avg mass : 732.6907)
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Primary structure of neutral and acidic oligosaccharide-alditols derived from the jelly coat of the Mexican axolotl. Occurence of oliogsaccharides with fucosyl(alpha 1-3)fucosyl(alpha 1-4)-3-deoxy-D-glycero-D-galacto-nonulosonic acid and galactosyl(alpha 1-4)[fucosyl(alpha 1-2)]galactosyl(beta 1-4)- (1992 - Strecker G, Wieruszeski J, Michalski J, Alonso C, Leroy Y, Boilly B, Montreuil J) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Mucin / Ambystoma mexicanum
- Undefined site
-
- O-Linked / Core 3
(avg mass : 732.6907)
- Saliva (UBERON_0001836)
- Egg Cell Jelly Coat
- Structure of the major neutral oligosaccharide-alditols released from the egg jelly coats of Axolotl maculatum. Characterization of the carbohydrate sequence GalNAc(beta 1-4)[Fuc(alpha 1-3)] GlcNAc(beta 1-3/6). (1994 - Strecker G, Wieruszeski J, Fontaine M, Plancke Y) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Ambystoma maculatum
- Undefined site
-
- O-Linked / Core 6
(avg mass : 732.6907)
- Seminal Fluid (UBERON_0006530)
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
- O-Linked / No-core
(avg mass : 732.6907)
- Egg Cell Jelly Coat
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
-
Mucin / Xenopus laevis
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 732.6907)
- Large Intestine (UBERON_0000059)
- Small Intestine (UBERON_0002108)
- Submandibular Gland (UBERON_0001736)
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
-
Mucin / Bos taurus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 732.6907)
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 732.6907)
- Small Intestine (UBERON_0002108)
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 732.6907)
- Small Intestine (UBERON_0002108)
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- Hex:1 HexNAc:2 dHex:1 / N-Linked
(avg mass : 732.6907)
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- Prostate cancer (DOID:10283)
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Protein AMBP / Homo sapiens
- Uromodulin / Homo sapiens
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Neuronal acetylcholine receptor subunit beta-4 / Mus musculus
- Phospholipase D3 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
- HFPFDQQNCTLK (12aa)
- EFILAPNDHFNNLPVNISLSDVQVPTNMYNK (31aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- KNFTK (5aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- RGCKDNATDSVPLR (14aa)
-
- Hex:1 HexNAc:2 dHex:1 / O-Linked
(avg mass : 732.6907)
- Urine (UBERON_0001088)
- O-Linked / Core 1 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)GalNAc
- O-Linked / Core 14 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-?)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 3 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)GalNAc
- O-Linked / Core 3 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)GalNAc
- O-Linked / Core 3 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)GalNAc
- O-Linked / Core 6 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)GalNAc
- O-Linked / No-core / GlcNAc(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal
- O-Linked / Undefined core / Fuc(?1-2)[GalNAc(?1-3)]Gal(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)[GlcNAc(?1-6)]GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)GlcNAc(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-4)GlcNAc(?1-3)GalNAc
- Prostate cancer (DOID:10283)
- Polymeric immunoglobulin receptor / Homo sapiens
- Protein AMBP / Homo sapiens
- Uromodulin / Homo sapiens
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- ASVDSGSSEEQGGSSR (16aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:1 HexNAc:2 dHex:1 / O-Linked
(avg mass : 732.6907)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:1 HexNAc:2 dHex:1 / N-Linked
(avg mass : 732.6907)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 732.6907)
Source
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 732.6907)
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 732.6907)
Source
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 732.6907)
Source
Reference
Reported glycosite
- O-Linked / No-core
(avg mass : 732.6907)
Source
Reported glycosite
- O-Linked / Core 6
(avg mass : 732.6907)
Source
Reference
Reported glycosite
- O-Linked / Core 3
(avg mass : 732.6907)
Reference
Reported glycosite
- O-Linked / Core 3
(avg mass : 732.6907)
Disease
Reference
Reported glycosite
- O-Linked / Core 3
(avg mass : 732.6907)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 732.6907)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 732.6907)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 732.6907)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 732.6907)
Reported glycosite
- O-Linked / Core 14
(avg mass : 732.6907)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 732.6907)
Source
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 732.6907)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 732.6907)
Disease
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 732.6907)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 732.6907)