taxonomy (19)
protein (36)
source (23)
structure (21)
composition (1)
disease (9)
reference (48)
site (38)
peptide (8)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Ambystoma maculatum (Spotted salamander)
- Ambystoma mexicanum (Axolotl)
- Bufo arenarum
- Bufo bufo (European toad)
- Bufo japonicus (Japanese toad)
- Rana arvalis (Moor frog)
- Rana clamitans (Green frog)
- Rana palustris
- Rana temporaria (Common frog)
- Rana utricularia
- Xenopus laevis (African clawed frog)
- Xenopus tropicalis (Western clawed frog)
- Androctonus australis hector (Sahara scorpion)
- Apis mellifera (Honeybee)
Taxonomy
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Glycoprotein ln / Homo sapiens
- Glycoprotein rg / Homo sapiens
- Kappa casein / Homo sapiens P07498
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prosaposin / Homo sapiens P07602
- Protein AMBP / Homo sapiens P02760
- Uncharacterized protein from Seminal Fluid / Homo sapiens
- Unspecified mucin / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Mucin / Bos taurus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus Q9EQG7
- Muc2 / Mus musculus
- Neuronal acetylcholine receptor subunit beta-4 / Mus musculus Q8R493
- Phospholipase D3 / Mus musculus O35405
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus Q9Z1L5
- Mucin / Rattus norvegicus
- Mucin-2 glycopeptide a / Rattus norvegicus Q62635
- Mucin-2 glycopeptide b / Rattus norvegicus Q62635
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Mucin / Sus scrofa
- Mucin / Ambystoma maculatum
- Mucin / Ambystoma mexicanum
- Mucin / Bufo arenarum
- Mucin / Bufo bufo
- Uncharacterized protein / Bufo japonicus
- Mucin / Rana arvalis
- Mucin / Rana clamitans
- Mucin / Rana palustris
- Mucin / Rana temporaria
- Mucin / Rana utricularia
- Mucin / Xenopus laevis
- Mucin / Xenopus tropicalis
- Toxin Aah6 / Androctonus australis hector P56743
- Hyaluronoglucosaminidase / Apis mellifera Q08169
Protein
- Brain (UBERON_0000955)
- Duodenal Gland (UBERON_0001212)
- Intestinal Mucosa
- Kidney (UBERON_0002113)
- Large Intestine (UBERON_0000059)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Seminal Fluid (UBERON_0006530)
- Small Intestine (UBERON_0002108)
- Striatum (UBERON_0002345)
- Submandibular Gland (UBERON_0001736)
- Substantia Nigra (UBERON_0002038)
- Tracheal Mucosa (UBERON_0000379)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- HEK293 (CVCL_0045)
- SW48 (CVCL_1724)
- Egg Cell Jelly Coat
Source
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- O-Linked / Core 1 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)GalNAc
- O-Linked / Core 1 / Structure 11381
- O-Linked / Core 14 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-?)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 3 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)GalNAc
- O-Linked / Core 3 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)GalNAc
- O-Linked / Core 3 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)GalNAc
- O-Linked / Core 6 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)GalNAc
- O-Linked / No-core / GlcNAc(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal
- O-Linked / O-Man / Structure 11450
- O-Linked / Undefined core / Fuc(?1-2)[GalNAc(?1-3)]Gal(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)[GlcNAc(?1-6)]GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)GlcNAc(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-4)GlcNAc(?1-3)GalNAc
Reported structure
- Hex:1 HexNAc:2 dHex:1 (avg mass : 732.6907 )
Composition
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, Ovarian (Cystic) (DOID:2394)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Gangliosidosis GM1 (DOID:3322)
- Parkinson's disease (DOID:14330)
- Prostate cancer (DOID:10283)
Disease
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- Species specificity of O-linked carbohydrate chains of the oviducal mucins in amphibians: structural analysis of neutral oligosaccharide alditols released by reductive beta-elimination from the egg-jelly coats of Rana clamitans. (2002 - Delplace F, Maes E, Lemoine J, Strecker G) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
- Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
- Structural analysis of 13 neutral oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana temporaria (1999 - Coppin, Maes, Morelle, Strecker) / Status : Reviewed
- Acquisition of species-specific O-linked carbohydrate chains from oviducal mucins in Rana arvalis. A case study (1999 - Coppin, Maes, Flahaut, Coddeville, Strecker) / Status : Reviewed
- Structural analysis of a new series of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana utricularia. (1998 - Morelle W, Strecker G) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
