GlyConnect

Export CSV

taxonomy (19) protein (36) source (20) structure (19) composition (1) disease (6) reference (46) site (38) peptide (8)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:1 HexNAc:2 dHex:1 (avg mass : 732.6907 )

Disease

Reference

Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
Species specificity of O-linked carbohydrate chains of the oviducal mucins in amphibians: structural analysis of neutral oligosaccharide alditols released by reductive beta-elimination from the egg-jelly coats of Rana clamitans. (2002 - Delplace F, Maes E, Lemoine J, Strecker G) / Status : Reviewed
N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
Structural analysis of 13 neutral oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana temporaria (1999 - Coppin, Maes, Morelle, Strecker) / Status : Reviewed
Acquisition of species-specific O-linked carbohydrate chains from oviducal mucins in Rana arvalis. A case study (1999 - Coppin, Maes, Flahaut, Coddeville, Strecker) / Status : Reviewed
Structural analysis of a new series of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana utricularia. (1998 - Morelle W, Strecker G) / Status : Reviewed
Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
Structure of the major neutral oligosaccharide-alditols released from the egg jelly coats of Axolotl maculatum. Characterization of the carbohydrate sequence GalNAc(beta 1-4)[Fuc(alpha 1-3)] GlcNAc(beta 1-3/6). (1994 - Strecker G, Wieruszeski J, Fontaine M, Plancke Y) / Status : Reviewed
Isolation, structural determination, and calcium-binding properties of the major glycoprotein present in Bufo japonicus japonicus egg jelly. (1994 - Shimoda Y, Kitajima K, Inoue S, Inoue Y) / Status : Reviewed
Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
Primary structure of neutral and acidic oligosaccharide-alditols derived from the jelly coat of the Mexican axolotl. Occurence of oliogsaccharides with fucosyl(alpha 1-3)fucosyl(alpha 1-4)-3-deoxy-D-glycero-D-galacto-nonulosonic acid and galactosyl(alpha 1-4)[fucosyl(alpha 1-2)]galactosyl(beta 1-4)- (1992 - Strecker G, Wieruszeski J, Michalski J, Alonso C, Leroy Y, Boilly B, Montreuil J) / Status : Reviewed
Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
Chemical structure of neutral sugar chains isolated from human mature milk kappa-casein. (1988 - Saito T, Itoh T, Adachi S) / Status : Reviewed
The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
Structure determination of oligosaccharides isolated from A+, H+ and A-H- hog-submaxillary-gland mucin glycoproteins, by 360-MHz 1H-NMR spectroscopy, permethylation analysis and mass spectrometry. (1981 - van Halbeek H, Dorland L, Haverkamp J, Veldink G, Vliegenthart J, Fournet B, Ricart G, Montreuil J, Gathmann W, Aminoff D) / Status : Reviewed
Glycoproteins and blood group activity. Oligosaccharides of A+ hog submaxillary glycoproteins. (1979 - Aminoff D, Baig MM, Gathmann WD) / Status : Reviewed
Structure of some oligosaccharides derived from rat-intestinal glycoproteins. (1978 - Carlsson H, Sundblad G, Hammarstrm S, Lnngren J) / Status : Reviewed
Structures and immunochemical properties of oligosaccharides isolated from pig submaxillary mucins. (1968 - Carlson D) / Status : Reviewed
Physical and chemical studies on glycoproteins. II. Isolation and characterization of oligosaccharides from porcine submaxillary glycoproteins. (1968 - Katzman RL, Eylar EH) / Status : Reviewed

Reported glycosite

Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
Glycoprotein ln / Homo sapiens
- Undefined site
Glycoprotein rg / Homo sapiens
- Undefined site
Kappa casein / Homo sapiens
- Undefined site
Polymeric immunoglobulin receptor / Homo sapiens
- Ser-624
Prosaposin / Homo sapiens
- Undefined site
Protein AMBP / Homo sapiens
- Asn-250
- Thr-252
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
Unspecified mucin / Homo sapiens
- Undefined site
Uromodulin / Homo sapiens
- Asn-275
- Ser-292
Mucin / Bos taurus
- Undefined site
Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Asn-362
Muc2 / Mus musculus
- Undefined site
Neuronal acetylcholine receptor subunit beta-4 / Mus musculus
- Asn-165
Phospholipase D3 / Mus musculus
- Asn-385
Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Asn-2128
Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
- Asn-166
Mucin / Rattus norvegicus
- Undefined site
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
Mucin / Sus scrofa
- Undefined site
Mucin / Ambystoma maculatum
- Undefined site
Mucin / Ambystoma mexicanum
- Undefined site
Mucin / Bufo arenarum
- Undefined site
Mucin / Bufo bufo
- Undefined site
Uncharacterized protein / Bufo japonicus
- Undefined site
Mucin / Rana arvalis
- Undefined site
Mucin / Rana clamitans
- Undefined site
Mucin / Rana palustris
- Undefined site
Mucin / Rana temporaria
- Undefined site
Mucin / Rana utricularia
- Undefined site
Mucin / Xenopus laevis
- Undefined site
Mucin / Xenopus tropicalis
- Undefined site
Toxin Aah6 / Androctonus australis hector
- Asn-9
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site

Mass spectrometry observed peptide

HFPFDQQNCTLK (12aa)
- Q8R493 Asn-165 Neuronal acetylcholine receptor subunit beta-4 / Mus musculus
EFILAPNDHFNNLPVNISLSDVQVPTNMYNK (31aa)
- Q9Z1L5 Asn-166 Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- P02760 Thr-252 Protein AMBP / Homo sapiens
- P02760 Asn-250 Protein AMBP / Homo sapiens
ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- P07911 Ser-292 Uromodulin / Homo sapiens
- P07911 Asn-275 Uromodulin / Homo sapiens
KNFTK (5aa)
- Q9EQG7 Asn-362 Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
SFLLSLAALHDNHTHSDIQVK (21aa)
- O35405 Asn-385 Phospholipase D3 / Mus musculus
ASVDSGSSEEQGGSSR (16aa)
- P01833 Ser-624 Polymeric immunoglobulin receptor / Homo sapiens
RGCKDNATDSVPLR (14aa)
- Q91ZX7 Asn-2128 Prolow-density lipoprotein receptor-related protein 1 / Mus musculus

- N-Linked / No-core (avg mass : 732.6907)
- N-Linked / No-core (avg mass : 732.6907)
- N-Linked / No-core (avg mass : 732.6907)
- O-Linked / Core 1 (avg mass : 732.6907)
- O-Linked / Core 1 (avg mass : 732.6907)
- O-Linked / Core 14 (avg mass : 732.6907)
- O-Linked / Core 2 (avg mass : 732.6907)
- O-Linked / Core 2 (avg mass : 732.6907)
- O-Linked / Core 2 (avg mass : 732.6907)
- O-Linked / Core 2 (avg mass : 732.6907)
- O-Linked / Core 3 (avg mass : 732.6907)
- O-Linked / Core 3 (avg mass : 732.6907)
- O-Linked / Core 3 (avg mass : 732.6907)
- O-Linked / Core 6 (avg mass : 732.6907)
- O-Linked / No-core (avg mass : 732.6907)
- O-Linked / Undefined core (avg mass : 732.6907)
- O-Linked / Undefined core (avg mass : 732.6907)
- O-Linked / Undefined core (avg mass : 732.6907)
- O-Linked / Undefined core (avg mass : 732.6907)

- Hex:1 HexNAc:2 dHex:1 / N-Linked (avg mass : 732.6907)
- Hex:1 HexNAc:2 dHex:1 / O-Linked (avg mass : 732.6907)