GlyConnect

Export CSV

taxonomy (19) protein (35) source (19) structure (19) composition (1) disease (5) reference (45) site (37) peptide (8)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:1 HexNAc:2 dHex:1 (avg mass : 732.6907 )

Disease

Reference

Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
Species specificity of O-linked carbohydrate chains of the oviducal mucins in amphibians: structural analysis of neutral oligosaccharide alditols released by reductive beta-elimination from the egg-jelly coats of Rana clamitans. (2002 - Delplace F, Maes E, Lemoine J, Strecker G) / Status : Reviewed
N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
Structural analysis of 13 neutral oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana temporaria (1999 - Coppin, Maes, Morelle, Strecker) / Status : Reviewed
Acquisition of species-specific O-linked carbohydrate chains from oviducal mucins in Rana arvalis. A case study (1999 - Coppin, Maes, Flahaut, Coddeville, Strecker) / Status : Reviewed
Structural analysis of a new series of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana utricularia. (1998 - Morelle W, Strecker G) / Status : Reviewed
Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
Structure of the major neutral oligosaccharide-alditols released from the egg jelly coats of Axolotl maculatum. Characterization of the carbohydrate sequence GalNAc(beta 1-4)[Fuc(alpha 1-3)] GlcNAc(beta 1-3/6). (1994 - Strecker G, Wieruszeski J, Fontaine M, Plancke Y) / Status : Reviewed
Isolation, structural determination, and calcium-binding properties of the major glycoprotein present in Bufo japonicus japonicus egg jelly. (1994 - Shimoda Y, Kitajima K, Inoue S, Inoue Y) / Status : Reviewed
Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
Primary structure of neutral and acidic oligosaccharide-alditols derived from the jelly coat of the Mexican axolotl. Occurence of oliogsaccharides with fucosyl(alpha 1-3)fucosyl(alpha 1-4)-3-deoxy-D-glycero-D-galacto-nonulosonic acid and galactosyl(alpha 1-4)[fucosyl(alpha 1-2)]galactosyl(beta 1-4)- (1992 - Strecker G, Wieruszeski J, Michalski J, Alonso C, Leroy Y, Boilly B, Montreuil J) / Status : Reviewed
Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
Chemical structure of neutral sugar chains isolated from human mature milk kappa-casein. (1988 - Saito T, Itoh T, Adachi S) / Status : Reviewed
The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
Structure determination of oligosaccharides isolated from A+, H+ and A-H- hog-submaxillary-gland mucin glycoproteins, by 360-MHz 1H-NMR spectroscopy, permethylation analysis and mass spectrometry. (1981 - van Halbeek H, Dorland L, Haverkamp J, Veldink G, Vliegenthart J, Fournet B, Ricart G, Montreuil J, Gathmann W, Aminoff D) / Status : Reviewed
Glycoproteins and blood group activity. Oligosaccharides of A+ hog submaxillary glycoproteins. (1979 - Aminoff D, Baig MM, Gathmann WD) / Status : Reviewed
Structure of some oligosaccharides derived from rat-intestinal glycoproteins. (1978 - Carlsson H, Sundblad G, Hammarstrm S, Lnngren J) / Status : Reviewed
Structures and immunochemical properties of oligosaccharides isolated from pig submaxillary mucins. (1968 - Carlson D) / Status : Reviewed
Physical and chemical studies on glycoproteins. II. Isolation and characterization of oligosaccharides from porcine submaxillary glycoproteins. (1968 - Katzman RL, Eylar EH) / Status : Reviewed

Reported glycosite

Glycoprotein ln / Homo sapiens
- Undefined site
Glycoprotein rg / Homo sapiens
- Undefined site
Kappa casein / Homo sapiens
- Undefined site
Polymeric immunoglobulin receptor / Homo sapiens
- Ser-624
Prosaposin / Homo sapiens
- Undefined site
Protein AMBP / Homo sapiens
- Asn-250
- Thr-252
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
Unspecified mucin / Homo sapiens
- Undefined site
Uromodulin / Homo sapiens
- Asn-275
- Ser-292
Mucin / Bos taurus
- Undefined site
Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Asn-362
Muc2 / Mus musculus
- Undefined site
Neuronal acetylcholine receptor subunit beta-4 / Mus musculus
- Asn-165
Phospholipase D3 / Mus musculus
- Asn-385
Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Asn-2128
Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
- Asn-166
Mucin / Rattus norvegicus
- Undefined site
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
Mucin / Sus scrofa
- Undefined site
Mucin / Ambystoma maculatum
- Undefined site
Mucin / Ambystoma mexicanum
- Undefined site
Mucin / Bufo arenarum
- Undefined site
Mucin / Bufo bufo
- Undefined site
Uncharacterized protein / Bufo japonicus
- Undefined site
Mucin / Rana arvalis
- Undefined site
Mucin / Rana clamitans
- Undefined site
Mucin / Rana palustris
- Undefined site
Mucin / Rana temporaria
- Undefined site
Mucin / Rana utricularia
- Undefined site
Mucin / Xenopus laevis
- Undefined site
Mucin / Xenopus tropicalis
- Undefined site
Toxin Aah6 / Androctonus australis hector
- Asn-9
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site

Mass spectrometry observed peptide

HFPFDQQNCTLK (12aa)
- Q8R493 Asn-165 Neuronal acetylcholine receptor subunit beta-4 / Mus musculus
EFILAPNDHFNNLPVNISLSDVQVPTNMYNK (31aa)
- Q9Z1L5 Asn-166 Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- P02760 Asn-250 Protein AMBP / Homo sapiens
- P02760 Thr-252 Protein AMBP / Homo sapiens
ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- P07911 Ser-292 Uromodulin / Homo sapiens
- P07911 Asn-275 Uromodulin / Homo sapiens
KNFTK (5aa)
- Q9EQG7 Asn-362 Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
SFLLSLAALHDNHTHSDIQVK (21aa)
- O35405 Asn-385 Phospholipase D3 / Mus musculus
ASVDSGSSEEQGGSSR (16aa)
- P01833 Ser-624 Polymeric immunoglobulin receptor / Homo sapiens
RGCKDNATDSVPLR (14aa)
- Q91ZX7 Asn-2128 Prolow-density lipoprotein receptor-related protein 1 / Mus musculus

- N-Linked / No-core (avg mass : 732.6907)
- N-Linked / No-core (avg mass : 732.6907)
- N-Linked / No-core (avg mass : 732.6907)
- O-Linked / Core 1 (avg mass : 732.6907)
- O-Linked / Core 1 (avg mass : 732.6907)
- O-Linked / Core 14 (avg mass : 732.6907)
- O-Linked / Core 2 (avg mass : 732.6907)
- O-Linked / Core 2 (avg mass : 732.6907)
- O-Linked / Core 2 (avg mass : 732.6907)
- O-Linked / Core 2 (avg mass : 732.6907)
- O-Linked / Core 3 (avg mass : 732.6907)
- O-Linked / Core 3 (avg mass : 732.6907)
- O-Linked / Core 3 (avg mass : 732.6907)
- O-Linked / Core 6 (avg mass : 732.6907)
- O-Linked / No-core (avg mass : 732.6907)
- O-Linked / Undefined core (avg mass : 732.6907)
- O-Linked / Undefined core (avg mass : 732.6907)
- O-Linked / Undefined core (avg mass : 732.6907)
- O-Linked / Undefined core (avg mass : 732.6907)

- Hex:1 HexNAc:2 dHex:1 / N-Linked (avg mass : 732.6907)
- Hex:1 HexNAc:2 dHex:1 / O-Linked (avg mass : 732.6907)