- Structure of the major neutral oligosaccharide-alditols released from the egg jelly coats of Axolotl maculatum. Characterization of the carbohydrate sequence GalNAc(beta 1-4)[Fuc(alpha 1-3)] GlcNAc(beta 1-3/6). (1994 - Strecker G, Wieruszeski J, Fontaine M, Plancke Y) / Status : Reviewed
- Isolation, structural determination, and calcium-binding properties of the major glycoprotein present in Bufo japonicus japonicus egg jelly. (1994 - Shimoda Y, Kitajima K, Inoue S, Inoue Y) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Primary structure of neutral and acidic oligosaccharide-alditols derived from the jelly coat of the Mexican axolotl. Occurence of oliogsaccharides with fucosyl(alpha 1-3)fucosyl(alpha 1-4)-3-deoxy-D-glycero-D-galacto-nonulosonic acid and galactosyl(alpha 1-4)[fucosyl(alpha 1-2)]galactosyl(beta 1-4)- (1992 - Strecker G, Wieruszeski J, Michalski J, Alonso C, Leroy Y, Boilly B, Montreuil J) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Chemical structure of neutral sugar chains isolated from human mature milk kappa-casein. (1988 - Saito T, Itoh T, Adachi S) / Status : Reviewed
- The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
- Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
- Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
- Structure determination of oligosaccharides isolated from A+, H+ and A-H- hog-submaxillary-gland mucin glycoproteins, by 360-MHz 1H-NMR spectroscopy, permethylation analysis and mass spectrometry. (1981 - van Halbeek H, Dorland L, Haverkamp J, Veldink G, Vliegenthart J, Fournet B, Ricart G, Montreuil J, Gathmann W, Aminoff D) / Status : Reviewed
- Glycoproteins and blood group activity. Oligosaccharides of A+ hog submaxillary glycoproteins. (1979 - Aminoff D, Baig MM, Gathmann WD) / Status : Reviewed
- Structure of some oligosaccharides derived from rat-intestinal glycoproteins. (1978 - Carlsson H, Sundblad G, Hammarstrm S, Lnngren J) / Status : Reviewed
- Structures and immunochemical properties of oligosaccharides isolated from pig submaxillary mucins. (1968 - Carlson D) / Status : Reviewed
- Physical and chemical studies on glycoproteins. II. Isolation and characterization of oligosaccharides from porcine submaxillary glycoproteins. (1968 - Katzman RL, Eylar EH) / Status : Reviewed
Reference
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Kappa casein / Homo sapiens
- Undefined site
- Polymeric immunoglobulin receptor / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Protein AMBP / Homo sapiens
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
-
Mucin / Bos taurus
- Undefined site
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
-
Muc2 / Mus musculus
- Undefined site
- Neuronal acetylcholine receptor subunit beta-4 / Mus musculus
- Phospholipase D3 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Mucin / Ambystoma maculatum
- Undefined site
-
Mucin / Ambystoma mexicanum
- Undefined site
-
Mucin / Bufo arenarum
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Uncharacterized protein / Bufo japonicus
- Undefined site
-
Mucin / Rana arvalis
- Undefined site
-
Mucin / Rana clamitans
- Undefined site
-
Mucin / Rana palustris
- Undefined site
-
Mucin / Rana temporaria
- Undefined site
-
Mucin / Rana utricularia
- Undefined site
-
Mucin / Xenopus laevis
- Undefined site
-
Mucin / Xenopus tropicalis
- Undefined site
- Toxin Aah6 / Androctonus australis hector
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
Reported glycosite
-
- N-Linked / No-core
(avg mass : 732.6907)
- Venom (UBERON_0007113)
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
-
- N-Linked / No-core
(avg mass : 732.6907)
- Gangliosidosis GM1 (DOID:3322)
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
- N-Linked / No-core
(avg mass : 732.6907)
- Venom (UBERON_0007113)
- Toxin Aah6 / Androctonus australis hector
-
- O-Linked / Core 1
(avg mass : 732.6907)
- Intestinal Mucosa
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Submandibular Gland (UBERON_0001736)
- SW48 (CVCL_1724)
- Egg Cell Jelly Coat
- Cancer, Ovarian (Cystic) (DOID:2394)
- Colon adenocarcinoma (DOID:234)
- Cystic Fibrosis (DOID:1485)
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
- Structural analysis of a new series of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana utricularia. (1998 - Morelle W, Strecker G) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- The determination of the structure of blood group oligosaccharides from fully assigned 1H-n.m.r. spectra for solutions in non-aqueous solvents. (1988 - Rao B, Bush C) / Status : Reviewed
- Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
- Structure determination of oligosaccharides isolated from A+, H+ and A-H- hog-submaxillary-gland mucin glycoproteins, by 360-MHz 1H-NMR spectroscopy, permethylation analysis and mass spectrometry. (1981 - van Halbeek H, Dorland L, Haverkamp J, Veldink G, Vliegenthart J, Fournet B, Ricart G, Montreuil J, Gathmann W, Aminoff D) / Status : Reviewed
- Glycoproteins and blood group activity. Oligosaccharides of A+ hog submaxillary glycoproteins. (1979 - Aminoff D, Baig MM, Gathmann WD) / Status : Reviewed
- Structure of some oligosaccharides derived from rat-intestinal glycoproteins. (1978 - Carlsson H, Sundblad G, Hammarstrm S, Lnngren J) / Status : Reviewed
- Structures and immunochemical properties of oligosaccharides isolated from pig submaxillary mucins. (1968 - Carlson D) / Status : Reviewed
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Mucin / Bufo arenarum
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Rana utricularia
- Undefined site
-
Mucin / Xenopus tropicalis
- Undefined site
-
- O-Linked / Core 1
(avg mass : 732.6907)
- Egg Cell Jelly Coat
-
Mucin / Xenopus tropicalis
- Undefined site
-
- O-Linked / Core 1
(avg mass : 732.6907)
-
- O-Linked / Core 14
(avg mass : 732.6907)
-
Mucin / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 732.6907)
- Duodenal Gland (UBERON_0001212)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Striatum (UBERON_0002345)
- Submandibular Gland (UBERON_0001736)
- Substantia Nigra (UBERON_0002038)
- Tracheal Mucosa (UBERON_0000379)
- Egg Cell Jelly Coat
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, Ovarian (Cystic) (DOID:2394)
- Control/Healthy
- Cystic Fibrosis (DOID:1485)
- Parkinson's disease (DOID:14330)
- The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
- Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Acquisition of species-specific O-linked carbohydrate chains from oviducal mucins in Rana arvalis. A case study (1999 - Coppin, Maes, Flahaut, Coddeville, Strecker) / Status : Reviewed
- Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
- Structural analysis of 13 neutral oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana temporaria (1999 - Coppin, Maes, Morelle, Strecker) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
- Isolation, structural determination, and calcium-binding properties of the major glycoprotein present in Bufo japonicus japonicus egg jelly. (1994 - Shimoda Y, Kitajima K, Inoue S, Inoue Y) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Terminal alpha (1 leads to 4)-linked N-acetylglucosamine: a characteristic constituent of duodenal-gland mucous glycoproteins in rat and pig. A high-resolution 1H-NMR study. (1983 - van Halbeek H, Gerwig G, Vliegenthart J, Smits H, Van Kerkhof P, Kramer M) / Status : Reviewed
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Muc2 / Mus musculus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Mucin / Bufo arenarum
- Undefined site
-
Uncharacterized protein / Bufo japonicus
- Undefined site
-
Mucin / Rana arvalis
- Undefined site
-
Mucin / Rana palustris
- Undefined site
-
Mucin / Rana temporaria
- Undefined site
-
Mucin / Xenopus laevis
- Undefined site
-
Mucin / Xenopus tropicalis
- Undefined site
-
- O-Linked / Core 2
(avg mass : 732.6907)
- The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
- Species specificity of O-linked carbohydrate chains of the oviducal mucins in amphibians: structural analysis of neutral oligosaccharide alditols released by reductive beta-elimination from the egg-jelly coats of Rana clamitans. (2002 - Delplace F, Maes E, Lemoine J, Strecker G) / Status : Reviewed
-
Mucin / Rana clamitans
- Undefined site
-
- O-Linked / Core 2
(avg mass : 732.6907)
- Milk (UBERON_0001913)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Chemical structure of neutral sugar chains isolated from human mature milk kappa-casein. (1988 - Saito T, Itoh T, Adachi S) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Kappa casein / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 732.6907)
- Pulmonary Mucosa
- Cystic Fibrosis (DOID:1485)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 3
(avg mass : 732.6907)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, Ovarian (Cystic) (DOID:2394)
- Cystic Fibrosis (DOID:1485)
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 3
(avg mass : 732.6907)
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Primary structure of neutral and acidic oligosaccharide-alditols derived from the jelly coat of the Mexican axolotl. Occurence of oliogsaccharides with fucosyl(alpha 1-3)fucosyl(alpha 1-4)-3-deoxy-D-glycero-D-galacto-nonulosonic acid and galactosyl(alpha 1-4)[fucosyl(alpha 1-2)]galactosyl(beta 1-4)- (1992 - Strecker G, Wieruszeski J, Michalski J, Alonso C, Leroy Y, Boilly B, Montreuil J) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Mucin / Ambystoma mexicanum
- Undefined site
-
- O-Linked / Core 3
(avg mass : 732.6907)
- Saliva (UBERON_0001836)
- Egg Cell Jelly Coat
- Structure of the major neutral oligosaccharide-alditols released from the egg jelly coats of Axolotl maculatum. Characterization of the carbohydrate sequence GalNAc(beta 1-4)[Fuc(alpha 1-3)] GlcNAc(beta 1-3/6). (1994 - Strecker G, Wieruszeski J, Fontaine M, Plancke Y) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Ambystoma maculatum
- Undefined site
-
- O-Linked / Core 6
(avg mass : 732.6907)
- Seminal Fluid (UBERON_0006530)
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
- O-Linked / No-core
(avg mass : 732.6907)
- Egg Cell Jelly Coat
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
-
Mucin / Xenopus laevis
- Undefined site
-
- O-Linked / O-Man
(avg mass : 732.6907)
- Substantia Nigra (UBERON_0002038)
- Parkinson's disease (DOID:14330)
-
- O-Linked / Undefined core
(avg mass : 732.6907)
- Large Intestine (UBERON_0000059)
- Small Intestine (UBERON_0002108)
- Submandibular Gland (UBERON_0001736)
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
-
Mucin / Bos taurus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 732.6907)
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 732.6907)
- Small Intestine (UBERON_0002108)
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 732.6907)
- Small Intestine (UBERON_0002108)
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- Hex:1 HexNAc:2 dHex:1 / N-Linked
(avg mass : 732.6907)
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- Prostate cancer (DOID:10283)
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Protein AMBP / Homo sapiens
- Uromodulin / Homo sapiens
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Neuronal acetylcholine receptor subunit beta-4 / Mus musculus
- Phospholipase D3 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
- HFPFDQQNCTLK (12aa)
- EFILAPNDHFNNLPVNISLSDVQVPTNMYNK (31aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- KNFTK (5aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- RGCKDNATDSVPLR (14aa)
-
- Hex:1 HexNAc:2 dHex:1 / O-Linked
(avg mass : 732.6907)
- Urine (UBERON_0001088)
- O-Linked / Core 1 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)GalNAc
- O-Linked / Core 1 / Structure 11381
- O-Linked / Core 14 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-?)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 3 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)GalNAc
- O-Linked / Core 3 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)GalNAc
- O-Linked / Core 3 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)GalNAc
- O-Linked / Core 6 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)GalNAc
- O-Linked / No-core / GlcNAc(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal
- O-Linked / O-Man / Structure 11450
- O-Linked / Undefined core / Fuc(?1-2)[GalNAc(?1-3)]Gal(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)[GlcNAc(?1-6)]GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-3)GlcNAc(?1-3)GalNAc
- O-Linked / Undefined core / Fuc(?1-2)Gal(?1-4)GlcNAc(?1-3)GalNAc
- Prostate cancer (DOID:10283)
- Polymeric immunoglobulin receptor / Homo sapiens
- Protein AMBP / Homo sapiens
- Uromodulin / Homo sapiens
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- ASVDSGSSEEQGGSSR (16aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:1 HexNAc:2 dHex:1 / O-Linked
(avg mass : 732.6907)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:1 HexNAc:2 dHex:1 / N-Linked
(avg mass : 732.6907)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 732.6907)
Source
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 732.6907)
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 732.6907)
Source
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 732.6907)
Source
Disease
Reported glycosite
- O-Linked / O-Man
(avg mass : 732.6907)
Source
Reference
Reported glycosite
- O-Linked / No-core
(avg mass : 732.6907)
Source
Reported glycosite
- O-Linked / Core 6
(avg mass : 732.6907)
Source
Reference
Reported glycosite
- O-Linked / Core 3
(avg mass : 732.6907)
Reference
Reported glycosite
- O-Linked / Core 3
(avg mass : 732.6907)
Disease
Reference
Reported glycosite
- O-Linked / Core 3
(avg mass : 732.6907)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 732.6907)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 732.6907)
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 732.6907)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 732.6907)
Reported glycosite
- O-Linked / Core 14
(avg mass : 732.6907)
Reported glycosite
- O-Linked / Core 1
(avg mass : 732.6907)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 732.6907)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 732.6907)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 732.6907)
Disease
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 732.6907)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 732.6907)